BLASTX nr result
ID: Acanthopanax23_contig00004289
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax23_contig00004289
(489 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|WP_106001130.1| hypothetical protein, partial [Escherichia c... 178 3e-55
ref|XP_019579115.1| PREDICTED: histone H4-like, partial [Rhinolo... 178 3e-55
gb|PKI39387.1| hypothetical protein CRG98_040253 [Punica granatum] 178 3e-55
ref|XP_019579135.1| PREDICTED: histone H4-like, partial [Rhinolo... 178 3e-55
gb|KZM84927.1| hypothetical protein DCAR_027651 [Daucus carota s... 178 3e-55
gb|EYU41919.1| hypothetical protein MIMGU_mgv1a024124mg, partial... 178 3e-55
gb|EFH38540.1| hypothetical protein ARALYDRAFT_497532, partial [... 178 3e-55
prf||1101277A histone H4 [Triticum aestivum] 178 3e-55
gb|OAY83940.1| Histone H4 [Ananas comosus] 178 3e-55
dbj|BAB71814.1| histone H4, partial [Citrus jambhiri] 178 3e-55
ref|XP_021823737.1| histone H4-like [Prunus avium] 178 4e-55
gb|OVA08191.1| Histone H4 [Macleaya cordata] 178 4e-55
ref|XP_020176745.1| histone H4-like [Aegilops tauschii subsp. ta... 178 4e-55
ref|XP_010913656.1| PREDICTED: histone H4-like [Elaeis guineensis] 178 4e-55
gb|ACG31455.1| histone H4 [Zea mays] 178 4e-55
gb|ACG31227.1| histone H4 [Zea mays] 178 4e-55
gb|ACG31208.1| histone H4 [Zea mays] 178 4e-55
gb|ACG30729.1| histone H4 [Zea mays] 178 4e-55
sp|P62786.2|H42_WHEAT RecName: Full=Histone H4 variant TH091 >gi... 178 4e-55
ref|WP_072354057.1| hypothetical protein [Paenibacillus sp. IHB ... 178 4e-55
>ref|WP_106001130.1| hypothetical protein, partial [Escherichia coli]
Length = 92
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 3 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 62
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 63 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 92
>ref|XP_019579115.1| PREDICTED: histone H4-like, partial [Rhinolophus sinicus]
gb|ACD76815.1| histone 4, partial [Capsella bursa-pastoris]
Length = 96
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 3 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 62
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 63 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 92
>gb|PKI39387.1| hypothetical protein CRG98_040253 [Punica granatum]
Length = 99
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 6 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 65
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 66 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 95
>ref|XP_019579135.1| PREDICTED: histone H4-like, partial [Rhinolophus sinicus]
Length = 99
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 6 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 65
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 66 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 95
>gb|KZM84927.1| hypothetical protein DCAR_027651 [Daucus carota subsp. sativus]
Length = 100
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 7 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 66
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 67 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 96
>gb|EYU41919.1| hypothetical protein MIMGU_mgv1a024124mg, partial [Erythranthe
guttata]
Length = 100
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 7 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 66
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 67 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 96
>gb|EFH38540.1| hypothetical protein ARALYDRAFT_497532, partial [Arabidopsis lyrata
subsp. lyrata]
gb|EFH42618.1| hypothetical protein ARALYDRAFT_496134, partial [Arabidopsis lyrata
subsp. lyrata]
Length = 100
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>prf||1101277A histone H4 [Triticum aestivum]
Length = 102
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 9 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 68
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 69 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 98
>gb|OAY83940.1| Histone H4 [Ananas comosus]
Length = 102
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 9 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 68
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 69 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 98
>dbj|BAB71814.1| histone H4, partial [Citrus jambhiri]
Length = 102
Score = 178 bits (451), Expect = 3e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>ref|XP_021823737.1| histone H4-like [Prunus avium]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>gb|OVA08191.1| Histone H4 [Macleaya cordata]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>ref|XP_020176745.1| histone H4-like [Aegilops tauschii subsp. tauschii]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>ref|XP_010913656.1| PREDICTED: histone H4-like [Elaeis guineensis]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>gb|ACG31455.1| histone H4 [Zea mays]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>gb|ACG31227.1| histone H4 [Zea mays]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>gb|ACG31208.1| histone H4 [Zea mays]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>gb|ACG30729.1| histone H4 [Zea mays]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>sp|P62786.2|H42_WHEAT RecName: Full=Histone H4 variant TH091
gb|AAA34292.1| histone H4 [Triticum aestivum]
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99
>ref|WP_072354057.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
ref|NP_180441.1| histone H4 [Arabidopsis thaliana]
ref|NP_190179.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_190941.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_563793.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_563797.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_568911.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_568918.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_850939.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_850660.1| Histone superfamily protein [Arabidopsis thaliana]
ref|NP_001131585.1| histone H4 [Zea mays]
ref|NP_001237495.1| histone H4 [Glycine max]
ref|NP_001278493.1| uncharacterized LOC100278340 [Zea mays]
ref|NP_001281194.1| uncharacterized protein LOC100282268 [Zea mays]
ref|NP_001313304.1| histone H4 [Zea mays]
ref|NP_001332089.1| Histone superfamily protein [Arabidopsis thaliana]
ref|XP_001751729.1| histone H4 [Physcomitrella patens]
ref|XP_001766349.1| histone H4 [Physcomitrella patens]
ref|XP_001768203.1| histone H4 [Physcomitrella patens]
ref|XP_001769691.1| histone H4 [Physcomitrella patens]
ref|XP_001771124.1| histone H4 [Physcomitrella patens]
ref|XP_001773584.1| histone H4 [Physcomitrella patens]
ref|XP_001775783.1| histone H4 [Physcomitrella patens]
ref|XP_001779524.1| predicted protein [Physcomitrella patens]
ref|XP_001779981.1| histone H4 [Physcomitrella patens]
ref|XP_001780443.1| histone H4 [Physcomitrella patens]
ref|XP_001783818.1| histone H4 [Physcomitrella patens]
ref|XP_002310853.1| histone H4 family protein [Populus trichocarpa]
ref|XP_002310855.1| hypothetical protein POPTR_0007s14020g [Populus trichocarpa]
ref|XP_002310859.1| histone H4 family protein [Populus trichocarpa]
ref|XP_002311129.1| histone H4 family protein [Populus trichocarpa]
ref|XP_002316326.1| hypothetical protein POPTR_0010s22090g [Populus trichocarpa]
ref|XP_002324472.1| histone H4 family protein [Populus trichocarpa]
ref|XP_002324474.1| histone H4 family protein [Populus trichocarpa]
ref|XP_002325056.1| hypothetical protein POPTR_0018s10040g [Populus trichocarpa]
ref|XP_002284158.1| PREDICTED: histone H4 [Vitis vinifera]
ref|XP_002284564.1| PREDICTED: histone H4 [Vitis vinifera]
ref|XP_002262845.1| PREDICTED: histone H4 [Vitis vinifera]
ref|XP_002281789.1| PREDICTED: histone H4 [Vitis vinifera]
ref|XP_002465012.1| histone H4 [Sorghum bicolor]
ref|XP_002468624.1| histone H4 [Sorghum bicolor]
ref|XP_002460250.1| histone H4 [Sorghum bicolor]
ref|XP_002462803.1| histone H4 [Sorghum bicolor]
ref|XP_002455130.1| histone H4 [Sorghum bicolor]
ref|XP_002455131.1| histone H4 [Sorghum bicolor]
ref|XP_002456596.1| histone H4 [Sorghum bicolor]
ref|XP_002457286.1| histone H4 [Sorghum bicolor]
ref|XP_002452743.1| histone H4 [Sorghum bicolor]
ref|XP_002448395.1| histone H4 [Sorghum bicolor]
ref|XP_002439932.1| histone H4 [Sorghum bicolor]
ref|XP_002509686.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_002518940.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_002531654.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_002531656.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_002532808.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_002864647.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_003521335.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003535987.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003538030.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003538258.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003538259.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003538260.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003539748.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003544868.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003549448.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003555742.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003557745.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003557764.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003558370.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003558954.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003578155.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003578603.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_003597302.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003600460.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003600922.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003606566.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003615092.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003625481.1| histone H4 domain protein [Medicago truncatula]
ref|XP_003627802.1| histone H4 domain protein [Medicago truncatula]
ref|XP_004138399.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004143094.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004143095.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004143098.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004143099.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004143100.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_004294590.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004294591.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004294592.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004294628.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004302787.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004307447.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_004487047.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004500222.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004505922.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004507853.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004511025.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004513931.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004516180.1| PREDICTED: histone H4 [Cicer arietinum]
ref|XP_004953471.1| histone H4 [Setaria italica]
ref|XP_004956919.1| histone H4 [Setaria italica]
ref|XP_004957584.1| histone H4 [Setaria italica]
ref|XP_004961797.1| histone H4 [Setaria italica]
ref|XP_004970497.1| histone H4 [Setaria italica]
ref|XP_004973289.1| histone H4 [Setaria italica]
ref|XP_004976597.1| histone H4 [Setaria italica]
ref|XP_004983800.1| histone H4 [Setaria italica]
ref|XP_004985949.1| histone H4 [Setaria italica]
ref|XP_006349012.1| PREDICTED: histone H4 [Solanum tuberosum]
ref|XP_006279505.1| histone H4 [Capsella rubella]
ref|XP_006292098.1| histone H4 [Capsella rubella]
ref|XP_006292099.1| histone H4 [Capsella rubella]
ref|XP_006295294.1| histone H4 [Capsella rubella]
ref|XP_006303455.1| histone H4 [Capsella rubella]
ref|XP_006303457.1| histone H4 [Capsella rubella]
ref|XP_006383119.1| hypothetical protein POPTR_0005s11740g [Populus trichocarpa]
ref|XP_006383122.1| histone H4 family protein [Populus trichocarpa]
ref|XP_006381806.1| hypothetical protein POPTR_0006s18360g [Populus trichocarpa]
ref|XP_002316375.2| hypothetical protein POPTR_0010s22080g [Populus trichocarpa]
ref|XP_006417762.1| histone H4 [Eutrema salsugineum]
ref|XP_006418920.1| histone H4 [Eutrema salsugineum]
ref|XP_006418982.1| histone H4 [Eutrema salsugineum]
ref|XP_006400894.1| histone H4 [Eutrema salsugineum]
ref|XP_006400928.1| histone H4 [Eutrema salsugineum]
ref|XP_006403660.1| histone H4 [Eutrema salsugineum]
ref|XP_006409907.1| histone H4 [Eutrema salsugineum]
ref|XP_006410944.1| histone H4 [Eutrema salsugineum]
ref|XP_006424714.1| histone H4 [Citrus clementina]
ref|XP_006424783.1| histone H4 [Citrus clementina]
ref|XP_006429035.1| histone H4 [Citrus clementina]
ref|XP_006453377.1| histone H4 [Citrus clementina]
ref|XP_006474179.1| PREDICTED: histone H4 [Citrus sinensis]
ref|XP_006480778.1| PREDICTED: histone H4 [Citrus sinensis]
ref|XP_006488229.1| PREDICTED: histone H4 [Citrus sinensis]
ref|XP_006488285.1| PREDICTED: histone H4 [Citrus sinensis]
ref|XP_006597302.1| PREDICTED: histone H4 [Glycine max]
ref|XP_006644971.1| PREDICTED: histone H4 [Oryza brachyantha]
ref|XP_006652696.1| PREDICTED: histone H4 [Oryza brachyantha]
ref|XP_006829196.1| histone H4 [Amborella trichopoda]
ref|XP_006841590.1| histone H4 [Amborella trichopoda]
ref|XP_006845633.1| histone H4 [Amborella trichopoda]
ref|XP_006845635.1| histone H4 [Amborella trichopoda]
ref|XP_006845637.1| histone H4 [Amborella trichopoda]
ref|XP_006856158.1| histone H4 [Amborella trichopoda]
