BLASTX nr result
ID: Acanthopanax23_contig00002470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00002470 (496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236726.1| PREDICTED: probable phospholipid hydroperoxi... 145 2e-41 ref|XP_017234992.1| PREDICTED: probable phospholipid hydroperoxi... 146 7e-41 gb|PON62856.1| Glutathione peroxidase [Parasponia andersonii] 143 1e-40 ref|XP_006368752.1| hypothetical protein POPTR_0001s09270g [Popu... 142 3e-40 gb|AGY31282.1| glutathione peroxidase 2 [Panax ginseng] 145 3e-40 gb|APZ73851.1| glutathione peroxidase [Populus euphratica] >gi|1... 142 3e-40 gb|AKJ66815.1| glutathione peroxidase [Populus euphratica] 142 4e-40 ref|XP_002299536.1| glutathione peroxidase family protein [Popul... 142 4e-40 gb|PNT53810.1| hypothetical protein POPTR_001G105200v3 [Populus ... 141 8e-40 ref|XP_021615131.1| probable phospholipid hydroperoxide glutathi... 141 8e-40 ref|XP_009386053.1| PREDICTED: probable phospholipid hydroperoxi... 141 8e-40 emb|CBI34679.3| unnamed protein product, partial [Vitis vinifera] 141 8e-40 ref|NP_001280872.1| probable phospholipid hydroperoxide glutathi... 141 8e-40 dbj|BAS90433.1| Os04g0556300, partial [Oryza sativa Japonica Group] 139 9e-40 gb|PON84601.1| Glutathione peroxidase [Trema orientalis] 141 1e-39 gb|PNT53809.1| hypothetical protein POPTR_001G105200v3 [Populus ... 141 1e-39 ref|XP_009346754.1| PREDICTED: probable phospholipid hydroperoxi... 141 1e-39 gb|EEF51177.1| glutathione peroxidase, putative [Ricinus communis] 141 1e-39 ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxi... 140 2e-39 ref|NP_001304349.1| probable phospholipid hydroperoxide glutathi... 142 2e-39 >ref|XP_017236726.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Daucus carota subsp. sativus] gb|KZN05908.1| hypothetical protein DCAR_006745 [Daucus carota subsp. sativus] Length = 169 Score = 145 bits (367), Expect = 2e-41 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNGSNAAP+YKYLKSSKGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 97 EYPIFDKVDVNGSNAAPVYKYLKSSKGGLFGDGIKWNFSKFLVDKDGKVVDRYAPTTSPL 156 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 157 SIEKDVKKLLGIA 169 >ref|XP_017234992.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Daucus carota subsp. sativus] Length = 240 Score = 146 bits (369), Expect = 7e-41 Identities = 69/73 (94%), Positives = 72/73 (98%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNGSNAAP+YKYLKSSKGGLFGD IKWNFAKFLVDKDGKVVDRYAPTTSPL Sbjct: 168 EYPIFDKVDVNGSNAAPVYKYLKSSKGGLFGDGIKWNFAKFLVDKDGKVVDRYAPTTSPL 227 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLG+A Sbjct: 228 SIEKDVKKLLGVA 240 >gb|PON62856.1| Glutathione peroxidase [Parasponia andersonii] Length = 168 Score = 143 bits (361), Expect = 1e-40 Identities = 67/73 (91%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG NAAP+YKYLKSSKGGLFGD IKWNF+KFLVDK+GKVVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGDNAAPIYKYLKSSKGGLFGDSIKWNFSKFLVDKEGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >ref|XP_006368752.1| hypothetical protein POPTR_0001s09270g [Populus trichocarpa] Length = 155 Score = 142 bits (358), Expect = 3e-40 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 +YPIFDKVDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 83 DYPIFDKVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPL 142 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 143 SIEKDVKKLLGIA 155 >gb|AGY31282.1| glutathione peroxidase 2 [Panax ginseng] Length = 240 Score = 145 bits (365), Expect = 3e-40 Identities = 68/73 (93%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNGSNAAP+YKYLKSSKGGLFGD IKWNFAKFLVDKDG VVDRYAPTTSPL Sbjct: 168 EYPIFDKVDVNGSNAAPVYKYLKSSKGGLFGDSIKWNFAKFLVDKDGNVVDRYAPTTSPL 227 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLG+A Sbjct: 228 SIEKDVKKLLGVA 240 >gb|APZ73851.1| glutathione peroxidase [Populus euphratica] gb|APZ73852.1| glutathione peroxidase [Populus euphratica] gb|APZ73853.1| glutathione peroxidase [Populus euphratica] gb|APZ73854.1| glutathione peroxidase [Populus euphratica] gb|APZ73855.1| glutathione peroxidase [Populus euphratica] gb|APZ73856.1| glutathione peroxidase [Populus euphratica] gb|APZ73857.1| glutathione