BLASTX nr result
ID: Acanthopanax23_contig00004958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00004958 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017255854.1| PREDICTED: BTB/POZ domain-containing protein... 92 5e-19 ref|XP_017255853.1| PREDICTED: BTB/POZ domain-containing protein... 92 6e-19 ref|XP_018853882.1| PREDICTED: BTB/POZ domain-containing protein... 84 4e-16 ref|XP_018853880.1| PREDICTED: BTB/POZ domain-containing protein... 84 4e-16 ref|XP_017969321.1| PREDICTED: BTB/POZ domain-containing protein... 84 5e-16 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theob... 84 5e-16 ref|XP_023922577.1| BTB/POZ domain-containing protein SR1IP1-lik... 84 7e-16 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis] 83 1e-15 ref|XP_010086959.2| BTB/POZ domain-containing protein SR1IP1 [Mo... 83 1e-15 gb|KYP52407.1| BTB/POZ domain-containing protein At5g48800 famil... 83 1e-15 gb|KRH28379.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 gb|KRH28381.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 gb|KRH28383.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 gb|KRH28385.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 ref|XP_020230341.1| BTB/POZ domain-containing protein At5g67385 ... 83 1e-15 ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phas... 83 1e-15 ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein... 83 1e-15 gb|KRH28382.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein... 83 1e-15 gb|KRH28386.1| hypothetical protein GLYMA_11G049800 [Glycine max] 83 1e-15 >ref|XP_017255854.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X2 [Daucus carota subsp. sativus] Length = 558 Score = 92.4 bits (228), Expect = 5e-19 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = -2 Query: 434 KPTDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPP 255 + T SSPN PL +T+PS+ KPPL KSIINS+SKKLGRLNLFVRADGTTPS + + +P Sbjct: 492 RKTVKSSPNTPLVITYPSADKPPLAPKSIINSMSKKLGRLNLFVRADGTTPS-RVQNRPS 550 Query: 254 KDRRHSIS 231 KDRRHS+S Sbjct: 551 KDRRHSMS 558 >ref|XP_017255853.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X1 [Daucus carota subsp. sativus] gb|KZM91166.1| hypothetical protein DCAR_021469 [Daucus carota subsp. sativus] Length = 624 Score = 92.4 bits (228), Expect = 6e-19 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = -2 Query: 434 KPTDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPP 255 + T SSPN PL +T+PS+ KPPL KSIINS+SKKLGRLNLFVRADGTTPS + + +P Sbjct: 558 RKTVKSSPNTPLVITYPSADKPPLAPKSIINSMSKKLGRLNLFVRADGTTPS-RVQNRPS 616 Query: 254 KDRRHSIS 231 KDRRHS+S Sbjct: 617 KDRRHSMS 624 >ref|XP_018853882.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X2 [Juglans regia] ref|XP_018807674.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X2 [Juglans regia] ref|XP_018817546.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X2 [Juglans regia] Length = 599 Score = 84.3 bits (207), Expect = 4e-16 Identities = 41/68 (60%), Positives = 52/68 (76%) Frame = -2 Query: 434 KPTDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPP 255 + T +SS + P++ PS+ KPPLPRKS I+SVSKKLGRL+ F+R+DG T + GR KP Sbjct: 532 RSTHSSSVSSPMKNALPSADKPPLPRKSFISSVSKKLGRLSPFIRSDGATANIIGRMKPN 591 Query: 254 KDRRHSIS 231 KDRRHSIS Sbjct: 592 KDRRHSIS 599 >ref|XP_018853880.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X1 [Juglans regia] ref|XP_018807673.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X1 [Juglans regia] ref|XP_018817545.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform X1 [Juglans regia] Length = 632 Score = 84.3 bits (207), Expect = 4e-16 Identities = 41/68 (60%), Positives = 52/68 (76%) Frame = -2 Query: 434 KPTDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPP 255 + T +SS + P++ PS+ KPPLPRKS I+SVSKKLGRL+ F+R+DG T + GR KP Sbjct: 565 RSTHSSSVSSPMKNALPSADKPPLPRKSFISSVSKKLGRLSPFIRSDGATANIIGRMKPN 624 Query: 254 KDRRHSIS 231 KDRRHSIS Sbjct: 625 KDRRHSIS 632 >ref|XP_017969321.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Theobroma cacao] Length = 623 Score = 84.0 bits (206), Expect = 5e-16 Identities = 42/64 (65%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = -2 Query: 419 SSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPST-KGRAKPPKDRR 243 S+ + P+ + PSS KPPLPRKS +NSVSKKLGRL FVR+DG +PS+ KGR +P KDRR Sbjct: 560 SAVSSPMGIILPSSDKPPLPRKSFMNSVSKKLGRLYPFVRSDGVSPSSAKGRTRPSKDRR 619 Query: 242 HSIS 231 HSIS Sbjct: 620 HSIS 623 >gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao] Length = 623 Score = 84.0 bits (206), Expect = 5e-16 Identities = 42/64 (65%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = -2 Query: 419 SSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPST-KGRAKPPKDRR 243 S+ + P+ + PSS KPPLPRKS +NSVSKKLGRL FVR+DG +PS+ KGR +P KDRR Sbjct: 560 SAVSSPMGIILPSSDKPPLPRKSFMNSVSKKLGRLYPFVRSDGVSPSSAKGRTRPSKDRR 619 Query: 242 HSIS 231 HSIS Sbjct: 620 HSIS 623 >ref|XP_023922577.1| BTB/POZ domain-containing protein