BLASTX nr result
ID: Acanthopanax23_contig00004933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00004933 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF22900.1|AC006932_17 T27G7.17 [Arabidopsis thaliana] 65 4e-09 ref|XP_023874787.1| cysteine desulfurase 1, chloroplastic isofor... 63 1e-08 gb|KZM91212.1| hypothetical protein DCAR_021423 [Daucus carota s... 63 1e-08 ref|XP_017214954.1| PREDICTED: cysteine desulfurase 1, chloropla... 63 1e-08 ref|XP_022576306.1| cysteine desulfurase 1, chloroplastic [Brass... 62 1e-08 ref|XP_023874786.1| cysteine desulfurase 1, chloroplastic isofor... 63 1e-08 ref|XP_018833108.1| PREDICTED: cysteine desulfurase 1, chloropla... 63 2e-08 pdb|4Q76|A Chain A, Crystal structure of Nfs2 C384S mutant, the ... 62 3e-08 pdb|4Q75|A Chain A, Crystal Structure Of Nfs2, The Plastidial Cy... 62 3e-08 gb|KFK43169.1| hypothetical protein AALP_AA1G088700 [Arabis alpina] 62 3e-08 ref|XP_013586149.1| PREDICTED: cysteine desulfurase 1, chloropla... 62 3e-08 ref|XP_013710946.1| cysteine desulfurase 1, chloroplastic [Brass... 62 3e-08 ref|NP_172325.2| chloroplastic NIFS-like cysteine desulfurase [A... 62 3e-08 ref|XP_020866921.1| cysteine desulfurase 1, chloroplastic [Arabi... 62 3e-08 ref|XP_018490620.1| PREDICTED: cysteine desulfurase 1, chloropla... 62 4e-08 gb|POO01516.1| Cysteine desulfurase [Trema orientalis] 62 5e-08 ref|XP_011072902.1| cysteine desulfurase 1, chloroplastic isofor... 61 6e-08 ref|XP_011072901.1| cysteine desulfurase 1, chloroplastic isofor... 61 7e-08 ref|XP_006417682.1| cysteine desulfurase 1, chloroplastic [Eutre... 61 7e-08 gb|EYU40686.1| hypothetical protein MIMGU_mgv1a0062341mg, partia... 61 8e-08 >gb|AAF22900.1|AC006932_17 T27G7.17 [Arabidopsis thaliana] Length = 526 Score = 64.7 bits (156), Expect = 4e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 262 LTIIILCFVASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 LT + C +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 231 LTYVSFC-LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 270 >ref|XP_023874787.1| cysteine desulfurase 1, chloroplastic isoform X2 [Quercus suber] Length = 446 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPI+EIVLWAHDVGAKVLVDACQSVPH++ Sbjct: 256 LASVLPIEEIVLWAHDVGAKVLVDACQSVPHMV 288 >gb|KZM91212.1| hypothetical protein DCAR_021423 [Daucus carota subsp. sativus] Length = 467 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPI+EIVLWAHDVGAKVLVDACQSVPH++ Sbjct: 230 LASVLPIEEIVLWAHDVGAKVLVDACQSVPHMV 262 >ref|XP_017214954.1| PREDICTED: cysteine desulfurase 1, chloroplastic [Daucus carota subsp. sativus] Length = 468 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPI+EIVLWAHDVGAKVLVDACQSVPH++ Sbjct: 231 LASVLPIEEIVLWAHDVGAKVLVDACQSVPHMV 263 >ref|XP_022576306.1| cysteine desulfurase 1, chloroplastic [Brassica napus] Length = 259 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 22 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 54 >ref|XP_023874786.1| cysteine desulfurase 1, chloroplastic isoform X1 [Quercus suber] gb|POE83122.1| cysteine desulfurase 1, chloroplastic [Quercus suber] Length = 493 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPI+EIVLWAHDVGAKVLVDACQSVPH++ Sbjct: 256 LASVLPIEEIVLWAHDVGAKVLVDACQSVPHMV 288 >ref|XP_018833108.1| PREDICTED: cysteine desulfurase 1, chloroplastic [Juglans regia] Length = 485 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHI 381 +AS LPI+EIVLWAHDVGAKVLVDACQSVPH+ Sbjct: 248 LASVLPIEEIVLWAHDVGAKVLVDACQSVPHM 279 >pdb|4Q76|A Chain A, Crystal structure of Nfs2 C384S mutant, the plastidial cysteine desulfurase from Arabidopsis thaliana pdb|4Q76|B Chain B, Crystal structure of Nfs2 C384S mutant, the plastidial cysteine desulfurase from Arabidopsis thaliana Length = 429 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 192 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 224 >pdb|4Q75|A Chain A, Crystal Structure Of Nfs2, The