peroxidase [Populus euphratica] gb|APZ73858.1| glutathione peroxidase [Populus euphratica] gb|APZ73859.1| glutathione peroxidase [Populus euphratica] gb|APZ73860.1| glutathione peroxidase [Populus euphratica] gb|APZ73861.1| glutathione peroxidase [Populus euphratica] gb|APZ73862.1| glutathione peroxidase [Populus euphratica] gb|APZ73863.1| glutathione peroxidase [Populus euphratica] gb|APZ73864.1| glutathione peroxidase [Populus euphratica] gb|APZ73865.1| glutathione peroxidase [Populus euphratica] gb|APZ73866.1| glutathione peroxidase [Populus euphratica] gb|APZ73867.1| glutathione peroxidase [Populus euphratica] gb|APZ73868.1| glutathione peroxidase [Populus euphratica] gb|APZ73869.1| glutathione peroxidase [Populus euphratica] gb|APZ73870.1| glutathione peroxidase [Populus euphratica] gb|APZ73871.1| glutathione peroxidase [Populus euphratica] gb|APZ73872.1| glutathione peroxidase [Populus euphratica] gb|APZ73873.1| glutathione peroxidase [Populus euphratica] gb|APZ73874.1| glutathione peroxidase [Populus euphratica] gb|APZ73875.1| glutathione peroxidase [Populus euphratica] gb|APZ73876.1| glutathione peroxidase [Populus euphratica] gb|APZ73877.1| glutathione peroxidase [Populus euphratica] gb|APZ73878.1| glutathione peroxidase [Populus euphratica] gb|APZ73879.1| glutathione peroxidase [Populus euphratica] gb|APZ73880.1| glutathione peroxidase [Populus euphratica] gb|APZ73881.1| glutathione peroxidase [Populus euphratica] gb|APZ73882.1| glutathione peroxidase [Populus euphratica] gb|APZ73883.1| glutathione peroxidase [Populus euphratica] gb|APZ73884.1| glutathione peroxidase [Populus euphratica] gb|APZ73885.1| glutathione peroxidase [Populus euphratica] gb|APZ73886.1| glutathione peroxidase [Populus euphratica] gb|APZ73887.1| glutathione peroxidase [Populus euphratica] gb|APZ73888.1| glutathione peroxidase [Populus euphratica] gb|APZ73889.1| glutathione peroxidase [Populus euphratica] gb|APZ73890.1| glutathione peroxidase [Populus euphratica] gb|APZ73891.1| glutathione peroxidase [Populus euphratica] gb|APZ73892.1| glutathione peroxidase [Populus euphratica] gb|APZ73893.1| glutathione peroxidase [Populus euphratica] gb|APZ73894.1| glutathione peroxidase [Populus euphratica] gb|APZ73895.1| glutathione peroxidase [Populus euphratica] gb|APZ73896.1| glutathione peroxidase [Populus euphratica] gb|APZ73897.1| glutathione peroxidase [Populus euphratica] gb|APZ73898.1| glutathione peroxidase [Populus euphratica] gb|APZ73899.1| glutathione peroxidase [Populus euphratica] gb|APZ73900.1| glutathione peroxidase [Populus euphratica] gb|APZ73901.1| glutathione peroxidase [Populus euphratica] gb|APZ73902.1| glutathione peroxidase [Populus euphratica] gb|APZ73903.1| glutathione peroxidase [Populus euphratica] gb|APZ73904.1| glutathione peroxidase [Populus euphratica] gb|APZ73905.1| glutathione peroxidase [Populus euphratica] gb|APZ73906.1| glutathione peroxidase [Populus euphratica] gb|APZ73907.1| glutathione peroxidase [Populus euphratica] gb|APZ73908.1| glutathione peroxidase [Populus euphratica] gb|APZ73909.1| glutathione peroxidase [Populus euphratica] gb|APZ73910.1| glutathione peroxidase [Populus euphratica] gb|APZ73911.1| glutathione peroxidase [Populus euphratica] gb|APZ73912.1| glutathione peroxidase [Populus euphratica] gb|APZ73913.1| glutathione peroxidase [Populus euphratica] gb|APZ73914.1| glutathione peroxidase [Populus euphratica] gb|APZ73915.1| glutathione peroxidase [Populus euphratica] gb|APZ73916.1| glutathione peroxidase [Populus euphratica] gb|APZ73917.1| glutathione peroxidase [Populus euphratica] gb|APZ73918.1| glutathione peroxidase [Populus euphratica] gb|APZ73919.1| glutathione peroxidase [Populus euphratica] gb|APZ73920.1| glutathione peroxidase [Populus euphratica] gb|APZ73921.1| glutathione peroxidase [Populus euphratica] gb|APZ73922.1| glutathione peroxidase [Populus euphratica] gb|APZ73923.1| glutathione peroxidase [Populus euphratica] gb|APZ73924.1| glutathione peroxidase [Populus euphratica] gb|APZ73925.1| glutathione peroxidase [Populus euphratica] gb|APZ73926.1| glutathione peroxidase [Populus euphratica] gb|APZ73927.1| glutathione peroxidase [Populus