BLASTX nr result
ID: Acanthopanax23_contig00004381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00004381 (650 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010045981.1| PREDICTED: F-box/LRR-repeat protein 17 [Euca... 95 6e-19 gb|KDO68540.1| hypothetical protein CISIN_1g045871mg, partial [C... 94 2e-18 ref|XP_006479595.1| PREDICTED: F-box/LRR-repeat protein 17 [Citr... 94 2e-18 dbj|GAY55786.1| hypothetical protein CUMW_166800 [Citrus unshiu] 94 2e-18 ref|XP_024045411.1| F-box/LRR-repeat protein 17 [Citrus clementina] 94 2e-18 gb|ESR57156.1| hypothetical protein CICLE_v10019274mg [Citrus cl... 94 2e-18 ref|XP_023513559.1| F-box/LRR-repeat protein 17-like isoform X2 ... 93 4e-18 ref|XP_022960538.1| F-box/LRR-repeat protein 17-like isoform X2 ... 93 4e-18 ref|XP_023513558.1| F-box/LRR-repeat protein 17-like isoform X1 ... 93 4e-18 ref|XP_022960537.1| F-box/LRR-repeat protein 17-like isoform X1 ... 93 4e-18 ref|XP_019057077.1| PREDICTED: F-box/LRR-repeat protein 17 [Tare... 93 4e-18 ref|XP_022954395.1| F-box/LRR-repeat protein 17-like [Cucurbita ... 92 5e-18 ref|XP_004146955.2| PREDICTED: F-box/LRR-repeat protein 17 [Cucu... 92 5e-18 ref|XP_023548623.1| F-box/LRR-repeat protein 17-like [Cucurbita ... 92 5e-18 ref|XP_022991271.1| F-box/LRR-repeat protein 17-like [Cucurbita ... 92 5e-18 ref|XP_008451271.1| PREDICTED: F-box/LRR-repeat protein 17 isofo... 92 5e-18 ref|XP_016901037.1| PREDICTED: F-box/LRR-repeat protein 17 isofo... 92 5e-18 dbj|GAV73435.1| PRK domain-containing protein/F-box-like domain-... 92 5e-18 ref|XP_017975014.1| PREDICTED: F-box/LRR-repeat protein 17 isofo... 92 6e-18 gb|PPD68126.1| hypothetical protein GOBAR_DD34992 [Gossypium bar... 92 6e-18 >ref|XP_010045981.1| PREDICTED: F-box/LRR-repeat protein 17 [Eucalyptus grandis] gb|KCW84670.1| hypothetical protein EUGRSUZ_B01491 [Eucalyptus grandis] Length = 623 Score = 95.1 bits (235), Expect = 6e-19 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICNEFP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGMT Sbjct: 410 DLSGSSISDSGIGMICNEFPETLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMT 466 >gb|KDO68540.1| hypothetical protein CISIN_1g045871mg, partial [Citrus sinensis] Length = 541 Score = 93.6 bits (231), Expect = 2e-18 Identities = 53/92 (57%), Positives = 59/92 (64%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGM Sbjct: 349 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGM---- 404 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLF 261 S P D TC+ LQ+ F Sbjct: 405 --------SICDPTSEDSNSDETCDFELQKAF 428 >ref|XP_006479595.1| PREDICTED: F-box/LRR-repeat protein 17 [Citrus sinensis] Length = 577 Score = 93.6 bits (231), Expect = 2e-18 Identities = 53/92 (57%), Positives = 59/92 (64%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGM Sbjct: 364 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGM---- 419 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLF 261 S P D TC+ LQ+ F Sbjct: 420 --------SICDPTSEDSNSDETCDFELQKAF 443 >dbj|GAY55786.1| hypothetical protein CUMW_166800 [Citrus unshiu] Length = 589 Score = 93.6 bits (231), Expect = 2e-18 Identities = 53/92 (57%), Positives = 59/92 (64%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGM Sbjct: 376 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGM---- 431 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLF 261 S P D TC+ LQ+ F Sbjct: 432 --------SICDPTSEDSNSDETCDFELQKAF 455 >ref|XP_024045411.1| F-box/LRR-repeat protein 17 [Citrus clementina] Length = 590 Score = 93.6 bits (231), Expect = 2e-18 Identities = 53/92 (57%), Positives = 59/92 (64%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGM Sbjct: 377 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGM---- 432 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLF 261 S P D TC+ LQ+ F Sbjct: 433 --------SICDPTSEDSNSDETCDFELQKAF 456 >gb|ESR57156.1| hypothetical protein CICLE_v10019274mg [Citrus clementina] Length = 635 Score = 93.6 bits (231), Expect = 2e-18 Identities = 53/92 (57%), Positives = 59/92 (64%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGM Sbjct: 422 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGM---- 477 