BLASTX nr result
ID: Acanthopanax23_contig00004898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00004898 (937 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017248423.1| PREDICTED: OTU domain-containing protein DDB... 234 3e-73 ref|XP_024182231.1| OTU domain-containing protein DDB_G0284757 i... 220 1e-67 ref|XP_010112865.2| OTU domain-containing protein DDB_G0284757 [... 220 1e-67 emb|CDP16038.1| unnamed protein product [Coffea canephora] 218 8e-67 ref|XP_004303938.1| PREDICTED: OTU domain-containing protein DDB... 216 3e-66 ref|XP_016492245.1| PREDICTED: OTU domain-containing protein DDB... 216 3e-66 ref|XP_020995345.1| OTU domain-containing protein DDB_G0284757 i... 216 4e-66 ref|XP_019226896.1| PREDICTED: OTU domain-containing protein DDB... 216 5e-66 ref|XP_015958421.1| OTU domain-containing protein DDB_G0284757 i... 216 5e-66 ref|XP_021828284.1| OTU domain-containing protein DDB_G0284757 [... 216 5e-66 ref|XP_009375336.1| PREDICTED: OTU domain-containing protein DDB... 216 5e-66 ref|XP_008378356.1| PREDICTED: OTU domain-containing protein DDB... 216 5e-66 ref|XP_008229666.1| PREDICTED: OTU domain-containing protein DDB... 216 5e-66 ref|XP_007215925.1| OTU domain-containing protein DDB_G0284757 i... 216 5e-66 ref|XP_020976027.1| OTU domain-containing protein DDB_G0284757 i... 215 6e-66 ref|XP_016197000.1| OTU domain-containing protein DDB_G0284757 i... 215 7e-66 ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB... 215 1e-65 gb|PHT48271.1| hypothetical protein CQW23_12479 [Capsicum baccatum] 215 1e-65 ref|XP_008342290.1| PREDICTED: OTU domain-containing protein DDB... 214 1e-65 gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium r... 212 2e-65 >ref|XP_017248423.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] ref|XP_017248424.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] ref|XP_017248425.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Daucus carota subsp. sativus] Length = 233 Score = 234 bits (598), Expect = 3e-73 Identities = 104/124 (83%), Positives = 116/124 (93%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLFHNPEYHKHVRKQVVKQLKHHR+LYEG++PMKY+SYLK MKRLGEWGDH+TLQAAA Sbjct: 106 ADQLFHNPEYHKHVRKQVVKQLKHHRKLYEGYIPMKYRSYLKTMKRLGEWGDHVTLQAAA 165 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRFSAKICL+TSFRD+ YIEI+PK+ NP RE+WLSFWSE+HYNSLYERG VP R KKKH Sbjct: 166 DRFSAKICLVTSFRDSGYIEIVPKEKNPIRELWLSFWSEIHYNSLYERGDVPVRAAKKKH 225 Query: 576 WYSL 565 WY+L Sbjct: 226 WYNL 229 >ref|XP_024182231.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Rosa chinensis] ref|XP_024182232.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Rosa chinensis] gb|PRQ52286.1| putative ubiquitinyl hydrolase 1 [Rosa chinensis] Length = 226 Score = 220 bits (560), Expect = 1e-67 Identities = 97/121 (80%), Positives = 109/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQV+KQLKHHR+LYE +VPMKYKSYL+ MK+ GEWGDHLTLQAAA Sbjct: 104 ADQLFRNPDYHKHVRKQVIKQLKHHRKLYEAYVPMKYKSYLRKMKKKGEWGDHLTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NP+RE+WLSFWSEVHYNSLY