ref|XP_007009385.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007014216.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007016483.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007016577.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007024825.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007027067.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007027069.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_007132137.1| hypothetical protein PHAVU_011G069700g [Phaseolus vulgaris]
ref|XP_007142236.1| hypothetical protein PHAVU_008G263800g [Phaseolus vulgaris]
ref|XP_007146746.1| hypothetical protein PHAVU_006G066300g [Phaseolus vulgaris]
ref|XP_007146747.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
ref|XP_007146748.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
ref|XP_007150264.1| hypothetical protein PHAVU_005G139600g [Phaseolus vulgaris]
ref|XP_007154766.1| hypothetical protein PHAVU_003G145900g [Phaseolus vulgaris]
ref|XP_007162656.1| hypothetical protein PHAVU_001G169200g [Phaseolus vulgaris]
ref|XP_007202793.1| histone H4 [Prunus persica]
ref|XP_007206175.1| histone H4 [Prunus persica]
ref|XP_007206176.1| histone H4 [Prunus persica]
ref|XP_007210543.1| histone H4 [Prunus persica]
ref|XP_007220484.1| histone H4 [Prunus persica]
ref|XP_007220485.1| histone H4 [Prunus persica]
ref|XP_008223213.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008241245.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008233523.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008233524.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008233596.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008245808.1| PREDICTED: histone H4 [Prunus mume]
ref|XP_008343545.1| PREDICTED: histone H4 [Malus domestica]
ref|XP_008463901.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008448389.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008448390.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008448391.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008448392.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008456764.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008456765.1| PREDICTED: histone H4 [Cucumis melo]
ref|XP_008650256.1| histone H4 [Zea mays]
ref|XP_008668985.1| histone H4 [Zea mays]
ref|XP_008673673.1| histone H4 [Zea mays]
ref|XP_008674854.1| histone H4 [Zea mays]
ref|XP_008656378.1| histone H4 [Zea mays]
ref|XP_008657088.1| histone H4 [Zea mays]
ref|XP_008804861.1| PREDICTED: histone H4 [Phoenix dactylifera]
ref|XP_008812450.1| PREDICTED: histone H4 [Phoenix dactylifera]
ref|XP_008781903.1| PREDICTED: histone H4 [Phoenix dactylifera]
ref|XP_009131981.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009133863.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009140937.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009141673.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009143480.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009148015.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009116068.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009118417.1| PREDICTED: histone H4 [Brassica rapa]
ref|XP_009337602.1| PREDICTED: histone H4 [Pyrus x bretschneideri]
ref|XP_009394094.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009394189.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009401269.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009390508.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009394577.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009406967.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009409540.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009414300.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009416257.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009420019.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009420833.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009380760.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009382750.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009384902.1| PREDICTED: histone H4 [Musa acuminata subsp. malaccensis]
ref|XP_009607922.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
ref|XP_009609514.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
ref|XP_009591402.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
ref|XP_009600261.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
ref|XP_009791880.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_009794491.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_009798388.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_009757026.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_009767266.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_009777185.1| PREDICTED: histone H4 [Nicotiana sylvestris]
ref|XP_010030574.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010053044.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010056038.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010033143.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010037716.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010037848.1| PREDICTED: histone H4 [Eucalyptus grandis]
ref|XP_010092782.1| histone H4 [Morus notabilis]
ref|XP_010093009.1| histone H4 [Morus notabilis]
ref|XP_010104910.1| histone H4 [Morus notabilis]
ref|XP_010263120.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010264531.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010264574.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010262272.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010262273.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010262275.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010262276.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010246201.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010246202.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010246203.1| PREDICTED: histone H4 [Nelumbo nucifera]
ref|XP_010231275.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_010313299.1| PREDICTED: histone H4 [Solanum lycopersicum]
ref|XP_010455395.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010455780.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010487799.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010488030.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010503204.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010503249.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010504143.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010510587.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010514915.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010514961.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010515874.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010426021.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010426070.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010427032.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010443740.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010443785.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010457960.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010457961.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010457987.1| PREDICTED: histone H4 isoform X2 [Camelina sativa]
ref|XP_010457988.1| PREDICTED: histone H4 isoform X1 [Camelina sativa]
ref|XP_010475534.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010475535.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010475557.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010483612.1| PREDICTED: histone H4 [Camelina sativa]
ref|XP_010541393.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010542611.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010542654.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010557281.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010557296.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010520287.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010520288.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010521821.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010521900.1| PREDICTED: histone H4 [Tarenaya hassleriana]
ref|XP_010680743.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010672778.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010685810.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010693814.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010695592.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010695599.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_010913659.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_010914145.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_011018258.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011018338.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_010920757.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_010928661.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_010935331.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_011025936.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011025939.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011025955.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_010937748.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_011027073.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_010940230.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_010907491.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_011043210.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011043213.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011043969.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011043970.1| PREDICTED: histone H4 isoform X1 [Populus euphratica]
ref|XP_011043971.1| PREDICTED: histone H4 isoform X2 [Populus euphratica]
ref|XP_011043972.1| PREDICTED: histone H4 isoform X3 [Populus euphratica]
ref|XP_011009519.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011013668.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011013671.1| PREDICTED: histone H4 [Populus euphratica]
ref|XP_011076639.1| histone H4 [Sesamum indicum]
ref|XP_011077456.1| histone H4 [Sesamum indicum]
ref|XP_011077544.1| histone H4 [Sesamum indicum]
ref|XP_011084861.1| histone H4 [Sesamum indicum]
ref|XP_011089394.1| histone H4 [Sesamum indicum]
ref|XP_011094841.1| histone H4 [Sesamum indicum]
ref|XP_011095029.1| histone H4 [Sesamum indicum]
ref|XP_011095589.1| histone H4 [Sesamum indicum]
ref|XP_011097720.1| histone H4 [Sesamum indicum]
ref|XP_011101872.1| histone H4 [Sesamum indicum]
ref|XP_011469720.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_011469723.1| PREDICTED: histone H4 [Fragaria vesca subsp. vesca]
ref|XP_011623050.1| histone H4 [Amborella trichopoda]
ref|XP_011623051.1| histone H4 [Amborella trichopoda]
ref|XP_011622317.1| histone H4 [Amborella trichopoda]
ref|XP_011653471.1| PREDICTED: histone H4 [Cucumis sativus]
ref|XP_012065002.1| histone H4 [Jatropha curcas]
ref|XP_012074058.1| histone H4 [Jatropha curcas]
ref|XP_012087028.1| histone H4 [Jatropha curcas]
ref|XP_012087045.1| histone H4 [Jatropha curcas]
ref|XP_012468389.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012469798.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012471384.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012471433.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012472789.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012472799.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012441522.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012442871.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012456440.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012460773.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012461907.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012465147.1| PREDICTED: histone H4 [Gossypium raimondii]
ref|XP_012831997.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012832191.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012841834.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012848703.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012850355.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012850464.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012850911.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012858790.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_012827931.1| PREDICTED: histone H4 [Erythranthe guttata]
ref|XP_013448040.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013456049.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013459905.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013460127.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013460128.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013460134.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013460151.1| histone H4 domain protein [Medicago truncatula]
ref|XP_013615993.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013622579.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013623511.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013625358.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013630704.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013631522.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013632073.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013633957.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013637962.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013583915.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013588638.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013600442.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013602591.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013605168.1| PREDICTED: histone H4 [Brassica oleracea var. oleracea]
ref|XP_013702039.1| histone H4 [Brassica napus]
ref|XP_013680780.1| histone H4 isoform X1 [Brassica napus]
ref|XP_013680787.1| histone H4 isoform X2 [Brassica napus]
ref|XP_013681707.1| histone H4 [Brassica napus]
ref|XP_013689098.1| histone H4 [Brassica napus]
ref|XP_013732634.1| histone H4 [Brassica napus]
ref|XP_013734919.1| histone H4 [Brassica napus]
