BLASTX nr result
ID: Acanthopanax23_contig00003180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00003180 (593 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN03639.1| hypothetical protein DCAR_012395 [Daucus carota s... 64 2e-08 >gb|KZN03639.1| hypothetical protein DCAR_012395 [Daucus carota subsp. sativus] Length = 995 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/43 (67%), Positives = 30/43 (69%) Frame = -1 Query: 131 LSFLIMVTPTWKWHQGSWITVKRNMWILKWVVCGTFADLLQDP 3 L FL T TW WHQG WI+VKRN WIL WVV GTFAD Q P Sbjct: 914 LVFLYNETHTWNWHQGYWISVKRNNWILNWVVFGTFADHGQGP 956