VP R+P+KKH Sbjct: 164 DRFGAKICLITSFRDTCYIEILPKDRNPTRELWLSFWSEVHYNSLYATADVPTRSPRKKH 223 Query: 576 W 574 W Sbjct: 224 W 224 >ref|XP_010112865.2| OTU domain-containing protein DDB_G0284757 [Morus notabilis] Length = 226 Score = 220 bits (560), Expect = 1e-67 Identities = 98/121 (80%), Positives = 110/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF +P+YHKHVRKQVVKQLKH+R+LYE +VPMKY+SYLK MK+ GEWGDH+TLQAAA Sbjct: 104 ADQLFRSPDYHKHVRKQVVKQLKHYRKLYESYVPMKYRSYLKKMKKSGEWGDHVTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NPSRE+WLSFWSEVHYNSLY G VP RTP+KKH Sbjct: 164 DRFEAKICLVTSFRDTCYIEILPKDKNPSREVWLSFWSEVHYNSLYATGDVPTRTPRKKH 223 Query: 576 W 574 W Sbjct: 224 W 224 >emb|CDP16038.1| unnamed protein product [Coffea canephora] Length = 245 Score = 218 bits (556), Expect = 8e-67 Identities = 99/121 (81%), Positives = 108/121 (89%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQVVKQLK +RLYEG+VPM+YK YLK MK+LGEWGDH+TLQAAA Sbjct: 123 ADQLFRNPDYHKHVRKQVVKQLKRFKRLYEGYVPMRYKDYLKKMKKLGEWGDHVTLQAAA 182 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NPSREIWLSFWSEVHYNSLYE G VP R PKK+ Sbjct: 183 DRFGAKICLVTSFRDTCYIEILPKDKNPSREIWLSFWSEVHYNSLYETGEVPTRVPKKRF 242 Query: 576 W 574 W Sbjct: 243 W 243 >ref|XP_004303938.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Fragaria vesca subsp. vesca] ref|XP_011467668.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Fragaria vesca subsp. vesca] Length = 228 Score = 216 bits (551), Expect = 3e-66 Identities = 95/121 (78%), Positives = 108/121 (89%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQV+KQLK HR+LYE +VPMKYKSYL+ MK+ GEWGDHLTLQAAA Sbjct: 106 ADQLFRNPDYHKHVRKQVIKQLKRHRKLYEAYVPMKYKSYLRKMKKKGEWGDHLTLQAAA 165 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKIC++TSFRDT Y+EI+PKD NP+RE+WLSFWSEVHYNSLY VP R+PKKKH Sbjct: 166 DRFGAKICVITSFRDTCYVEILPKDRNPTRELWLSFWSEVHYNSLYATADVPTRSPKKKH 225 Query: 576 W 574 W Sbjct: 226 W 226 >ref|XP_016492245.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana tabacum] ref|XP_018626745.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Nicotiana tomentosiformis] ref|XP_018626746.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Nicotiana tomentosiformis] Length = 233 Score = 216 bits (551), Expect = 3e-66 Identities = 96/121 (79%), Positives = 109/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 +DQL+HNPEYHKHVRK+VVKQLKH R+LYEG+VPM+YKSYL+ MKRLGEWGDH+TLQAAA Sbjct: 110 SDQLYHNPEYHKHVRKEVVKQLKHFRKLYEGYVPMRYKSYLRKMKRLGEWGDHVTLQAAA 169 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF KICL+TSFRD YI+I+PKD PSRE+WLSFWSEVHYNSLYE G VPAR +KKH Sbjct: 170 DRFGVKICLVTSFRDNGYIDILPKDIQPSRELWLSFWSEVHYNSLYEIGEVPARVRRKKH 229 Query: 576 W 574 W Sbjct: 230 W 230 >ref|XP_020995345.1| OTU domain-containing protein DDB_G0284757 isoform X2 [Arachis duranensis] Length = 222 Score = 216 bits (549), Expect = 4e-66 Identities = 96/121 (79%), Positives = 110/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVR+QV+KQLKHH++LYEG+VPMKYKSYLKMMK+ GEWGDH+TLQAAA Sbjct: 100 ADQLFRNPEYHKHVRRQVIKQLKHHKKLYEGYVPMKYKSYLKMMKKSGEWGDHITLQAAA 159 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF+AKICL+TSFRDT YIEI+P D N + E+WLSFWSEVHYNSLY G VPAR P+KK+ Sbjct: 160 DRFNAKICLVTSFRDTCYIEILPTDKNYTIELWLSFWSEVHYNSLYASGDVPARAPRKKY 219 Query: 576 W 574 W Sbjct: 220 W 220 >ref|XP_019226896.