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLF 261 S P D TC+ LQ+ F Sbjct: 478 --------SICDPTSEDSNSDETCDFELQKAF 501 >ref|XP_023513559.1| F-box/LRR-repeat protein 17-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 583 Score = 92.8 bits (229), Expect = 4e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 370 DLSGSSISDSGIGMICNVFPDTLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 426 >ref|XP_022960538.1| F-box/LRR-repeat protein 17-like isoform X2 [Cucurbita moschata] Length = 583 Score = 92.8 bits (229), Expect = 4e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 370 DLSGSSISDSGIGMICNVFPDTLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 426 >ref|XP_023513558.1| F-box/LRR-repeat protein 17-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 584 Score = 92.8 bits (229), Expect = 4e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 371 DLSGSSISDSGIGMICNVFPDTLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 427 >ref|XP_022960537.1| F-box/LRR-repeat protein 17-like isoform X1 [Cucurbita moschata] Length = 584 Score = 92.8 bits (229), Expect = 4e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 371 DLSGSSISDSGIGMICNVFPDTLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 427 >ref|XP_019057077.1| PREDICTED: F-box/LRR-repeat protein 17 [Tarenaya hassleriana] Length = 645 Score = 92.8 bits (229), Expect = 4e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSITDSGIGMICN FPD LS+LLLALC NITSSGI FAT QLPLL+LM+CGMT Sbjct: 415 DLSGSSITDSGIGMICNVFPDTLSKLLLALCPNITSSGIQFATAQLPLLKLMDCGMT 471 >ref|XP_022954395.1| F-box/LRR-repeat protein 17-like [Cucurbita moschata] Length = 586 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 373 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 429 >ref|XP_004146955.2| PREDICTED: F-box/LRR-repeat protein 17 [Cucumis sativus] gb|KGN44762.1| hypothetical protein Csa_7G378510 [Cucumis sativus] Length = 587 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 373 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 429 >ref|XP_023548623.1| F-box/LRR-repeat protein 17-like [Cucurbita pepo subsp. pepo] Length = 590 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 377 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 433 >ref|XP_022991271.1| F-box/LRR-repeat protein 17-like [Cucurbita maxima] Length = 590 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 377 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 433 >ref|XP_008451271.1| PREDICTED: F-box/LRR-repeat protein 17 isoform X2 [Cucumis melo] Length = 591 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 377 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 433 >ref|XP_016901037.1| PREDICTED: F-box/LRR-repeat protein 17 isoform X1 [Cucumis melo] Length = 592 Score = 92.4 bits (228), Expect = 5e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FPD LSRLLLALC NITSSGI FAT +LPLLELM+CGMT Sbjct: 378 DLSGSSISDSGIGMICNVFPDSLSRLLLALCPNITSSGIQFATAELPLLELMDCGMT 434 >dbj|GAV73435.1| PRK domain-containing protein/F-box-like domain-containing protein [Cephalotus follicularis] Length = 807 Score = 92.4 bits (228), Expect = 5e-18 Identities = 54/105 (51%), Positives = 63/105 (60%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMTXXX 357 +L SSI+DSGIGMICN +P LSRLLLALC NITSSGI FAT QLPLLELM+CGMT Sbjct: 371 DLSGSSISDSGIGMICNVYPHTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMTISD 430 Query: 356 XXXXXNYSSFAAPLFHLLALDSTCNITLQRLFQPFRSRQNPQTRL 222 +Y + P L N L ++Q + N RL Sbjct: 431 PNSQESYYESSDP-----ELQKMFNNKLHLIYQKLIIKHNRLRRL 470 >ref|XP_017975014.1| PREDICTED: F-box/LRR-repeat protein 17 isoform X2 [Theobroma cacao] Length = 492 Score = 92.0 bits (227), Expect = 6e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGMT Sbjct: 277 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMT 333 >gb|PPD68126.1| hypothetical protein GOBAR_DD34992 [Gossypium barbadense] Length = 551 Score = 92.0 bits (227), Expect = 6e-18 Identities = 46/57 (80%), Positives = 50/57 (87%) Frame = -1 Query: 536 NLRSSSITDSGIGMICNEFPDILSRLLLALCSNITSSGI*FATTQLPLLELMNCGMT 366 +L SSI+DSGIGMICN FP+ LSRLLLALC NITSSGI FAT QLPLLELM+CGMT Sbjct: 353 DLSGSSISDSGIGMICNVFPNTLSRLLLALCPNITSSGIQFATAQLPLLELMDCGMT 409