ref|XP_013738370.1| histone H4 [Brassica napus]
ref|XP_013744194.1| histone H4 [Brassica napus]
ref|XP_013744725.1| histone H4 [Brassica napus]
ref|XP_013748348.1| histone H4 [Brassica napus]
ref|XP_013641146.1| histone H4 [Brassica napus]
ref|XP_013641159.1| histone H4 [Brassica napus]
ref|XP_013642542.1| histone H4 [Brassica napus]
ref|XP_013647689.1| histone H4 [Brassica napus]
ref|XP_013657574.1| histone H4 [Brassica napus]
ref|XP_013661167.1| histone H4 [Brassica napus]
ref|XP_013676426.1| histone H4 [Brassica napus]
ref|XP_013678307.1| histone H4 [Brassica napus]
ref|XP_013691794.1| histone H4 [Brassica napus]
ref|XP_013695902.1| histone H4 [Brassica napus]
ref|XP_013699203.1| histone H4 [Brassica napus]
ref|XP_013708064.1| histone H4 [Brassica napus]
ref|XP_013708232.1| histone H4 [Brassica napus]
ref|XP_013716269.1| histone H4 [Brassica napus]
ref|XP_013723951.1| histone H4 [Brassica napus]
ref|XP_013729484.1| histone H4 [Brassica napus]
ref|XP_013733729.1| histone H4 [Brassica napus]
ref|XP_014493889.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014494409.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014494432.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014496235.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014498124.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014505099.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014518271.1| histone H4 [Vigna radiata var. radiata]
ref|XP_014624656.1| PREDICTED: histone H4 [Glycine max]
ref|XP_003542580.3| PREDICTED: histone H4 [Glycine max]
ref|XP_003551292.3| PREDICTED: histone H4 [Glycine max]
ref|XP_014755701.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_014758281.1| PREDICTED: histone H4 [Brachypodium distachyon]
ref|XP_015057055.1| PREDICTED: histone H4 [Solanum pennellii]
ref|XP_015578392.1| PREDICTED: histone H4 [Ricinus communis]
ref|XP_015612982.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015627403.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015628561.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015636819.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015637997.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015639309.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015645242.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015610672.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015612705.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015614455.1| PREDICTED: histone H4 [Oryza sativa Japonica Group]
ref|XP_015697325.1| PREDICTED: histone H4 [Oryza brachyantha]
ref|XP_015900237.1| PREDICTED: histone H4 [Ziziphus jujuba]
ref|XP_015874145.1| PREDICTED: histone H4 [Ziziphus jujuba]
ref|XP_015876988.1| PREDICTED: histone H4 [Ziziphus jujuba]
ref|XP_015877066.1| PREDICTED: histone H4 [Ziziphus jujuba]
ref|XP_015901777.1| PREDICTED: histone H4 [Ziziphus jujuba]
ref|XP_015933867.1| histone H4 [Arachis duranensis]
ref|XP_015949070.1| histone H4 [Arachis duranensis]
ref|XP_015949071.1| histone H4 [Arachis duranensis]
ref|XP_015949133.1| histone H4 [Arachis duranensis]
ref|XP_015956746.1| histone H4 [Arachis duranensis]
ref|XP_015958826.1| histone H4 [Arachis duranensis]
ref|XP_015932139.1| histone H4 [Arachis duranensis]
ref|XP_016201174.1| histone H4 [Arachis ipaensis]
ref|XP_016201187.1| histone H4 [Arachis ipaensis]
ref|XP_016201198.1| histone H4 [Arachis ipaensis]
ref|XP_016183210.1| histone H4 [Arachis ipaensis]
ref|XP_016183212.1| histone H4 [Arachis ipaensis]
ref|XP_016183239.1| histone H4 [Arachis ipaensis]
ref|XP_016190129.1| histone H4 [Arachis ipaensis]
ref|XP_016197256.1| histone H4 [Arachis ipaensis]
ref|XP_016166903.1| histone H4 [Arachis ipaensis]
ref|XP_016452786.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016455516.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016459669.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016475587.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016476748.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016477054.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016483711.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016491075.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016497947.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016501198.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016501825.1| PREDICTED: histone H4 [Nicotiana tabacum]
ref|XP_016575872.1| PREDICTED: histone H4 [Capsicum annuum]
ref|XP_016719940.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016719943.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016727035.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016727067.1| PREDICTED: histone H4 isoform X1 [Gossypium hirsutum]
ref|XP_016727068.1| PREDICTED: histone H4 isoform X2 [Gossypium hirsutum]
ref|XP_016718727.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016720273.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016749120.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016750530.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016665187.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016665209.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016697953.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016739036.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016740566.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016740603.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_016740787.1| PREDICTED: histone H4 [Gossypium hirsutum]
ref|XP_017232728.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017235819.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017235820.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017235821.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017244001.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017244283.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017244627.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017244681.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017248895.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017250137.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017251355.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017221901.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017221902.1| PREDICTED: histone H4 [Daucus carota subsp. sativus]
ref|XP_017406841.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017409675.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017410781.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017425797.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017425798.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017431445.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017432606.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017432919.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017436612.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017436614.1| PREDICTED: histone H4 [Vigna angularis]
ref|XP_017606882.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017612737.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017619881.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017617154.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017619313.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017623963.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017638499.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017639016.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017639068.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017643271.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017644832.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017647212.1| PREDICTED: histone H4 [Gossypium arboreum]
ref|XP_017985006.1| PREDICTED: histone H4 [Theobroma cacao]
ref|XP_018466002.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018489416.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018450669.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018473023.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018474564.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018478486.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018486629.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018490753.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018434873.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018436511.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018439064.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018450799.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018450800.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018463191.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018465955.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018465956.1| PREDICTED: histone H4 [Raphanus sativus]
ref|XP_018623612.1| PREDICTED: histone H4 [Nicotiana tomentosiformis]
ref|XP_018836019.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018842042.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018854792.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018859994.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018859999.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018823320.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018824592.1| PREDICTED: histone H4 [Juglans regia]
ref|XP_018831351.1| PREDICTED: histone H4 isoform X1 [Juglans regia]
ref|XP_018831352.1| PREDICTED: histone H4 isoform X2 [Juglans regia]
ref|XP_019080189.1| PREDICTED: histone H4 [Vitis vinifera]
ref|XP_019108317.1| PREDICTED: histone H4 [Beta vulgaris subsp. vulgaris]
ref|XP_019091613.1| PREDICTED: histone H4 isoform X3 [Camelina sativa]
ref|XP_019177310.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019178794.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019192695.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019199555.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019199556.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019199558.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019199568.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019164344.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019164404.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019164405.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019164409.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019164410.1| PREDICTED: histone H4 [Ipomoea nil]
ref|XP_019258070.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019263034.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019266516.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019224160.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019224162.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019228913.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019230718.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019231939.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019237410.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019256679.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019256680.1| PREDICTED: histone H4 [Nicotiana attenuata]
ref|XP_019454345.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019457387.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019457388.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019459107.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019460698.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019464757.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019416384.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019417437.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019426269.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019426607.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019440955.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019440956.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019440957.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019444402.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019448676.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019448677.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019453594.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019455688.1| PREDICTED: histone H4 [Lupinus angustifolius]
ref|XP_019579043.1| PREDICTED: histone H4 [Rhinolophus sinicus]
ref|XP_019579075.1| PREDICTED: histone H4 [Rhinolophus sinicus]
ref|XP_019579104.1| PREDICTED: histone H4 [Rhinolophus sinicus]
ref|XP_019702445.1| PREDICTED: histone H4 [Elaeis guineensis]
ref|XP_020080562.1| histone H4 [Ananas comosus]
ref|XP_020083540.1| histone H4 [Ananas comosus]
ref|XP_020084450.1| histone H4 [Ananas comosus]
ref|XP_020085925.1| histone H4 [Ananas comosus]
ref|XP_020091513.1| histone H4 [Ananas comosus]
ref|XP_020093856.1| histone H4 [Ananas comosus]
ref|XP_020103264.1| histone H4 [Ananas comosus]
ref|XP_020113492.1| histone H4 [Ananas comosus]
ref|XP_020114137.1| histone H4 [Ananas comosus]
ref|XP_020197329.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020146241.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020153967.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020160641.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020176722.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020177269.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020180110.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020183599.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020183604.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020183951.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020186569.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020189180.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020189184.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020189186.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020190975.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020195819.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020195820.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020195821.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020199877.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020200225.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020201075.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020146435.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020147506.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020161978.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020162652.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020164571.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020164951.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020165875.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020165901.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020166659.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020172790.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020176330.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020176567.1| histone H4 [Aegilops tauschii subsp. tauschii]