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana attenuata] gb|OIT31768.1| hypothetical protein A4A49_23535 [Nicotiana attenuata] Length = 233 Score = 216 bits (550), Expect = 5e-66 Identities = 96/121 (79%), Positives = 109/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 +DQL+HNPEYHKHVRK+VVKQLKH R+LYEG+VPM+YKSYL+ MKRLGEWGDH+TLQAAA Sbjct: 110 SDQLYHNPEYHKHVRKEVVKQLKHFRKLYEGYVPMRYKSYLRKMKRLGEWGDHVTLQAAA 169 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF KICL+TSFRD YI+I+PKD PSRE+WLSFWSEVHYNSLYE G VPAR +KKH Sbjct: 170 DRFGVKICLVTSFRDNGYIDILPKDIQPSRELWLSFWSEVHYNSLYEIGEVPARVCRKKH 229 Query: 576 W 574 W Sbjct: 230 W 230 >ref|XP_015958421.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Arachis duranensis] Length = 226 Score = 216 bits (549), Expect = 5e-66 Identities = 96/121 (79%), Positives = 110/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVR+QV+KQLKHH++LYEG+VPMKYKSYLKMMK+ GEWGDH+TLQAAA Sbjct: 104 ADQLFRNPEYHKHVRRQVIKQLKHHKKLYEGYVPMKYKSYLKMMKKSGEWGDHITLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF+AKICL+TSFRDT YIEI+P D N + E+WLSFWSEVHYNSLY G VPAR P+KK+ Sbjct: 164 DRFNAKICLVTSFRDTCYIEILPTDKNYTIELWLSFWSEVHYNSLYASGDVPARAPRKKY 223 Query: 576 W 574 W Sbjct: 224 W 224 >ref|XP_021828284.1| OTU domain-containing protein DDB_G0284757 [Prunus avium] Length = 227 Score = 216 bits (549), Expect = 5e-66 Identities = 95/121 (78%), Positives = 106/121 (87%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQVVKQLKHHR+LYE +VPMKY+ YLK MK+ GEWGDHLTLQAAA Sbjct: 105 ADQLFRNPDYHKHVRKQVVKQLKHHRKLYEAYVPMKYRHYLKKMKKAGEWGDHLTLQAAA 164 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKIC++TSFRD YIEI+PKD NP+RE+WLSFWSEVHYNSLY VP R P+KKH Sbjct: 165 DRFGAKICVITSFRDACYIEILPKDRNPTREVWLSFWSEVHYNSLYASADVPTRNPRKKH 224 Query: 576 W 574 W Sbjct: 225 W 225 >ref|XP_009375336.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] ref|XP_009375337.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] ref|XP_018507133.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] Length = 227 Score = 216 bits (549), Expect = 5e-66 Identities = 95/121 (78%), Positives = 107/121 (88%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVRKQV+KQLKHH++LYE +VPMKY+ YL+ MK+ GEWGDHLTLQAAA Sbjct: 104 ADQLFRNPEYHKHVRKQVIKQLKHHKKLYEAYVPMKYRRYLRKMKKTGEWGDHLTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NP+ E+WLSFWSEVHYNSLY VP RTP+KKH Sbjct: 164 DRFGAKICLITSFRDTCYIEILPKDGNPTLELWLSFWSEVHYNSLYASADVPTRTPRKKH 223 Query: 576 W 574 W Sbjct: 224 W 224 >ref|XP_008378356.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Malus domestica] ref|XP_008378357.