BLASTX nr result
ID: Acanthopanax23_contig00005377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00005377 (676 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017224810.1| PREDICTED: keratin, type I cytoskeletal 9-li... 56 5e-06 >ref|XP_017224810.1| PREDICTED: keratin, type I cytoskeletal 9-like [Daucus carota subsp. sativus] Length = 213 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 572 VKGAGKNDGFHEIKMSHNGGAGGRNLGQMGQMGNF 676 VKGA K+DGFH++K SHNGGA GR +GQMGQMG++ Sbjct: 62 VKGAAKHDGFHDMK-SHNGGAAGRPMGQMGQMGSY 95