ref|XP_020236808.1| histone H4 [Cajanus cajan]
ref|XP_020239049.1| histone H4 [Cajanus cajan]
ref|XP_020207752.1| histone H4 [Cajanus cajan]
ref|XP_020221135.1| histone H4 [Cajanus cajan]
ref|XP_020214786.1| histone H4 [Cajanus cajan]
ref|XP_020223991.1| histone H4 [Cajanus cajan]
ref|XP_020227233.1| histone H4 [Cajanus cajan]
ref|XP_020264716.1| histone H4 [Asparagus officinalis]
ref|XP_020270212.1| histone H4 [Asparagus officinalis]
ref|XP_020275824.1| histone H4 [Asparagus officinalis]
ref|XP_020241898.1| histone H4 [Asparagus officinalis]
ref|XP_020244089.1| histone H4 [Asparagus officinalis]
ref|XP_008668988.2| histone H4 [Zea mays]
ref|XP_020551922.1| histone H4 [Sesamum indicum]
ref|XP_020582078.1| histone H4 [Phalaenopsis equestris]
ref|XP_020587032.1| histone H4 [Phalaenopsis equestris]
ref|XP_020574636.1| histone H4 [Phalaenopsis equestris]
ref|XP_020575609.1| histone H4 [Phalaenopsis equestris]
ref|XP_020597240.1| histone H4 [Phalaenopsis equestris]
ref|XP_020685660.1| histone H4 [Dendrobium catenatum]
ref|XP_020685681.1| histone H4 [Dendrobium catenatum]
ref|XP_020692374.1| histone H4 [Dendrobium catenatum]
ref|XP_020692375.1| histone H4 [Dendrobium catenatum]
ref|XP_020693310.1| histone H4 [Dendrobium catenatum]
ref|XP_020674550.1| histone H4 [Dendrobium catenatum]
ref|XP_020674934.1| histone H4 [Dendrobium catenatum]
ref|XP_020868710.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020868758.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020884530.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020879701.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020880172.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020880298.1| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_002866359.2| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_002862282.2| histone H4 [Arabidopsis lyrata subsp. lyrata]
ref|XP_020999550.1| histone H4 [Arachis duranensis]
ref|XP_020999556.1| histone H4 [Arachis duranensis]
ref|XP_021276513.1| histone H4 [Herrania umbratica]
ref|XP_021278635.1| histone H4 [Herrania umbratica]
ref|XP_021279187.1| histone H4 [Herrania umbratica]
ref|XP_021288954.1| histone H4 [Herrania umbratica]
ref|XP_021288955.1| histone H4 [Herrania umbratica]
ref|XP_021295066.1| histone H4 [Herrania umbratica]
ref|XP_021295273.1| histone H4 [Herrania umbratica]
ref|XP_021295923.1| histone H4 [Herrania umbratica]
ref|XP_021630441.1| histone H4 [Manihot esculenta]
ref|XP_021604719.1| histone H4 [Manihot esculenta]
ref|XP_021609403.1| histone H4 [Manihot esculenta]
ref|XP_021609540.1| histone H4 [Manihot esculenta]
ref|XP_021615854.1| histone H4 [Manihot esculenta]
ref|XP_021617492.1| histone H4 [Manihot esculenta]
ref|XP_021624939.1| histone H4 [Manihot esculenta]
ref|XP_021628581.1| histone H4 [Manihot esculenta]
ref|XP_021591740.1| histone H4 [Manihot esculenta]
ref|XP_021665395.1| histone H4 [Hevea brasiliensis]
ref|XP_021666604.1| histone H4 [Hevea brasiliensis]
ref|XP_021674886.1| histone H4 [Hevea brasiliensis]
ref|XP_021681117.1| histone H4 [Hevea brasiliensis]
ref|XP_021687392.1| histone H4 [Hevea brasiliensis]
ref|XP_021687393.1| histone H4 [Hevea brasiliensis]
ref|XP_021689202.1| histone H4 [Hevea brasiliensis]
ref|XP_021638501.1| histone H4 [Hevea brasiliensis]
ref|XP_021640757.1| histone H4 [Hevea brasiliensis]
ref|XP_021654410.1| histone H4 [Hevea brasiliensis]
ref|XP_021658344.1| histone H4 [Hevea brasiliensis]
ref|XP_021663081.1| histone H4 [Hevea brasiliensis]
ref|XP_021757711.1| histone H4 [Chenopodium quinoa]
ref|XP_021757712.1| histone H4 [Chenopodium quinoa]
ref|XP_021766201.1| histone H4 [Chenopodium quinoa]
ref|XP_021766202.1| histone H4 [Chenopodium quinoa]
ref|XP_021767869.1| histone H4 [Chenopodium quinoa]
ref|XP_021767870.1| histone H4 [Chenopodium quinoa]
ref|XP_021769562.1| histone H4 [Chenopodium quinoa]
ref|XP_021770972.1| histone H4 [Chenopodium quinoa]
ref|XP_021770973.1| histone H4 [Chenopodium quinoa]
ref|XP_021771231.1| histone H4 [Chenopodium quinoa]
ref|XP_021713480.1| histone H4 [Chenopodium quinoa]
ref|XP_021716192.1| histone H4 [Chenopodium quinoa]
ref|XP_021720904.1| histone H4 [Chenopodium quinoa]
ref|XP_021721601.1| histone H4 [Chenopodium quinoa]
ref|XP_021738317.1| histone H4 [Chenopodium quinoa]
ref|XP_021741144.1| histone H4 [Chenopodium quinoa]
ref|XP_021811294.1| histone H4 [Prunus avium]
ref|XP_021813846.1| histone H4 [Prunus avium]
ref|XP_021813868.1| histone H4 [Prunus avium]
ref|XP_021816542.1| histone H4 [Prunus avium]
ref|XP_021819100.1| histone H4 [Prunus avium]
ref|XP_021820341.1| histone H4 [Prunus avium]
ref|XP_021824009.1| histone H4 [Prunus avium]
ref|XP_021845438.1| histone H4 [Spinacia oleracea]
ref|XP_021848374.1| histone H4 [Spinacia oleracea]
ref|XP_021849088.1| histone H4 [Spinacia oleracea]
ref|XP_021850397.1| histone H4 [Spinacia oleracea]
ref|XP_021851994.1| histone H4 [Spinacia oleracea]
ref|XP_021892860.1| histone H4 [Carica papaya]
ref|XP_021887636.1| histone H4 [Carica papaya]
ref|XP_021888050.1| histone H4 [Carica papaya]
ref|XP_021889822.1| histone H4 [Carica papaya]
ref|XP_021910298.1| histone H4 [Carica papaya]
ref|XP_021910299.1| histone H4 [Carica papaya]
ref|XP_021976787.1| histone H4 [Helianthus annuus]
ref|XP_022018999.1| histone H4 [Helianthus annuus]
ref|XP_022027940.1| histone H4 [Helianthus annuus]
ref|XP_022027941.1| histone H4 [Helianthus annuus]
ref|XP_022037954.1| histone H4 [Helianthus annuus]
ref|XP_022038020.1| histone H4 [Helianthus annuus]
ref|XP_022038534.1| histone H4 [Helianthus annuus]
ref|XP_022038535.1| histone H4 [Helianthus annuus]
ref|XP_022040995.1| histone H4 [Helianthus annuus]
ref|XP_021970196.1| histone H4 [Helianthus annuus]
ref|XP_021970831.1| histone H4 [Helianthus annuus]
ref|XP_021977071.1| histone H4 [Helianthus annuus]
ref|XP_021978386.1| histone H4 [Helianthus annuus]
ref|XP_021981373.1| histone H4 [Helianthus annuus]
ref|XP_021982247.1| histone H4 [Helianthus annuus]
ref|XP_021982248.1| histone H4 [Helianthus annuus]
ref|XP_021989610.1| histone H4 [Helianthus annuus]
ref|XP_021997869.1| histone H4 [Helianthus annuus]
ref|XP_021997872.1| histone H4 [Helianthus annuus]
ref|XP_021997873.1| histone H4 [Helianthus annuus]
ref|XP_021997874.1| histone H4 [Helianthus annuus]
ref|XP_022001278.1| histone H4 [Helianthus annuus]
ref|XP_022005182.1| histone H4 [Helianthus annuus]
ref|XP_022008633.1| histone H4 [Helianthus annuus]
ref|XP_022008686.1| histone H4 [Helianthus annuus]
ref|XP_022009096.1| histone H4 [Helianthus annuus]
ref|XP_022011720.1| histone H4 [Helianthus annuus]
ref|XP_022013262.1| histone H4 [Helianthus annuus]
ref|XP_022013266.1| histone H4 [Helianthus annuus]
ref|XP_022021488.1| histone H4 [Helianthus annuus]
ref|XP_022148379.1| histone H4 [Momordica charantia]
ref|XP_022159401.1| histone H4 [Momordica charantia]
ref|XP_022572790.1| histone H4 [Brassica napus]
ref|XP_022574099.1| histone H4 [Brassica napus]
ref|XP_022559642.1| histone H4 [Brassica napus]
ref|XP_022752765.1| histone H4 [Durio zibethinus]
ref|XP_022752801.1| histone H4 [Durio zibethinus]
ref|XP_022755702.1| histone H4 [Durio zibethinus]
ref|XP_022755743.1| histone H4 [Durio zibethinus]
ref|XP_022767521.1| histone H4 [Durio zibethinus]
ref|XP_022715401.1| histone H4 [Durio zibethinus]
ref|XP_022728968.1| histone H4 [Durio zibethinus]
ref|XP_022742643.1| histone H4 [Durio zibethinus]
ref|XP_022748254.1| histone H4 [Durio zibethinus]
ref|XP_022851491.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022865282.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022867328.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022868932.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022868933.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022869544.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022872768.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022873696.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022877016.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022887447.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022893127.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022893526.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022847007.1| histone H4 [Olea europaea var. sylvestris]
ref|XP_022923792.1| histone H4 [Cucurbita moschata]
ref|XP_022943982.1| histone H4 [Cucurbita moschata]
ref|XP_022943983.1| histone H4 [Cucurbita moschata]
ref|XP_022944592.1| histone H4 [Cucurbita moschata]
ref|XP_022947467.1| histone H4 [Cucurbita moschata]
ref|XP_022947468.1| histone H4 [Cucurbita moschata]
ref|XP_022947505.1| histone H4 [Cucurbita moschata]
ref|XP_022947506.1| histone H4 [Cucurbita moschata]
ref|XP_022948276.1| histone H4 [Cucurbita moschata]
ref|XP_022964718.1| histone H4 [Cucurbita moschata]
ref|XP_022986969.1| histone H4 [Cucurbita maxima]
ref|XP_022986970.1| histone H4 [Cucurbita maxima]
ref|XP_022986971.1| histone H4 [Cucurbita maxima]
ref|XP_022991075.1| histone H4 [Cucurbita maxima]
ref|XP_022998072.1| histone H4 [Cucurbita maxima]
ref|XP_023006962.1| histone H4 [Cucurbita maxima]
ref|XP_023006963.1| histone H4 [Cucurbita maxima]
ref|XP_023006964.1| histone H4 [Cucurbita maxima]
ref|XP_023006966.1| histone H4 [Cucurbita maxima]
ref|XP_022970461.1| histone H4 [Cucurbita maxima]
ref|XP_023521253.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023547129.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023524998.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023532330.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023532331.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023532332.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023532333.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023512029.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023512030.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023512031.1| histone H4 [Cucurbita pepo subsp. pepo]
ref|XP_023638361.1| histone H4 [Capsella rubella]
ref|XP_023742330.1| histone H4 [Lactuca sativa]
ref|XP_023748101.1| histone H4 [Lactuca sativa]
ref|XP_023749799.1| histone H4 [Lactuca sativa]
ref|XP_023749800.1| histone H4 [Lactuca sativa]
ref|XP_023749801.1| histone H4 [Lactuca sativa]
ref|XP_023750914.1| histone H4 [Lactuca sativa]
ref|XP_023750915.1| histone H4 [Lactuca sativa]
ref|XP_023748794.1| histone H4 [Lactuca sativa]
ref|XP_023757681.1| histone H4 [Lactuca sativa]
ref|XP_023761034.1| histone H4 [Lactuca sativa]
ref|XP_023761068.1| histone H4 [Lactuca sativa]
ref|XP_023761070.1| histone H4 [Lactuca sativa]
ref|XP_023761162.1| histone H4 [Lactuca sativa]
ref|XP_023761163.1| histone H4 [Lactuca sativa]
ref|XP_023765329.1| histone H4 [Lactuca sativa]
ref|XP_023771220.1| histone H4 [Lactuca sativa]
ref|XP_023772401.1| histone H4 [Lactuca sativa]
ref|XP_023730459.1| histone H4 [Lactuca sativa]
ref|XP_023730460.1| histone H4 [Lactuca sativa]
ref|XP_023730461.1| histone H4 [Lactuca sativa]
ref|XP_023730465.1| histone H4 [Lactuca sativa]
ref|XP_023731748.1| histone H4 [Lactuca sativa]
ref|XP_023731749.1| histone H4 [Lactuca sativa]
ref|XP_023737272.1| histone H4 [Lactuca sativa]
ref|XP_023737935.1| histone H4 [Lactuca sativa]
ref|XP_023742109.1| histone H4 [Lactuca sativa]
ref|XP_023876250.1| histone H4 [Quercus suber]
ref|XP_023884217.1| histone H4 [Quercus suber]
ref|XP_023888716.1| histone H4 [Quercus suber]
ref|XP_023904034.1| histone H4 [Quercus suber]
ref|XP_023904035.1| histone H4 [Quercus suber]
ref|XP_023913690.1| histone H4 [Quercus suber]
ref|XP_023913709.1| histone H4 [Quercus suber]
ref|XP_023913710.1| histone H4 [Quercus suber]
ref|XP_024019744.1| histone H4 [Morus notabilis]
ref|XP_024176813.1| histone H4 [Rosa chinensis]
ref|XP_024186436.1| histone H4 [Rosa chinensis]
ref|XP_024199218.1| histone H4 [Rosa chinensis]
ref|XP_024157215.1| histone H4 [Rosa chinensis]
ref|XP_024157217.1| histone H4 [Rosa chinensis]
ref|XP_024157491.1| histone H4 [Rosa chinensis]
ref|XP_024157492.1| histone H4 [Rosa chinensis]
ref|XP_024157493.1| histone H4 [Rosa chinensis]
ref|XP_024173275.1| histone H4 [Rosa chinensis]
sp|P59259.2|H4_ARATH RecName: Full=Histone H4
sp|Q6LAF3.3|H4_FLATR RecName: Full=Histone H4
sp|Q6PMI5.3|H4_CHEMJ RecName: Full=Histone H4
sp|Q6WZ83.3|H4_EUCGL RecName: Full=Histone H4
sp|Q76H85.3|H4_SILLA RecName: Full=Histone H4
sp|P62788.2|H4_PEA RecName: Full=Histone H4
sp|P62787.2|H4_MAIZE RecName: Full=Histone H4
sp|P62887.2|H4_LOLTE RecName: Full=Histone H4
sp|P62785.2|H41_WHEAT RecName: Full=Histone H4 variant TH011
sp|P0CG89.1|H4_SOYBN RecName: Full=Histone H4
gb|AAF75072.1|AC007583_8 Identical to histone H4 from Arabidopsis thaliana gi|S06904
[Arabidopsis thaliana]
gb|AAF75089.1|AC007583_25 Identical to histone H4 from Arabidopsis thaliana gi|S06904
[Arabidopsis thaliana]
gb|AAG40410.1|AF325058_1 AT5g59690 [Arabidopsis thaliana]
gb|AAG46106.1|AC073166_4 histone H4 [Oryza sativa Japonica Group]
gb|AAG50107.1|AF334729_1 putative histone H4 protein [Arabidopsis thaliana]
emb|CAA24924.1| unnamed protein product [Triticum aestivum]
gb|AAA32810.1| histone H4 [Arabidopsis thaliana]