Plastidial Cysteine Desulfurase From Arabidopsis Thaliana pdb|4Q75|B Chain B, Crystal Structure Of Nfs2, The Plastidial Cysteine Desulfurase From Arabidopsis Thaliana Length = 429 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 192 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 224 >gb|KFK43169.1| hypothetical protein AALP_AA1G088700 [Arabis alpina] Length = 460 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 223 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 255 >ref|XP_013586149.1| PREDICTED: cysteine desulfurase 1, chloroplastic [Brassica oleracea var. oleracea] Length = 463 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 226 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 258 >ref|XP_013710946.1| cysteine desulfurase 1, chloroplastic [Brassica napus] Length = 463 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 226 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 258 >ref|NP_172325.2| chloroplastic NIFS-like cysteine desulfurase [Arabidopsis thaliana] sp|Q93WX6.1|CNIF1_ARATH RecName: Full=Cysteine desulfurase 1, chloroplastic; AltName: Full=NIFS-like protein 1; Short=CpNifS1; AltName: Full=Plastid sufS-like protein; AltName: Full=Protein AtCpNifS; AltName: Full=Selenocysteine lyase; Flags: Precursor gb|AAL14994.1|AF419347_1 NIFS-like protein CpNifsp precursor [Arabidopsis thaliana] gb|AAM19798.1| At1g08490/T27G7_14 [Arabidopsis thaliana] gb|AAN31104.1| At1g08490/T27G7_14 [Arabidopsis thaliana] gb|AAL79956.1| cysteine desulfurase [Arabidopsis thaliana] gb|AEE28298.1| chloroplastic NIFS-like cysteine desulfurase [Arabidopsis thaliana] gb|OAP16593.1| SUFS [Arabidopsis thaliana] Length = 463 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 226 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 258 >ref|XP_020866921.1| cysteine desulfurase 1, chloroplastic [Arabidopsis lyrata subsp. lyrata] gb|EFH68719.1| hypothetical protein ARALYDRAFT_470910 [Arabidopsis lyrata subsp. lyrata] Length = 466 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI+EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 229 LASSLPIEEIVVWAHDVGAKVLVDACQSVPHMV 261 >ref|XP_018490620.1| PREDICTED: cysteine desulfurase 1, chloroplastic [Raphanus sativus] Length = 463 Score = 62.0 bits (149), Expect = 4e-08 Identities = 26/33 (78%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LP++EIV+WAHDVGAKVLVDACQSVPH++ Sbjct: 226 LASSLPVEEIVVWAHDVGAKVLVDACQSVPHMV 258 >gb|POO01516.1| Cysteine desulfurase [Trema orientalis] Length = 472 Score = 61.6 bits (148), Expect = 5e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LP+++IVLWAHDVGAKVLVDACQSVPH++ Sbjct: 235 LASVLPVEDIVLWAHDVGAKVLVDACQSVPHMV 267 >ref|XP_011072902.1| cysteine desulfurase 1, chloroplastic isoform X2 [Sesamum indicum] Length = 411 Score = 61.2 bits (147), Expect = 6e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPID+IV WAHDVGAKVLVDACQSVPH++ Sbjct: 228 LASVLPIDQIVSWAHDVGAKVLVDACQSVPHMV 260 >ref|XP_011072901.1| cysteine desulfurase 1, chloroplastic isoform X1 [Sesamum indicum] Length = 465 Score = 61.2 bits (147), Expect = 7e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPID+IV WAHDVGAKVLVDACQSVPH++ Sbjct: 228 LASVLPIDQIVSWAHDVGAKVLVDACQSVPHMV 260 >ref|XP_006417682.1| cysteine desulfurase 1, chloroplastic [Eutrema salsugineum] gb|ESQ36035.1| hypothetical protein EUTSA_v10007548mg [Eutrema salsugineum] Length = 468 Score = 61.2 bits (147), Expect = 7e-08 Identities = 26/33 (78%), Positives = 33/33 (100%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS+LPI++IV+WAHDVGAKVLVDACQSVPH++ Sbjct: 231 LASSLPIEDIVVWAHDVGAKVLVDACQSVPHMV 263 >gb|EYU40686.1| hypothetical protein MIMGU_mgv1a0062341mg, partial [Erythranthe guttata] Length = 336 Score = 60.8 bits (146), Expect = 8e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +1 Query: 286 VASALPIDEIVLWAHDVGAKVLVDACQSVPHIL 384 +AS LPIDEIV WAH+VGAKVLVDACQSVPH++ Sbjct: 224 LASVLPIDEIVSWAHEVGAKVLVDACQSVPHMV 256