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Malus domestica] Length = 227 Score = 216 bits (549), Expect = 5e-66 Identities = 95/121 (78%), Positives = 107/121 (88%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVRKQV+KQLKHH++LYE +VPMKY+ YL+ MK+ GEWGDHLTLQAAA Sbjct: 104 ADQLFRNPEYHKHVRKQVIKQLKHHKKLYEAYVPMKYRRYLRKMKKTGEWGDHLTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NP+ E+WLSFWSEVHYNSLY VP RTP+KKH Sbjct: 164 DRFGAKICLITSFRDTCYIEILPKDGNPTLELWLSFWSEVHYNSLYASADVPTRTPRKKH 223 Query: 576 W 574 W Sbjct: 224 W 224 >ref|XP_008229666.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Prunus mume] ref|XP_008229667.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Prunus mume] Length = 227 Score = 216 bits (549), Expect = 5e-66 Identities = 95/121 (78%), Positives = 106/121 (87%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQVVKQLKHHR+LYE +VPMKY+ YLK MK+ GEWGDHLTLQAAA Sbjct: 105 ADQLFRNPDYHKHVRKQVVKQLKHHRKLYEAYVPMKYRHYLKKMKKAGEWGDHLTLQAAA 164 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKIC++TSFRD YIEI+PKD NP+RE+WLSFWSEVHYNSLY VP R P+KKH Sbjct: 165 DRFGAKICVITSFRDACYIEILPKDRNPTREVWLSFWSEVHYNSLYASADVPTRNPRKKH 224 Query: 576 W 574 W Sbjct: 225 W 225 >ref|XP_007215925.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Prunus persica] ref|XP_020414682.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Prunus persica] ref|XP_020414683.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Prunus persica] ref|XP_020414685.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Prunus persica] ref|XP_020414686.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Prunus persica] gb|ONI17945.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17946.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17947.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17948.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17949.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17950.1| hypothetical protein PRUPE_3G187500 [Prunus persica] gb|ONI17951.1| hypothetical protein PRUPE_3G187500 [Prunus persica] Length = 227 Score = 216 bits (549), Expect = 5e-66 Identities = 95/121 (78%), Positives = 106/121 (87%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVRKQVVKQLKHHR+LYE +VPMKY+ YLK MK+ GEWGDHLTLQAAA Sbjct: 105 ADQLFRNPDYHKHVRKQVVKQLKHHRKLYEAYVPMKYRHYLKKMKKAGEWGDHLTLQAAA 164 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKIC++TSFRD YIEI+PKD NP+RE+WLSFWSEVHYNSLY VP R P+KKH Sbjct: 165 DRFGAKICVITSFRDACYIEILPKDRNPTREVWLSFWSEVHYNSLYASADVPTRNPRKKH 224 Query: 576 W 574 W Sbjct: 225 W 225 >ref|XP_020976027.1| OTU domain-containing protein DDB_G0284757 isoform X2 [Arachis ipaensis] Length = 222 Score = 215 bits (548), Expect = 6e-66 Identities = 95/121 (78%), Positives = 110/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVR+QV+KQLKHH++LYEG+VPMKYKSYLKMMK+ GEWGDH+TLQAAA Sbjct: 100 ADQLFRNPEYHKHVRRQVIKQLKHHKKLYEGYVPMKYKSYLKMMKKSGEWGDHITLQAAA 159 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF+AKICL+TSFRDT Y+EI+P D N + E+WLSFWSEVHYNSLY G VPAR P+KK+ Sbjct: 160 DRFNAKICLVTSFRDTCYVEILPTDKNYTIELWLSFWSEVHYNSLYASGDVPARAPRKKY 219 Query: 576 W 574 W Sbjct: 220 W 220 >ref|XP_016197000.