gb|AAA32811.1| histone H4 [Arabidopsis thaliana]
gb|AAA33474.1| histone H4 (H4C13) [Zea mays]
gb|AAA33475.1| histone H4 [Zea mays]
gb|AAA33476.1| histone H4 [Zea mays]
gb|AAA86948.1| histone H4 homolog [Pisum sativum]
emb|CAB01914.1| histone H4 homologue [Sesbania rostrata]
gb|AAC79580.1| histone H4 [Arabidopsis thaliana]
dbj|BAA85120.1| histone H4-like protein [Solanum melongena]
emb|CAB62023.1| histone H4-like protein [Arabidopsis thaliana]
emb|CAB82817.1| Histone H4-like protein [Arabidopsis thaliana]
emb|CAB88335.1| histone H4-like protein [Arabidopsis thaliana]
dbj|BAB08365.1| histone H4 [Arabidopsis thaliana]
dbj|BAB09507.1| histone H4 [Arabidopsis thaliana]
emb|CAC34411.1| histone H4 [Flaveria trinervia]
gb|AAL14404.1| AT5g59690/mth12_90 [Arabidopsis thaliana]
gb|AAL32795.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAL36213.1| putative histone H4 protein [Arabidopsis thaliana]
dbj|BAB89744.1| histone H4 [Oryza sativa Japonica Group]
gb|AAM15445.1| histone H4 [Arabidopsis thaliana]
gb|AAM13352.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM20526.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM61726.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM62721.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM63175.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM63839.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM64264.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM64622.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM64744.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM70545.1| AT5g59690/mth12_90 [Arabidopsis thaliana]
gb|AAM91255.1| histone H4-like protein [Arabidopsis thaliana]
gb|AAM93740.1| histone H4 [Oryza sativa Japonica Group]
gb|AAN13189.1| putative histone H4 protein [Arabidopsis thaliana]
gb|AAO15293.1| Unknown protein [Oryza sativa Japonica Group]
dbj|BAC56852.1| histone H4 [Silene latifolia]
gb|AAO41978.1| putative histone H4 protein [Arabidopsis thaliana]
gb|AAO44010.1| At1g07820 [Arabidopsis thaliana]
dbj|BAC57734.1| histone H4 [Oryza sativa Japonica Group]
gb|AAO50503.1| putative histone H4 protein [Arabidopsis thaliana]
gb|AAP33088.1| histone H4 [Eucalyptus globulus]
gb|AAP54838.1| Histone H4, putative, expressed [Oryza sativa Japonica Group]
emb|CAD41377.2| OSJNBa0088A01.17 [Oryza sativa Japonica Group]
dbj|BAD07563.1| histone H4 [Oryza sativa Japonica Group]
gb|AAT01924.1| histone H4 [Chelidonium majus]
gb|AAT39190.1| putative histone H4 [Oryza sativa Japonica Group]
gb|AAT58763.1| histone H4 [Oryza sativa Japonica Group]
gb|AAT58785.1| histone H4 [Oryza sativa Japonica Group]
dbj|BAD27874.1| histone H4 [Oryza sativa Japonica Group]
dbj|BAD33556.1| histone H4 [Oryza sativa Japonica Group]
dbj|BAD43276.1| histone H4 [Arabidopsis thaliana]
dbj|BAD43606.1| histone H4 [Arabidopsis thaliana]
dbj|BAD43910.1| histone H4 [Arabidopsis thaliana]
gb|AAU90170.1| histone H4 [Oryza sativa Japonica Group]
dbj|BAD82897.1| histone H4, partial [Fragaria x ananassa]
gb|AAX92702.1| histone 4 [Picea abies]
gb|ABD28289.1| histone H4-like protein [Glycine max]
gb|ABD38885.1| At3g45930 [Arabidopsis thaliana]
gb|ABE87620.1| Histone core [Medicago truncatula]
gb|ABF93682.1| Histone H4, putative, expressed [Oryza sativa Japonica Group]
dbj|BAF01106.1| Histone H4 - like protein [Arabidopsis thaliana]
dbj|BAF00179.1| histone H4 [Arabidopsis thaliana]
dbj|BAF09676.1| Os02g0684500 [Oryza sativa Japonica Group]
dbj|BAF10697.1| Os03g0119900 [Oryza sativa Japonica Group]
dbj|BAF15578.1| Os04g0583600 [Oryza sativa Japonica Group]
dbj|BAF17683.1| Os05g0462700 [Oryza sativa Japonica Group]
dbj|BAF17700.1| Os05g0466600 [Oryza sativa Japonica Group]
dbj|BAF25159.1| Os09g0433600 [Oryza sativa Japonica Group]
dbj|BAF25792.1| Os09g0553100 [Oryza sativa Japonica Group]
dbj|BAF27093.1| Os10g0539500 [Oryza sativa Japonica Group]
gb|ABK20879.1| unknown [Picea sitchensis]
gb|ABK22619.1| unknown [Picea sitchensis]
gb|ABK24738.1| unknown [Picea sitchensis]
gb|ABK26777.1| unknown [Picea sitchensis]
gb|ABK93286.1| unknown [Populus trichocarpa]
gb|ABK94246.1| unknown [Populus trichocarpa]
gb|ABK94634.1| unknown [Populus trichocarpa]
gb|ABN08909.1| Histone core [Medicago truncatula]
gb|EAY76410.1| hypothetical protein OsI_04340 [Oryza sativa Indica Group]
gb|EAY79363.1| hypothetical protein OsI_34491 [Oryza sativa Indica Group]
gb|EAY87099.1| hypothetical protein OsI_08497 [Oryza sativa Indica Group]
gb|EAY88304.1| hypothetical protein OsI_09762 [Oryza sativa Indica Group]
gb|EAY95298.1| hypothetical protein OsI_17123 [Oryza sativa Indica Group]
gb|EAY98337.1| hypothetical protein OsI_20247 [Oryza sativa Indica Group]
gb|EAY98358.1| hypothetical protein OsI_20269 [Oryza sativa Indica Group]
gb|EAZ04270.1| hypothetical protein OsI_26413 [Oryza sativa Indica Group]
gb|EAZ09209.1| hypothetical protein OsI_31484 [Oryza sativa Indica Group]
gb|EAZ10018.1| hypothetical protein OsI_32321 [Oryza sativa Indica Group]
gb|EAZ14069.1| hypothetical protein OsJ_03994 [Oryza sativa Japonica Group]
gb|EAZ16833.1| hypothetical protein OsJ_32304 [Oryza sativa Japonica Group]
gb|EAZ24208.1| hypothetical protein OsJ_07955 [Oryza sativa Japonica Group]
gb|EAZ25381.1| hypothetical protein OsJ_09199 [Oryza sativa Japonica Group]
gb|EAZ31763.1| hypothetical protein OsJ_15915 [Oryza sativa Japonica Group]
gb|EAZ40221.1| hypothetical protein OsJ_24666 [Oryza sativa Japonica Group]
gb|EAZ45602.1| hypothetical protein OsJ_30268 [Oryza sativa Japonica Group]
gb|ABQ32303.1| putative histone H4-like protein [Artemisia annua]
emb|CAN64268.1| hypothetical protein VITISV_036365 [Vitis vinifera]
emb|CAN59705.1| hypothetical protein VITISV_010247, partial [Vitis vinifera]
emb|CAN59706.1| hypothetical protein VITISV_010248 [Vitis vinifera]
emb|CAN68239.1| hypothetical protein VITISV_006985 [Vitis vinifera]
emb|CAN63143.1| hypothetical protein VITISV_034577 [Vitis vinifera]
emb|CAN79580.1| hypothetical protein VITISV_002271 [Vitis vinifera]
emb|CAN79581.1| hypothetical protein VITISV_002272 [Vitis vinifera]
emb|CAN79612.1| hypothetical protein VITISV_035467 [Vitis vinifera]
emb|CAN79680.1| hypothetical protein VITISV_034640 [Vitis vinifera]
emb|CAN83554.1| hypothetical protein VITISV_030356 [Vitis vinifera]
gb|ABW81095.1| H4his18 [Tarenaya spinosa]
gb|ACF80052.1| unknown [Zea mays]
gb|ACF80828.1| unknown [Zea mays]
gb|ACF82225.1| unknown [Zea mays]
gb|ACF82288.1| unknown [Zea mays]
gb|ACF83229.1| unknown [Zea mays]
gb|ACF83575.1| unknown [Zea mays]
gb|ACF83765.1| unknown [Zea mays]
gb|ACF84258.1| unknown [Zea mays]
gb|ACF86280.1| unknown [Zea mays]
gb|ACF87214.1| unknown [Zea mays]
gb|ACF88257.1| unknown [Zea mays]
gb|ACG24613.1| histone H4 [Zea mays]
gb|ACG24646.1| histone H4 [Zea mays]
gb|ACG24650.1| histone H4 [Zea mays]
gb|ACG24821.1| histone H4 [Zea mays]
gb|ACG25074.1| histone H4 [Zea mays]
gb|ACG25156.1| histone H4 [Zea mays]
gb|ACG25337.1| histone H4 [Zea mays]
gb|ACG25500.1| histone H4 [Zea mays]
gb|ACG30422.1| histone H4 [Zea mays]
gb|ACG30452.1| histone H4 [Zea mays]
gb|ACG30684.1| histone H4 [Zea mays]
gb|ACG30745.1| histone H4 [Zea mays]
gb|ACG30750.1| histone H4 [Zea mays]
gb|ACG30751.1| histone H4 [Zea mays]
gb|ACG30770.1| histone H4 [Zea mays]
gb|ACG30834.1| histone H4 [Zea mays]
gb|ACG30836.1| histone H4 [Zea mays]
gb|ACG30868.1| histone H4 [Zea mays]
gb|ACG30869.1| histone H4 [Zea mays]
gb|ACG30873.1| histone H4 [Zea mays]
gb|ACG30917.1| histone H4 [Zea mays]
gb|ACG30996.1| histone H4 [Zea mays]
gb|ACG31045.1| histone H4 [Zea mays]
gb|ACG31057.1| histone H4 [Zea mays]
gb|ACG31229.1| histone H4 [Zea mays]
gb|ACG31230.1| histone H4 [Zea mays]
gb|ACG31234.1| histone H4 [Zea mays]
gb|ACG31300.1| histone H4 [Zea mays]
gb|ACG31315.1| histone H4 [Zea mays]
gb|ACG31919.1| histone H4 [Zea mays]
gb|ACG32609.1| histone H4 [Zea mays]
gb|ACG33427.1| histone H4 [Zea mays]
gb|ACG34413.1| histone H4 [Zea mays]
gb|ACG34866.1| histone H4 [Zea mays]
gb|ACG35951.1| histone H4 [Zea mays]
gb|ACG35976.1| histone H4 [Zea mays]
gb|ACG36015.1| histone H4 [Zea mays]
gb|ACG36304.1| histone H4 [Zea mays]
gb|ACG36622.1| histone H4 [Zea mays]
gb|ACG37000.1| histone H4 [Zea mays]
gb|ACG37250.1| histone H4 [Zea mays]
gb|ACG37605.1| histone H4 [Zea mays]
gb|ACG37825.1| histone H4 [Zea mays]
gb|ACG38812.1| histone H4 [Zea mays]
gb|ACG39221.1| histone H4 [Zea mays]
gb|ACG48479.1| histone H4 [Zea mays]
gb|ACG48490.1| histone H4 [Zea mays]
gb|ACG48509.1| histone H4 [Zea mays]
gb|ACG48644.1| histone H4 [Zea mays]
gb|ACG48693.1| histone H4 [Zea mays]
gb|ACG49121.1| histone H4 [Zea mays]
dbj|BAG97383.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG86775.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG86791.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG86871.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG86892.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG99598.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAG99753.1| unnamed protein product [Oryza sativa Japonica Group]
dbj|BAH19766.1| AT1G07820 [Arabidopsis thaliana]
gb|EEE64000.1| hypothetical protein OsJ_18829 [Oryza sativa Japonica Group]
gb|EEE69764.1| hypothetical protein OsJ_29473 [Oryza sativa Japonica Group]
gb|EEF29565.1| histone h4, putative [Ricinus communis]
gb|EEF30724.1| histone h4, putative [Ricinus communis]
gb|EEF30726.1| histone h4, putative [Ricinus communis]
gb|EEF37320.1| histone h4, putative [Ricinus communis]
gb|EEF43473.1| histone h4, putative [Ricinus communis]
gb|EEF51073.1| histone h4, putative [Ricinus communis]
gb|ACN35499.1| unknown [Zea mays]
gb|ACN40254.1| unknown [Picea sitchensis]
gb|ACR36979.1| unknown [Zea mays]
gb|ACR37190.1| unknown [Zea mays]
gb|ACR38106.1| unknown [Zea mays]
gb|ACR38167.1| unknown [Zea mays]
gb|ACR38202.1| unknown [Zea mays]
gb|ACR38482.1| unknown [Zea mays]
gb|EER95622.1| hypothetical protein SORBI_3001G313200 [Sorghum bicolor]
gb|EER96771.1| hypothetical protein SORBI_3002G210500 [Sorghum bicolor]
gb|EES00250.1| hypothetical protein SORBI_3003G057100 [Sorghum bicolor]
gb|EES00251.1| hypothetical protein SORBI_3003G347900 [Sorghum bicolor]
gb|EES01716.1| hypothetical protein SORBI_3003G056600 [Sorghum bicolor]
gb|EES12723.1| hypothetical protein SORBI_3006G191800 [Sorghum bicolor]
gb|EES18362.1| hypothetical protein SORBI_3009G167500 [Sorghum bicolor]
gb|ACU13340.1| unknown [Glycine max]
dbj|BAF06643.2| Os01g0835900 [Oryza sativa Japonica Group]
dbj|BAH93978.1| Os07g0549900 [Oryza sativa Japonica Group]
gb|EFH40906.1| hypothetical protein ARALYDRAFT_496101 [Arabidopsis lyrata subsp.
lyrata]
gb|EFH52016.1| hypothetical protein ARALYDRAFT_484971 [Arabidopsis lyrata subsp.
lyrata]
gb|EFH53740.1| hypothetical protein ARALYDRAFT_485010 [Arabidopsis lyrata subsp.
lyrata]
gb|EFH54197.1| hypothetical protein ARALYDRAFT_485763 [Arabidopsis lyrata subsp.
lyrata]
gb|EFH57265.1| hypothetical protein ARALYDRAFT_481787 [Arabidopsis lyrata subsp.
lyrata]
dbj|BAJ89933.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK01803.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ94137.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK02226.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ98718.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK06265.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK02764.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ91174.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ91200.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ86564.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ86578.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK04181.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ88750.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK04343.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK04649.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK08280.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK05058.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAK05158.1| predicted protein [Hordeum vulgare subsp. vulgare]
dbj|BAJ93645.1| predicted protein [Hordeum vulgare subsp. vulgare]
gb|AEC08165.1| histone H4 [Arabidopsis thaliana]
gb|AEC10949.1| histone H4 [Camellia sinensis]
gb|AED97220.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AED97260.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE28158.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE28187.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE28188.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE78091.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE78146.1| Histone superfamily protein [Arabidopsis thaliana]
gb|AEE79133.1| Histone superfamily protein [Arabidopsis thaliana]
dbj|BAK64064.1| histone H4 [Physcomitrella patens]
gb|AES67553.1| histone H4 domain protein [Medicago truncatula]
gb|AES70711.1| histone H4 domain protein [Medicago truncatula]
gb|AES71173.1| histone H4 domain protein [Medicago truncatula]
gb|AES81699.1| histone H4 domain protein [Medicago truncatula]
gb|AES88763.1| histone H4 domain protein [Medicago truncatula]
gb|AES98050.1| histone H4 domain protein [Medicago truncatula]
gb|AET02278.1| histone H4 domain protein [Medicago truncatula]
gb|AEW08074.1| hypothetical protein 0_18315_01 [Pinus radiata]
gb|AFG63669.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63670.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63671.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63672.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63673.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63674.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63675.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63676.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63677.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63678.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63679.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63680.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63681.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63682.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63683.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63684.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFG63685.1| hypothetical protein 0_18315_01 [Pinus taeda]