SR1IP1-like [Quercus suber] gb|POE97793.1| btb/poz domain-containing protein [Quercus suber] Length = 632 Score = 83.6 bits (205), Expect = 7e-16 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -2 Query: 419 SSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKDRRH 240 SS + P++ T PS+ KPPLPRKS INS+S+KLGRL FVRADGT +TKGR K ++RRH Sbjct: 570 SSVSSPMQNTLPSADKPPLPRKSFINSMSRKLGRLYPFVRADGTPGNTKGRTKSSRNRRH 629 Query: 239 SIS 231 SIS Sbjct: 630 SIS 632 >gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 624 Score = 83.2 bits (204), Expect = 1e-15 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -2 Query: 419 SSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKDRRH 240 S+ N P + S+ KPP PRKS +NSVSK+LGRL FVR+DG TPS KGR KP KDRRH Sbjct: 562 SAVNSPQSVIMSSADKPPRPRKSFMNSVSKRLGRLYPFVRSDGVTPSYKGRTKPSKDRRH 621 Query: 239 SIS 231 SIS Sbjct: 622 SIS 624 >ref|XP_010086959.2| BTB/POZ domain-containing protein SR1IP1 [Morus notabilis] Length = 635 Score = 83.2 bits (204), Expect = 1e-15 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -2 Query: 419 SSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKDRRH 240 S+ N P + S+ KPP PRKS +NSVSK+LGRL FVR+DG TPS KGR KP KDRRH Sbjct: 573 SAVNSPQSVIMSSADKPPRPRKSFMNSVSKRLGRLYPFVRSDGVTPSYKGRTKPSKDRRH 632 Query: 239 SIS 231 SIS Sbjct: 633 SIS 635 >gb|KYP52407.1| BTB/POZ domain-containing protein At5g48800 family [Cajanus cajan] Length = 591 Score = 82.8 bits (203), Expect = 1e-15 Identities = 42/66 (63%), Positives = 48/66 (72%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P PS+ KPPLPR+S I+SVSKKLGRL+ FVRADG P KGR KP K+ Sbjct: 526 TLKSAGNSPAVSASPSADKPPLPRRSFISSVSKKLGRLSPFVRADGVAPFAKGRTKPNKN 585 Query: 248 RRHSIS 231 RRHSIS Sbjct: 586 RRHSIS 591 >gb|KRH28379.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 596 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 531 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 590 Query: 248 RRHSIS 231 RRHSIS Sbjct: 591 RRHSIS 596 >gb|KRH28381.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 598 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 533 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 592 Query: 248 RRHSIS 231 RRHSIS Sbjct: 593 RRHSIS 598 >gb|KRH28383.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 606 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 541 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 600 Query: 248 RRHSIS 231 RRHSIS Sbjct: 601 RRHSIS 606 >gb|KRH28385.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 608 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 543 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 602 Query: 248 RRHSIS 231 RRHSIS Sbjct: 603 RRHSIS 608 >ref|XP_020230341.1| BTB/POZ domain-containing protein At5g67385 [Cajanus cajan] Length = 616 Score = 82.8 bits (203), Expect = 1e-15 Identities = 42/66 (63%), Positives = 48/66 (72%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P PS+ KPPLPR+S I+SVSKKLGRL+ FVRADG P KGR KP K+ Sbjct: 551 TLKSAGNSPAVSASPSADKPPLPRRSFISSVSKKLGRLSPFVRADGVAPFAKGRTKPNKN 610 Query: 248 RRHSIS 231 RRHSIS Sbjct: 611 RRHSIS 616 >ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris] ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris] gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris] gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris] Length = 617 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 48/66 (72%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG P KGR KP K+ Sbjct: 552 TPKSAVNSPAVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVAPFAKGRTKPNKN 611 Query: 248 RRHSIS 231 RRHSIS Sbjct: 612 RRHSIS 617 >ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform X2 [Glycine max] gb|KRH28380.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 618 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 553 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 612 Query: 248 RRHSIS 231 RRHSIS Sbjct: 613 RRHSIS 618 >gb|KRH28382.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 620 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 555 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 614 Query: 248 RRHSIS 231 RRHSIS Sbjct: 615 RRHSIS 620 >ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform X1 [Glycine max] gb|KRH28384.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 628 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 563 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 622 Query: 248 RRHSIS 231 RRHSIS Sbjct: 623 RRHSIS 628 >gb|KRH28386.1| hypothetical protein GLYMA_11G049800 [Glycine max] Length = 630 Score = 82.8 bits (203), Expect = 1e-15 Identities = 41/66 (62%), Positives = 50/66 (75%) Frame = -2 Query: 428 TDNSSPNPPLELTFPSSGKPPLPRKSIINSVSKKLGRLNLFVRADGTTPSTKGRAKPPKD 249 T S+ N P+ PS+ KPPLPR+S ++SVSKKLGRL+ FVRADG +P KGR KP K+ Sbjct: 565 TLKSTVNSPVVSASPSADKPPLPRRSFMSSVSKKLGRLSPFVRADGVSPFAKGRTKPNKN 624 Query: 248 RRHSIS 231 RRHSIS Sbjct: 625 RRHSIS 630