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Arachis ipaensis] ref|XP_016197001.1| OTU domain-containing protein DDB_G0284757 isoform X1 [Arachis ipaensis] Length = 226 Score = 215 bits (548), Expect = 7e-66 Identities = 95/121 (78%), Positives = 110/121 (90%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVR+QV+KQLKHH++LYEG+VPMKYKSYLKMMK+ GEWGDH+TLQAAA Sbjct: 104 ADQLFRNPEYHKHVRRQVIKQLKHHKKLYEGYVPMKYKSYLKMMKKSGEWGDHITLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF+AKICL+TSFRDT Y+EI+P D N + E+WLSFWSEVHYNSLY G VPAR P+KK+ Sbjct: 164 DRFNAKICLVTSFRDTCYVEILPTDKNYTIELWLSFWSEVHYNSLYASGDVPARAPRKKY 223 Query: 576 W 574 W Sbjct: 224 W 224 >ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] ref|XP_009377958.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Pyrus x bretschneideri] Length = 227 Score = 215 bits (547), Expect = 1e-65 Identities = 96/123 (78%), Positives = 108/123 (87%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVRKQV+KQL+HH++LYE +VPMKY YL+ MK+ GEWGDHLTLQAAA Sbjct: 104 ADQLFRNPEYHKHVRKQVIKQLEHHKKLYEAYVPMKYGHYLRKMKKTGEWGDHLTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD NP RE+WLSFWSEVHYNSLY VP+RTP+KKH Sbjct: 164 DRFRAKICLVTSFRDTCYIEILPKDGNPVRELWLSFWSEVHYNSLYASADVPSRTPRKKH 223 Query: 576 WYS 568 W S Sbjct: 224 WLS 226 >gb|PHT48271.1| hypothetical protein CQW23_12479 [Capsicum baccatum] Length = 230 Score = 215 bits (547), Expect = 1e-65 Identities = 96/121 (79%), Positives = 107/121 (88%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQL+HNPEYHKHVRK+VVKQLKH R+ YE +VPMKYKSYLK MKRLGEWGDH+TLQAAA Sbjct: 108 ADQLYHNPEYHKHVRKEVVKQLKHFRKFYESYVPMKYKSYLKKMKRLGEWGDHITLQAAA 167 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DR+ KICL+TSFR+ YIEI+PKD PSRE+WLSFWSEVHYNSLYE G VPAR +KKH Sbjct: 168 DRYGVKICLVTSFRENGYIEILPKDIQPSRELWLSFWSEVHYNSLYEIGEVPARVRRKKH 227 Query: 576 W 574 W Sbjct: 228 W 228 >ref|XP_008342290.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Malus domestica] Length = 227 Score = 214 bits (546), Expect = 1e-65 Identities = 96/123 (78%), Positives = 107/123 (86%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NPEYHKHVRKQV+KQLKHH++LYE +VPMKY YL MK+ GEWGDHLTLQAAA Sbjct: 104 ADQLFRNPEYHKHVRKQVIKQLKHHKKLYEAYVPMKYSRYLMKMKKTGEWGDHLTLQAAA 163 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PKD N +RE+WLSFWSEVHYNSLY VP+RTP+KKH Sbjct: 164 DRFGAKICLITSFRDTCYIEILPKDGNHARELWLSFWSEVHYNSLYASADVPSRTPRKKH 223 Query: 576 WYS 568 W S Sbjct: 224 WLS 226 >gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium raimondii] Length = 160 Score = 212 bits (539), Expect = 2e-65 Identities = 93/121 (76%), Positives = 107/121 (88%) Frame = -2 Query: 936 ADQLFHNPEYHKHVRKQVVKQLKHHRRLYEGHVPMKYKSYLKMMKRLGEWGDHLTLQAAA 757 ADQLF NP+YHKHVR+Q+VKQLKH ++LYEG+VPMKYK YLK MK+ GEWGDH+TLQAAA Sbjct: 38 ADQLFRNPDYHKHVRRQIVKQLKHSKKLYEGYVPMKYKGYLKKMKKSGEWGDHVTLQAAA 97 Query: 756 DRFSAKICLLTSFRDTYYIEIIPKDTNPSREIWLSFWSEVHYNSLYERGAVPARTPKKKH 577 DRF AKICL+TSFRDT YIEI+PK +P+REIWLSFWSEVHYNSLY G VP R P++KH Sbjct: 98 DRFGAKICLVTSFRDTCYIEIMPKQASPTREIWLSFWSEVHYNSLYASGDVPTRAPRRKH 157 Query: 576 W 574 W Sbjct: 158 W 158