gb|AFK36911.1| unknown [Lotus japonicus]
gb|AFK40229.1| unknown [Medicago truncatula]
gb|AFK40827.1| unknown [Medicago truncatula]
gb|AFK42163.1| unknown [Lotus japonicus]
gb|AFK43817.1| unknown [Lotus japonicus]
gb|AFK47341.1| unknown [Medicago truncatula]
emb|CCI55324.1| PH01B001I13.20 [Phyllostachys edulis]
gb|EMS51036.1| Histone H4 [Triticum urartu]
gb|EMS54800.1| Histone H4 [Triticum urartu]
gb|EMS57442.1| Histone H4 [Triticum urartu]
gb|EMS58789.1| Histone H4 [Triticum urartu]
gb|EMS59432.1| Histone H4 [Triticum urartu]
gb|EMS61471.1| Histone H4 [Triticum urartu]
gb|EMS63901.1| Histone H4 [Triticum urartu]
gb|EMS64239.1| Histone H4 [Triticum urartu]
gb|EMS66687.1| Histone H4 [Triticum urartu]
gb|EMS67260.1| Histone H4 [Triticum urartu]
gb|EOA12403.1| hypothetical protein CARUB_v10027423mg [Capsella rubella]
gb|EOA24996.1| hypothetical protein CARUB_v10018293mg [Capsella rubella]
gb|EOA24997.1| hypothetical protein CARUB_v10018294mg [Capsella rubella]
gb|EOA28192.1| hypothetical protein CARUB_v10024384mg [Capsella rubella]
gb|EOA36353.1| hypothetical protein CARUB_v10010716mg [Capsella rubella]
gb|EOA36355.1| hypothetical protein CARUB_v10010719mg [Capsella rubella]
gb|EOY07569.1| Histone superfamily protein isoform 1 [Theobroma cacao]
gb|EOY07571.1| Histone superfamily protein [Theobroma cacao]
gb|EOY18195.1| Histone superfamily protein [Theobroma cacao]
gb|EOY27447.1| Histone superfamily protein [Theobroma cacao]
gb|EOY31835.1| Histone superfamily protein [Theobroma cacao]
gb|EOY34102.1| Histone superfamily protein [Theobroma cacao]
gb|EOY34196.1| Histone superfamily protein [Theobroma cacao]
gb|EPS60847.1| hypothetical protein M569_13955 [Genlisea aurea]
gb|EPS69507.1| hypothetical protein M569_05259 [Genlisea aurea]
gb|EPS69742.1| hypothetical protein M569_05024 [Genlisea aurea]
gb|EPS72649.1| hypothetical protein M569_02106 [Genlisea aurea]
gb|ERM96612.1| hypothetical protein AMTR_s00001p00271490 [Amborella trichopoda]
gb|ERN03265.1| hypothetical protein AMTR_s00003p00201000 [Amborella trichopoda]
gb|ERN03394.1| hypothetical protein AMTR_s00003p00256370 [Amborella trichopoda]
gb|ERN05340.1| hypothetical protein AMTR_s00007p00186150 [Amborella trichopoda]
gb|ERN07308.1| hypothetical protein AMTR_s00019p00220160 [Amborella trichopoda]
gb|ERN07310.1| hypothetical protein AMTR_s00019p00220720 [Amborella trichopoda]
gb|ERN07312.1| hypothetical protein AMTR_s00019p00221780 [Amborella trichopoda]
gb|ERN14802.1| hypothetical protein AMTR_s00032p00078840 [Amborella trichopoda]
gb|ERN17625.1| hypothetical protein AMTR_s00059p00172830 [Amborella trichopoda]
gb|ESQ36115.1| hypothetical protein EUTSA_v10009172mg [Eutrema salsugineum]
gb|ESQ37356.1| hypothetical protein EUTSA_v10002735mg [Eutrema salsugineum]
gb|ESQ37418.1| hypothetical protein EUTSA_v10002736mg [Eutrema salsugineum]
gb|ESQ42347.1| hypothetical protein EUTSA_v10016102mg [Eutrema salsugineum]
gb|ESQ42381.1| hypothetical protein EUTSA_v10015098mg [Eutrema salsugineum]
gb|ESQ45113.1| hypothetical protein EUTSA_v10010851mg [Eutrema salsugineum]
gb|ESQ51360.1| hypothetical protein EUTSA_v10017468mg [Eutrema salsugineum]
gb|ESQ52397.1| hypothetical protein EUTSA_v10017467mg [Eutrema salsugineum]
gb|ESR37954.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
gb|ESR37955.1| hypothetical protein CICLE_v10029643mg [Citrus clementina]
gb|ESR38023.1| hypothetical protein CICLE_v10029640mg [Citrus clementina]
gb|ESR42275.1| hypothetical protein CICLE_v10013183mg [Citrus clementina]
gb|ESR66617.1| hypothetical protein CICLE_v10009994mg [Citrus clementina]
gb|ESW04131.1| hypothetical protein PHAVU_011G069700g [Phaseolus vulgaris]
gb|ESW14230.1| hypothetical protein PHAVU_008G263800g [Phaseolus vulgaris]
gb|ESW18740.1| hypothetical protein PHAVU_006G066300g [Phaseolus vulgaris]
gb|ESW18741.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
gb|ESW18742.1| hypothetical protein PHAVU_006G066400g [Phaseolus vulgaris]
gb|ESW22258.1| hypothetical protein PHAVU_005G139600g [Phaseolus vulgaris]
gb|ESW26760.1| hypothetical protein PHAVU_003G145900g [Phaseolus vulgaris]
gb|ESW34650.1| hypothetical protein PHAVU_001G169200g [Phaseolus vulgaris]
gb|EXB52247.1| Histone H4 [Morus notabilis]
gb|EXB53247.1| Histone H4 [Morus notabilis]
gb|EXC02146.1| Histone H4 [Morus notabilis]
gb|EYU18905.1| hypothetical protein MIMGU_mgv1a016881mg [Erythranthe guttata]
gb|EYU20074.1| hypothetical protein MIMGU_mgv1a016888mg [Erythranthe guttata]
gb|EYU26577.1| hypothetical protein MIMGU_mgv1a023067mg [Erythranthe guttata]
gb|EYU26674.1| hypothetical protein MIMGU_mgv1a016867mg [Erythranthe guttata]
gb|EYU27473.1| hypothetical protein MIMGU_mgv1a023717mg [Erythranthe guttata]
gb|EYU33728.1| hypothetical protein MIMGU_mgv1a018239mg [Erythranthe guttata]
gb|EYU41706.1| hypothetical protein MIMGU_mgv1a016883mg [Erythranthe guttata]
gb|KCW49468.1| hypothetical protein EUGRSUZ_K02990 [Eucalyptus grandis]
gb|KCW49627.1| hypothetical protein EUGRSUZ_K03149 [Eucalyptus grandis]
gb|KCW51668.1| hypothetical protein EUGRSUZ_J01149 [Eucalyptus grandis]
gb|KCW72615.1| hypothetical protein EUGRSUZ_E01075 [Eucalyptus grandis]
gb|KCW77293.1| hypothetical protein EUGRSUZ_D01652 [Eucalyptus grandis]
gb|KCW88114.1| hypothetical protein EUGRSUZ_A00511 [Eucalyptus grandis]
gb|KDO43694.1| hypothetical protein CISIN_1g034139mg [Citrus sinensis]
gb|KDO46501.1| hypothetical protein CISIN_1g034144mg [Citrus sinensis]
gb|KDO72916.1| hypothetical protein CISIN_1g034133mg [Citrus sinensis]
gb|KDO73017.1| hypothetical protein CISIN_1g034148mg [Citrus sinensis]
gb|KDP25531.1| hypothetical protein JCGZ_20687 [Jatropha curcas]
gb|KDP25545.1| hypothetical protein JCGZ_20701 [Jatropha curcas]
gb|KDP36400.1| hypothetical protein JCGZ_08669 [Jatropha curcas]
gb|KDP44211.1| hypothetical protein JCGZ_05678 [Jatropha curcas]
gb|KEH22067.1| histone H4 domain protein [Medicago truncatula]
gb|KEH30080.1| histone H4 domain protein [Medicago truncatula]
gb|KEH33936.1| histone H4 domain protein [Medicago truncatula]
gb|KEH34158.1| histone H4 domain protein [Medicago truncatula]
gb|KEH34159.1| histone H4 domain protein [Medicago truncatula]
gb|KEH34165.1| histone H4 domain protein [Medicago truncatula]
gb|KEH34182.1| histone H4 domain protein [Medicago truncatula]
emb|CDP08969.1| unnamed protein product [Coffea canephora]
emb|CDP09020.1| unnamed protein product [Coffea canephora]
emb|CDP06635.1| unnamed protein product [Coffea canephora]
emb|CDP00010.1| unnamed protein product [Coffea canephora]
emb|CDP00068.1| unnamed protein product [Coffea canephora]
emb|CDM82261.1| unnamed protein product [Triticum aestivum]
emb|CDM84803.1| unnamed protein product [Triticum aestivum]
gb|KFK27507.1| hypothetical protein AALP_AA8G392100 [Arabis alpina]
gb|KFK27535.1| hypothetical protein AALP_AA8G395900 [Arabis alpina]
gb|KFK33956.1| histone h4 [Arabis alpina]
gb|KFK33958.1| hypothetical protein AALP_AA5G083900 [Arabis alpina]
gb|KFK34624.1| hypothetical protein AALP_AA5G170000 [Arabis alpina]
gb|KFK36645.1| hypothetical protein AALP_AA4G151600 [Arabis alpina]
gb|KFK43086.1| hypothetical protein AALP_AA1G077500 [Arabis alpina]
emb|CDY70247.1| BnaCnng67420D [Brassica napus]
emb|CDY60565.1| BnaA02g06910D [Brassica napus]
emb|CDY58832.1| BnaAnng15490D [Brassica napus]
emb|CDY56098.1| BnaC02g44320D [Brassica napus]
emb|CDY32809.1| BnaC08g02310D [Brassica napus]
emb|CDY31726.1| BnaA04g16620D [Brassica napus]
emb|CDY22719.1| BnaC08g43530D [Brassica napus]
emb|CDY18434.1| BnaA04g21530D [Brassica napus]
emb|CDY15777.1| BnaC04g15470D [Brassica napus]
emb|CDY07783.1| BnaA03g17280D [Brassica napus]
gb|KGN45824.1| Histone H4 [Cucumis sativus]
gb|KGN47169.1| Histone H4 [Cucumis sativus]
gb|KGN47170.1| hypothetical protein Csa_6G191580 [Cucumis sativus]
gb|KGN47171.1| hypothetical protein Csa_6G192080 [Cucumis sativus]
gb|KGN47172.1| Histone H4 [Cucumis sativus]
gb|KGN47173.1| Histone H4 [Cucumis sativus]
gb|KGN64733.1| hypothetical protein Csa_1G084320 [Cucumis sativus]
gb|AIZ04727.1| histone 4 [Elettaria cardamomum]
gb|AIZ04728.1| histone 4 [Nicotiana benthamiana]
gb|KHN05358.1| Histone H4 [Glycine soja]
gb|KHN05694.1| Histone H4 [Glycine soja]
gb|KHN06242.1| Histone H4 [Glycine soja]
gb|KHN09422.1| Histone H4 [Glycine soja]
gb|KHN12566.1| Histone H4 [Glycine soja]
gb|KHN12567.1| Histone H4 [Glycine soja]
gb|KHN12568.1| Histone H4 [Glycine soja]
gb|KHN22012.1| Histone H4 [Glycine soja]
gb|KHN33428.1| Histone H4 [Glycine soja]
gb|KHN40041.1| Histone H4 [Glycine soja]
gb|KHN41537.1| Histone H4 [Glycine soja]
gb|KHN48230.1| Histone H4 [Glycine soja]
dbj|BAQ19379.1| histone H4 [Sarracenia purpurea]
gb|KJB16932.1| hypothetical protein B456_002G255200 [Gossypium raimondii]
gb|KJB20200.1| hypothetical protein B456_003G138000 [Gossypium raimondii]
gb|KJB21608.1| hypothetical protein B456_004G002700 [Gossypium raimondii]
gb|KJB21611.1| hypothetical protein B456_004G003000 [Gossypium raimondii]
gb|KJB21620.1| hypothetical protein B456_004G004600 [Gossypium raimondii]
gb|KJB21641.1| hypothetical protein B456_004G005900 [Gossypium raimondii]
gb|KJB55990.1| hypothetical protein B456_009G102900 [Gossypium raimondii]
gb|KJB70009.1| hypothetical protein B456_011G053000 [Gossypium raimondii]
gb|KJB76718.1| hypothetical protein B456_012G102800 [Gossypium raimondii]
gb|KJB83811.1| hypothetical protein B456_013G265800 [Gossypium raimondii]
gb|KMS97567.1| hypothetical protein BVRB_5g125910 [Beta vulgaris subsp. vulgaris]
gb|KMS97568.1| hypothetical protein BVRB_5g125920 [Beta vulgaris subsp. vulgaris]
gb|KMS97569.1| hypothetical protein BVRB_5g125930 [Beta vulgaris subsp. vulgaris]
gb|KMS98764.1| hypothetical protein BVRB_3g068420 [Beta vulgaris subsp. vulgaris]
gb|KMT05290.1| hypothetical protein BVRB_7g174280 [Beta vulgaris subsp. vulgaris]
gb|KMT15427.1| hypothetical protein BVRB_3g061320 [Beta vulgaris subsp. vulgaris]
gb|KMT19540.1| hypothetical protein BVRB_1g011610 [Beta vulgaris subsp. vulgaris]
gb|KNA13214.1| hypothetical protein SOVF_118800 [Spinacia oleracea]
gb|KNA14759.1| hypothetical protein SOVF_104740 [Spinacia oleracea]
gb|KNA15746.1| hypothetical protein SOVF_095450 [Spinacia oleracea]
gb|KNA15747.1| hypothetical protein SOVF_095460 [Spinacia oleracea]
gb|KNA15748.1| hypothetical protein SOVF_095470 [Spinacia oleracea]
gb|KNA15766.1| hypothetical protein SOVF_095210 [Spinacia oleracea]
gb|KNA19789.1| hypothetical protein SOVF_058290 [Spinacia oleracea]
gb|KNA22027.1| hypothetical protein SOVF_037970 [Spinacia oleracea]
gb|KNA26079.1| hypothetical protein SOVF_000690 [Spinacia oleracea]
gb|KOM26701.1| hypothetical protein LR48_Vigan306s000300 [Vigna angularis]
gb|KOM29001.1| hypothetical protein LR48_Vigan627s005000 [Vigna angularis]
gb|KOM29891.1| hypothetical protein LR48_Vigan831s000900 [Vigna angularis]
gb|KOM44246.1| hypothetical protein LR48_Vigan05g185100 [Vigna angularis]
gb|KOM49405.1| hypothetical protein LR48_Vigan08g023200 [Vigna angularis]
gb|KOM49594.1| hypothetical protein LR48_Vigan08g042100 [Vigna angularis]
gb|KOM50760.1| hypothetical protein LR48_Vigan08g158700 [Vigna angularis]
gb|KOM52573.1| hypothetical protein LR48_Vigan09g123200 [Vigna angularis]
gb|KOM52574.1| hypothetical protein LR48_Vigan09g123300 [Vigna angularis]
dbj|BAS75107.1| Os01g0835900 [Oryza sativa Japonica Group]
dbj|BAS80323.1| Os02g0684500 [Oryza sativa Japonica Group]
dbj|BAS82016.1| Os03g0119900 [Oryza sativa Japonica Group]
dbj|BAS90673.1| Os04g0583600 [Oryza sativa Japonica Group]
dbj|BAS94424.1| Os05g0462700 [Oryza sativa Japonica Group]
dbj|BAS94452.1| Os05g0466600 [Oryza sativa Japonica Group]
dbj|BAT02038.1| Os07g0549900 [Oryza sativa Japonica Group]
dbj|BAT08228.1| Os09g0433600 [Oryza sativa Japonica Group]
dbj|BAT09322.1| Os09g0553100 [Oryza sativa Japonica Group]
dbj|BAT11849.1| Os10g0539500 [Oryza sativa Japonica Group]
gb|KQJ84202.1| hypothetical protein BRADI_5g19350v3 [Brachypodium distachyon]
gb|KQJ86516.1| hypothetical protein BRADI_4g06040v3 [Brachypodium distachyon]
gb|KQJ90348.1| hypothetical protein BRADI_4g30960v3 [Brachypodium distachyon]
gb|KQK05829.1| hypothetical protein BRADI_2g23004v3 [Brachypodium distachyon]
gb|KQK12788.1| hypothetical protein BRADI_1g68190v3 [Brachypodium distachyon]
gb|KQK92904.1| hypothetical protein SETIT_038166mg [Setaria italica]
gb|KQK98617.1| hypothetical protein SETIT_011423mg [Setaria italica]
gb|KQL01545.1| hypothetical protein SETIT_014712mg [Setaria italica]
gb|KQL07618.1| hypothetical protein SETIT_003454mg [Setaria italica]
gb|KQL15110.1| hypothetical protein SETIT_023745mg [Setaria italica]
gb|KQL24594.1| hypothetical protein SETIT_031602mg [Setaria italica]
gb|KQL30971.1| hypothetical protein SETIT_018796mg [Setaria italica]
gb|KRG88688.1| hypothetical protein GLYMA_U033600 [Glycine max]
gb|KRG90333.1| hypothetical protein GLYMA_20G083800 [Glycine max]
gb|KRG98308.1| hypothetical protein GLYMA_18G064300 [Glycine max]
gb|KRH02870.1| hypothetical protein GLYMA_17G063200 [Glycine max]
gb|KRH10344.1| hypothetical protein GLYMA_15G043200 [Glycine max]
gb|KRH10345.1| hypothetical protein GLYMA_15G043200 [Glycine max]
gb|KRH16996.1| hypothetical protein GLYMA_14G190800 [Glycine max]
gb|KRH19969.1| hypothetical protein GLYMA_13G147000 [Glycine max]
gb|KRH24981.1| hypothetical protein GLYMA_12G074500 [Glycine max]
gb|KRH30344.1| hypothetical protein GLYMA_11G177800 [Glycine max]
gb|KRH30345.1| hypothetical protein GLYMA_11G177900 [Glycine max]
gb|KRH30347.1| hypothetical protein GLYMA_11G178100 [Glycine max]
gb|KRH30348.1| hypothetical protein GLYMA_11G178200 [Glycine max]
gb|KRH33582.1| hypothetical protein GLYMA_10G133500 [Glycine max]
gb|KRH67535.1| hypothetical protein GLYMA_03G171400 [Glycine max]
gb|KRH72633.1| hypothetical protein GLYMA_02G224100 [Glycine max]
dbj|BAT88364.1| hypothetical protein VIGAN_05183800 [Vigna angularis var.
angularis]
dbj|BAT88365.1| hypothetical protein VIGAN_05183900 [Vigna angularis var.
angularis]
dbj|BAT89488.1| hypothetical protein VIGAN_06045200 [Vigna angularis var.
angularis]
dbj|BAT89583.1| hypothetical protein VIGAN_06057000 [Vigna angularis var.
angularis]
dbj|BAT90665.1| hypothetical protein VIGAN_06194200 [Vigna angularis var.
angularis]
dbj|BAT91914.1| hypothetical protein VIGAN_07055700 [Vigna angularis var.
angularis]
dbj|BAT74750.1| hypothetical protein VIGAN_01249700 [Vigna angularis var.
angularis]
dbj|BAT76735.1| hypothetical protein VIGAN_01478500 [Vigna angularis var.
angularis]
dbj|BAT85623.1| hypothetical protein VIGAN_04319000 [Vigna angularis var.
angularis]
emb|CUT18458.1| H4 [Lilium davidii var. unicolor]
gb|KVG36273.1| Histone core [Cynara cardunculus var. scolymus]
gb|KVG36274.1| hypothetical protein Ccrd_026469 [Cynara cardunculus var. scolymus]
gb|KVH88470.1| Histone core [Cynara cardunculus var. scolymus]
gb|KVI03176.1| hypothetical protein Ccrd_018530 [Cynara cardunculus var. scolymus]
gb|KVI03592.1| Histone core [Cynara cardunculus var. scolymus]
gb|KVI07817.1| Histone core [Cynara cardunculus var. scolymus]
gb|KVI11998.1| Histone core [Cynara cardunculus var. scolymus]
gb|KYP33406.1| Histone H4 [Cajanus cajan]
gb|KYP42925.1| Histone H4 [Cajanus cajan]
gb|KYP45343.1| Histone H4 [Cajanus cajan]
gb|KYP57463.1| Histone H4 [Cajanus cajan]
gb|KYP58596.1| Histone H4 [Cajanus cajan]
gb|KYP68442.1| Histone H4 [Cajanus cajan]
gb|KYP76122.1| Histone H4 [Cajanus cajan]
gb|KYP76125.1| Histone H4 [Cajanus cajan]
gb|KYP76127.1| Histone H4 [Cajanus cajan]
gb|KZM94638.1| hypothetical protein DCAR_017881 [Daucus carota subsp. sativus]
gb|KZM95623.1| hypothetical protein DCAR_018865 [Daucus carota subsp. sativus]
gb|KZM95654.1| hypothetical protein DCAR_018896 [Daucus carota subsp. sativus]
gb|KZM97937.1| hypothetical protein DCAR_014701 [Daucus carota subsp. sativus]
gb|KZN05148.1| hypothetical protein DCAR_005985 [Daucus carota subsp. sativus]
gb|KZN05153.1| hypothetical protein DCAR_005990 [Daucus carota subsp. sativus]
gb|KZN05156.1| hypothetical protein DCAR_005993 [Daucus carota subsp. sativus]
gb|KZN05158.1| hypothetical protein DCAR_005995 [Daucus carota subsp. sativus]
gb|KZV19615.1| hypothetical protein F511_10518 [Dorcoceras hygrometricum]
gb|KZV23426.1| hypothetical protein F511_43338 [Dorcoceras hygrometricum]
gb|KZV33126.1| hypothetical protein F511_03392 [Dorcoceras hygrometricum]
gb|KZV35045.1| hypothetical protein F511_04350 [Dorcoceras hygrometricum]
gb|KZV51788.1| hypothetical protein F511_11476 [Dorcoceras hygrometricum]
gb|OAO92471.1| hypothetical protein AXX17_AT5G59110 [Arabidopsis thaliana]
gb|OAO95258.1| hypothetical protein AXX17_AT5G59410 [Arabidopsis thaliana]
gb|OAP04740.1| hypothetical protein AXX17_AT3G40210 [Arabidopsis thaliana]
gb|OAP04980.1| hypothetical protein AXX17_AT3G48100 [Arabidopsis thaliana]
gb|OAP08079.1| hypothetical protein AXX17_AT2G24850 [Arabidopsis thaliana]
gb|OAP15907.1| hypothetical protein AXX17_AT1G07520 [Arabidopsis thaliana]
gb|OAP16019.1| hypothetical protein AXX17_AT1G07310 [Arabidopsis thaliana]
gb|OAY31148.1| hypothetical protein MANES_14G087900 [Manihot esculenta]
gb|OAY37892.1| hypothetical protein MANES_11G137100 [Manihot esculenta]
gb|OAY38731.1| hypothetical protein MANES_10G039100 [Manihot esculenta]
gb|OAY46073.1| hypothetical protein MANES_07G114600 [Manihot esculenta]
gb|OAY47472.1| hypothetical protein MANES_06G082200 [Manihot esculenta]
gb|OAY51739.1| hypothetical protein MANES_04G028700 [Manihot esculenta]
gb|OAY51785.1| hypothetical protein MANES_04G032600 [Manihot esculenta]
gb|OAY56602.1| hypothetical protein MANES_02G030600 [Manihot esculenta]
gb|OAY59902.1| hypothetical protein MANES_01G069400 [Manihot esculenta]
gb|OAY62981.1| Histone H4 [Ananas comosus]
gb|OAY66164.1| Histone H4 [Ananas comosus]
gb|OAY72693.1| Histone H4 [Ananas comosus]
gb|OAY79827.1| Histone H4 [Ananas comosus]
gb|OAY84103.1| Histone H4 [Ananas comosus]
gb|ANM70482.1| Histone superfamily protein [Arabidopsis thaliana]
gb|OEL16490.1| Histone H4 [Dichanthelium oligosanthes]
gb|OEL20720.1| Histone H4 [Dichanthelium oligosanthes]
gb|OEL23212.1| Histone H4 [Dichanthelium oligosanthes]
gb|OEL24175.1| Histone H4 [Dichanthelium oligosanthes]
gb|OEL32106.1| Histone H4 [Dichanthelium oligosanthes]
gb|OEL36021.1| Histone H4 [Dichanthelium oligosanthes]
gb|OIS95648.1| histone h4 [Nicotiana attenuata]
gb|OIS95649.1| histone h4 [Nicotiana attenuata]
gb|OIT22436.1| histone h4 [Nicotiana attenuata]
gb|OIT28377.1| histone h4 [Nicotiana attenuata]
gb|OIT29232.1| histone h4 [Nicotiana attenuata]
gb|OIT30437.1| histone h4 [Nicotiana attenuata]
gb|OIT33558.1| histone h4 [Nicotiana attenuata]
gb|OIT33559.1| histone h4 [Nicotiana attenuata]
gb|OIT34992.1| histone h4 [Nicotiana attenuata]
gb|OIT37424.1| histone h4 [Nicotiana attenuata]
gb|OIT40759.1| histone h4 [Nicotiana attenuata]
gb|OIV90495.1| hypothetical protein TanjilG_10259 [Lupinus angustifolius]
gb|OIV92124.1| hypothetical protein TanjilG_26982 [Lupinus angustifolius]
gb|OIV97187.1| hypothetical protein TanjilG_28938 [Lupinus angustifolius]
gb|OIV97188.1| hypothetical protein TanjilG_28939 [Lupinus angustifolius]
gb|OIV99794.1| hypothetical protein TanjilG_26132 [Lupinus angustifolius]
gb|OIW01639.1| hypothetical protein TanjilG_18210 [Lupinus angustifolius]
gb|OIW03951.1| hypothetical protein TanjilG_30227 [Lupinus angustifolius]
gb|OIW04349.1| hypothetical protein TanjilG_32541 [Lupinus angustifolius]
gb|OIW06108.1| hypothetical protein TanjilG_29864 [Lupinus angustifolius]
gb|OIW08598.1| hypothetical protein TanjilG_03274 [Lupinus angustifolius]
gb|OIW08600.1| hypothetical protein TanjilG_03276 [Lupinus angustifolius]
gb|OIW11232.1| hypothetical protein TanjilG_28323 [Lupinus angustifolius]
gb|OIW13234.1| hypothetical protein TanjilG_02368 [Lupinus angustifolius]
gb|OIW18679.1| hypothetical protein TanjilG_13431 [Lupinus angustifolius]
gb|APR64201.1| histone H4 family protein [Populus tomentosa]
dbj|GAV71402.1| Histone domain-containing protein [Cephalotus follicularis]
gb|OMO58938.1| Histone H4 [Corchorus capsularis]
gb|OMO66237.1| Histone H4 [Corchorus capsularis]
gb|OMO67623.1| Histone H4 [Corchorus capsularis]
gb|OMO67706.1| Histone H4 [Corchorus capsularis]
gb|OMO69468.1| Histone H4 [Corchorus capsularis]
gb|OMO69469.1| Histone H4 [Corchorus capsularis]
gb|OMO91301.1| Histone H4 [Corchorus olitorius]
gb|OMO91388.1| Histone H4 [Corchorus olitorius]
gb|OMO96940.1| Histone H4 [Corchorus olitorius]
gb|OMO97179.1| Histone H4 [Corchorus olitorius]
gb|OMP09108.1| Histone H4 [Corchorus olitorius]
gb|ONH94763.1| hypothetical protein PRUPE_7G028400 [Prunus persica]
gb|ONI00305.1| hypothetical protein PRUPE_6G081300 [Prunus persica]
gb|ONI03336.1| hypothetical protein PRUPE_6G251900 [Prunus persica]
gb|ONI07661.1| hypothetical protein PRUPE_5G134000 [Prunus persica]
gb|ONI24277.1| hypothetical protein PRUPE_2G232000 [Prunus persica]
gb|ONI24279.1| hypothetical protein PRUPE_2G232200 [Prunus persica]
gb|ONL93034.1| Histone H4 [Zea mays]
gb|AQK45299.1| Histone H4 [Zea mays]
gb|ONM14629.1| Histone H4 [Zea mays]
gb|ONM14650.1| Histone H4 [Zea mays]
gb|ONM22111.1| Histone H4 [Zea mays]
gb|ONM29854.1| Histone H4 [Zea mays]
gb|ONM36601.1| Histone H4 [Zea mays]
gb|AQK54299.1| Histone H4 [Zea mays]
gb|AQK90411.1| Histone H4 [Zea mays]
gb|AQK94391.1| Histone H4 [Zea mays]
gb|AQK99537.1| Histone H4 [Zea mays]
gb|ONM55158.1| Histone H4 [Zea mays]
gb|ONM55159.1| Histone H4 [Zea mays]
gb|ONM57249.1| Histone H4 [Zea mays]
gb|OQU85624.1| hypothetical protein SORBI_3004G279601 [Sorghum bicolor]
gb|OQU93370.1| hypothetical protein SORBI_3001G529400 [Sorghum bicolor]
gb|OTF86612.1| putative histone H31 [Helianthus annuus]
gb|OTF87480.1| putative histone H32 [Helianthus annuus]
gb|OTF96391.1| putative histone H22 [Helianthus annuus]
gb|OTF96395.1| putative histone H23 [Helianthus annuus]
gb|OTF96891.1| putative histone H17 [Helianthus annuus]
gb|OTF96955.1| putative histone H18 [Helianthus annuus]
gb|OTF98502.1| putative histone H20 [Helianthus annuus]
gb|OTG01755.1| putative histone H5 [Helianthus annuus]
gb|OTG05119.1| putative histone H13 [Helianthus annuus]
gb|OTG05124.1| putative histone H15 [Helianthus annuus]
gb|OTG05125.1| putative histone H16 [Helianthus annuus]
gb|OTG12348.1| putative histone H6 [Helianthus annuus]
gb|OTG14897.1| putative histone H29 [Helianthus annuus]
gb|OTG14898.1| putative histone H30 [Helianthus annuus]
gb|OTG18196.1| putative histone H10 [Helianthus annuus]
gb|OTG19503.1| putative histone H11 [Helianthus annuus]
gb|OTG22857.1| putative histone H7 [Helianthus annuus]
gb|OTG23468.1| putative histone H8 [Helianthus annuus]
gb|OTG25009.1| putative histone H24 [Helianthus annuus]
gb|OTG37175.1| putative histone H4 [Helianthus annuus]
gb|OVA04044.1| Histone H4 [Macleaya cordata]
gb|OVA04211.1| Histone H4 [Macleaya cordata]
gb|OVA10227.1| Histone H4 [Macleaya cordata]
gb|OVA14995.1| Histone H4 [Macleaya cordata]
gb|OVA18232.1| Histone H4 [Macleaya cordata]
gb|OWM64623.1| hypothetical protein CDL15_Pgr020590 [Punica granatum]
gb|OWM65777.1| hypothetical protein CDL15_Pgr015202 [Punica granatum]
gb|OWM68817.1| hypothetical protein CDL15_Pgr025004 [Punica granatum]
gb|PAN12563.1| hypothetical protein PAHAL_B02905 [Panicum hallii]
gb|PAN13752.1| hypothetical protein PAHAL_E01557 [Panicum hallii]
gb|PAN39755.1| hypothetical protein PAHAL_G02068 [Panicum hallii]
gb|PAN48732.1| hypothetical protein PAHAL_I04212 [Panicum hallii]
gb|PAN51910.1| hypothetical protein PAHAL_I00150 [Panicum hallii]
gb|PHT44726.1| Histone H4 [Capsicum baccatum]
gb|PHT44789.1| Histone H4 [Capsicum baccatum]
gb|PHT44792.1| Histone H4 [Capsicum baccatum]
gb|PHT78067.1| Histone H4 [Capsicum annuum]
gb|PHT78070.1| Histone H4 [Capsicum annuum]
gb|PHT78071.1| Histone H4 [Capsicum annuum]
gb|PHT78072.1| Histone H4 [Capsicum annuum]
gb|PHU13756.1| Histone H4 [Capsicum chinense]
gb|PHU13757.1| Histone H4 [Capsicum chinense]
gb|PHU13761.1| Histone H4 [Capsicum chinense]
gb|PIA26147.1| hypothetical protein AQUCO_09600005v1 [Aquilegia coerulea]
gb|PIA28655.1| hypothetical protein AQUCO_06800078v1 [Aquilegia coerulea]
gb|PIA28657.1| hypothetical protein AQUCO_06800080v1 [Aquilegia coerulea]
gb|PIA38742.1| hypothetical protein AQUCO_02700148v1 [Aquilegia coerulea]
gb|PIA38831.1| hypothetical protein AQUCO_02700197v1 [Aquilegia coerulea]
gb|PIA39246.1| hypothetical protein AQUCO_02700434v1 [Aquilegia coerulea]
gb|PIA42748.1| hypothetical protein AQUCO_02000300v1 [Aquilegia coerulea]
gb|PIA63919.1| hypothetical protein AQUCO_00201323v1 [Aquilegia coerulea]
gb|PIA63920.1| hypothetical protein AQUCO_00201324v1 [Aquilegia coerulea]
gb|PIA63988.1| hypothetical protein AQUCO_00201351v1 [Aquilegia coerulea]
gb|PIM97155.1| Histone H4 [Handroanthus impetiginosus]
gb|PIM98840.1| Histone H4 [Handroanthus impetiginosus]
gb|PIM99945.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN00504.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN06271.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN10864.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN11961.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN13110.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN17580.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN18071.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN19052.1| Histone H4 [Handroanthus impetiginosus]
gb|PIN19874.1| Histone H4 [Handroanthus impetiginosus]
gb|PKA48253.1| Histone H4 [Apostasia shenzhenica]
gb|PKA48393.1| Histone H4 [Apostasia shenzhenica]
gb|PKA49813.1| Histone H4 [Apostasia shenzhenica]
gb|PKA52161.1| Histone H4 [Apostasia shenzhenica]
gb|PKA53483.1| Histone H4 [Apostasia shenzhenica]
gb|PKA58174.1| Histone H4 [Apostasia shenzhenica]
gb|PKI34528.1| hypothetical protein CRG98_045065 [Punica granatum]
gb|PKI36416.1| hypothetical protein CRG98_043198 [Punica granatum]
gb|PKI61690.1| hypothetical protein CRG98_017914 [Punica granatum]
gb|PKI62362.1| hypothetical protein CRG98_017168 [Punica granatum]
gb|PKI64393.1| hypothetical protein CRG98_015253 [Punica granatum]
gb|PKI74648.1| hypothetical protein CRG98_004975 [Punica granatum]
gb|PKU72990.1| Histone H4 [Dendrobium catenatum]
gb|PKU73002.1| Histone H4 [Dendrobium catenatum]
gb|PKU74490.1| Histone H4 [Dendrobium catenatum]
gb|PKU76318.1| Histone H4 [Dendrobium catenatum]
gb|PKU79116.1| Histone H4 [Dendrobium catenatum]
gb|PKU81094.1| Histone H4 [Dendrobium catenatum]
gb|PKU81095.1| Histone H4 [Dendrobium catenatum]
dbj|GAY45148.1| hypothetical protein CUMW_087300 [Citrus unshiu]
dbj|GAY38141.1| hypothetical protein CUMW_034430 [Citrus unshiu]
dbj|GAY38203.1| hypothetical protein CUMW_034910 [Citrus unshiu]
dbj|GAY37149.1| hypothetical protein CUMW_026840 [Citrus unshiu]
gb|PLY62399.1| hypothetical protein LSAT_5X168841 [Lactuca sativa]
gb|PLY67433.1| hypothetical protein LSAT_6X50580 [Lactuca sativa]
gb|PLY70608.1| hypothetical protein LSAT_1X74341 [Lactuca sativa]
gb|PLY71166.1| hypothetical protein LSAT_9X65201 [Lactuca sativa]
gb|PLY75423.1| hypothetical protein LSAT_7X54561 [Lactuca sativa]
gb|PLY76435.1| hypothetical protein LSAT_5X89161 [Lactuca sativa]
gb|PLY76457.1| hypothetical protein LSAT_5X89201 [Lactuca sativa]
gb|PLY76468.1| hypothetical protein LSAT_5X89261 [Lactuca sativa]
gb|PLY76471.1| hypothetical protein LSAT_5X89181 [Lactuca sativa]
gb|PLY76480.1| hypothetical protein LSAT_5X89241 [Lactuca sativa]
gb|PLY79737.1| hypothetical protein LSAT_5X78861 [Lactuca sativa]
gb|PLY84313.1| hypothetical protein LSAT_5X84360 [Lactuca sativa]
gb|PLY87499.1| hypothetical protein LSAT_8X66800 [Lactuca sativa]
gb|PLY87538.1| hypothetical protein LSAT_8X67601 [Lactuca sativa]
gb|PLY87597.1| hypothetical protein LSAT_8X77961 [Lactuca sativa]
gb|PLY87604.1| hypothetical protein LSAT_8X78880 [Lactuca sativa]
gb|PLY90012.1| hypothetical protein LSAT_3X64581 [Lactuca sativa]
gb|PLY95214.1| hypothetical protein LSAT_1X129381 [Lactuca sativa]
gb|PLY95215.1| hypothetical protein LSAT_1X129421 [Lactuca sativa]
gb|PLY96060.1| hypothetical protein LSAT_8X16760 [Lactuca sativa]
gb|PLY96065.1| hypothetical protein LSAT_8X16740 [Lactuca sativa]
gb|PLY96227.1| hypothetical protein LSAT_1X129540 [Lactuca sativa]
gb|PLY96619.1| hypothetical protein LSAT_7X36021 [Lactuca sativa]
gb|PNR31124.1| hypothetical protein PHYPA_027441 [Physcomitrella patens]
gb|PNR38004.1| hypothetical protein PHYPA_021115 [Physcomitrella patens]
gb|PNR39097.1| hypothetical protein PHYPA_019375 [Physcomitrella patens]
gb|PNR41664.1| hypothetical protein PHYPA_019069 [Physcomitrella patens]
gb|PNR42180.1| hypothetical protein PHYPA_017009 [Physcomitrella patens]
gb|PNR51500.1| hypothetical protein PHYPA_010687 [Physcomitrella patens]
gb|PNR53198.1| hypothetical protein PHYPA_009573 [Physcomitrella patens]
gb|PNR53200.1| hypothetical protein PHYPA_009575 [Physcomitrella patens]
gb|PNR53202.1| hypothetical protein PHYPA_009577 [Physcomitrella patens]
gb|PNR53371.1| hypothetical protein PHYPA_007046 [Physcomitrella patens]
gb|PNR55696.1| hypothetical protein PHYPA_006593 [Physcomitrella patens]
gb|PNS93542.1| hypothetical protein POPTR_018G092900v3 [Populus trichocarpa]
gb|PNS93543.1| hypothetical protein POPTR_018G093000v3 [Populus trichocarpa]
gb|PNT17893.1| hypothetical protein POPTR_010G213900v3 [Populus trichocarpa]
gb|PNT17894.1| hypothetical protein POPTR_010G214000v3 [Populus trichocarpa]
gb|PNT22769.1| hypothetical protein POPTR_008G047500v3 [Populus trichocarpa]
gb|PNT26466.1| hypothetical protein POPTR_007G013300v3 [Populus trichocarpa]
gb|PNT26468.1| hypothetical protein POPTR_007G013500v3 [Populus trichocarpa]
gb|PNT32116.1| hypothetical protein POPTR_006G168100v3 [Populus trichocarpa]
gb|PNT36237.1| hypothetical protein POPTR_005G115300v3 [Populus trichocarpa]
gb|PNT69244.1| hypothetical protein BRADI_3g51930v3 [Brachypodium distachyon]
gb|PNX84124.1| histone H4-like protein [Trifolium pratense]
gb|PNX85978.1| histone H4-like protein [Trifolium pratense]
gb|PNY06306.1| histone H4-like protein [Trifolium pratense]
gb|PNY11860.1| histone H4-like protein [Trifolium pratense]
gb|POE45784.1| histone h4 variant [Quercus suber]
gb|POE45785.1| histone h4 variant [Quercus suber]
gb|POE70796.1| histone h4 variant [Quercus suber]
gb|POE81481.1| histone h4 variant [Quercus suber]
gb|POF08999.1| histone h4 variant [Quercus suber]
gb|POF09000.1| histone h4 variant [Quercus suber]
gb|POF09004.1| histone h4 variant [Quercus suber]
gb|PON37756.1| Histone H [Parasponia andersonii]
gb|PON51449.1| Histone H [Trema orientalis]
gb|PON56580.1| Histone H [Parasponia andersonii]
gb|PON58974.1| Histone H [Parasponia andersonii]
gb|PON61121.1| Histone H [Trema orientalis]
gb|PON75364.1| Histone H [Parasponia andersonii]
gb|PON75954.1| Histone H [Parasponia andersonii]
gb|PON82782.1| Histone H [Trema orientalis]
gb|PON91511.1| Histone H [Trema orientalis]
gb|PON97903.1| Histone H [Trema orientalis]
gb|PON97910.1| Histone H [Trema orientalis]
gb|PPD92099.1| hypothetical protein GOBAR_DD10926 [Gossypium barbadense]
gb|PPD92113.1| hypothetical protein GOBAR_DD10940 [Gossypium barbadense]
gb|PPD92131.1| hypothetical protein GOBAR_DD10958 [Gossypium barbadense]
gb|PPD99671.1| hypothetical protein GOBAR_DD03311 [Gossypium barbadense]
gb|PPE00098.1| hypothetical protein GOBAR_DD02888 [Gossypium barbadense]
gb|PPR82264.1| hypothetical protein GOBAR_AA38450 [Gossypium barbadense]
gb|PPR83252.1| hypothetical protein GOBAR_AA37460 [Gossypium barbadense]
gb|PPR92585.1| hypothetical protein GOBAR_AA28088 [Gossypium barbadense]
gb|PPR96437.1| hypothetical protein GOBAR_AA24232 [Gossypium barbadense]
gb|PPR97574.1| hypothetical protein GOBAR_AA23077 [Gossypium barbadense]
gb|PPR97591.1| hypothetical protein GOBAR_AA23094 [Gossypium barbadense]
gb|PPS07672.1| hypothetical protein GOBAR_AA12990 [Gossypium barbadense]
gb|PPS07801.1| hypothetical protein GOBAR_AA12849 [Gossypium barbadense]
gb|PPS18430.1| hypothetical protein GOBAR_AA02134 [Gossypium barbadense]
gb|PRQ16758.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ33852.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ33936.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ33939.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ33980.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ43303.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
gb|PRQ58966.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis]
prf||1314298A histone H4
Length = 103
Score = 178 bits (451), Expect = 4e-55
Identities = 90/90 (100%), Positives = 90/90 (100%)
Frame = -2
Query: 488 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 309
GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD
Sbjct: 10 GLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD 69
Query: 308 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 219
AVTYTEHARRKTVTAMDVVYALKRQGRTLY
Sbjct: 70 AVTYTEHARRKTVTAMDVVYALKRQGRTLY 99