euphratica] gb|APZ73928.1| glutathione peroxidase [Populus euphratica] gb|APZ73929.1| glutathione peroxidase [Populus euphratica] gb|APZ73930.1| glutathione peroxidase [Populus euphratica] gb|APZ73931.1| glutathione peroxidase [Populus euphratica] gb|APZ73932.1| glutathione peroxidase [Populus euphratica] gb|APZ73933.1| glutathione peroxidase [Populus euphratica] gb|APZ73934.1| glutathione peroxidase [Populus euphratica] gb|APZ73935.1| glutathione peroxidase [Populus euphratica] gb|APZ73936.1| glutathione peroxidase [Populus euphratica] gb|APZ73937.1| glutathione peroxidase [Populus euphratica] gb|APZ73938.1| glutathione peroxidase [Populus euphratica] gb|APZ73939.1| glutathione peroxidase [Populus euphratica] gb|APZ73940.1| glutathione peroxidase [Populus euphratica] Length = 168 Score = 142 bits (359), Expect = 3e-40 Identities = 66/73 (90%), Positives = 73/73 (100%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKV+VNG+NAAP+YKYLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 96 EYPIFDKVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEK++KKLLGIA Sbjct: 156 SIEKEVKKLLGIA 168 >gb|AKJ66815.1| glutathione peroxidase [Populus euphratica] Length = 168 Score = 142 bits (358), Expect = 4e-40 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 +YPIFDKVDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 96 DYPIFDKVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >ref|XP_002299536.1| glutathione peroxidase family protein [Populus trichocarpa] gb|ABK96047.1| unknown [Populus trichocarpa] Length = 168 Score = 142 bits (358), Expect = 4e-40 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 +YPIFDKVDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 96 DYPIFDKVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >gb|PNT53810.1| hypothetical protein POPTR_001G105200v3 [Populus trichocarpa] Length = 155 Score = 141 bits (355), Expect = 8e-40 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 +YPIFDKVDVNG NAAP+YK+LKS+KGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 83 DYPIFDKVDVNGKNAAPIYKFLKSNKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPL 142 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 143 SIEKDVKKLLGIA 155 >ref|XP_021615131.1| probable phospholipid hydroperoxide glutathione peroxidase [Manihot esculenta] ref|XP_021615137.1| probable phospholipid hydroperoxide glutathione peroxidase [Manihot esculenta] gb|OAY59821.1| hypothetical protein MANES_01G062400 [Manihot esculenta] Length = 168 Score = 141 bits (356), Expect = 8e-40 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDK+DVNG+NAAPLYK+LKSSKGG+FGD IKWNF+KFLVDKDG VVDRYAPTTSPL Sbjct: 96 EYPIFDKIDVNGNNAAPLYKFLKSSKGGIFGDSIKWNFSKFLVDKDGNVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >ref|XP_009386053.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Musa acuminata subsp. malaccensis] Length = 168 Score = 141 bits (356), Expect = 8e-40 Identities = 67/73 (91%), Positives = 70/73 (95%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNGSNAAPLYK+LKSSKGGLFGD IKWNF KFLVDKDG V+DRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGSNAAPLYKFLKSSKGGLFGDGIKWNFTKFLVDKDGHVIDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKDIKK+LGIA Sbjct: 156 SIEKDIKKVLGIA 168 >emb|CBI34679.3| unnamed protein product, partial [Vitis vinifera] Length = 168 Score = 141 bits (356), Expect = 8e-40 Identities = 66/73 (90%), Positives = 72/73 (98%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDK+DVNG +AAPLYK+LKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 96 EYPIFDKIDVNGDSAAPLYKFLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKDIKKLLGI+ Sbjct: 156 SIEKDIKKLLGIS 168 >ref|NP_001280872.1| probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Malus domestica] gb|AAQ03092.1| glutathione peroxidase [Malus domestica] Length = 168 Score = 141 bits (356), Expect = 8e-40 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDK+GKVVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGDNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLG+A Sbjct: 156 SIEKDVKKLLGVA 168 >dbj|BAS90433.1| Os04g0556300, partial [Oryza sativa Japonica Group] Length = 114 Score = 139 bits (351), Expect = 9e-40 Identities = 65/71 (91%), Positives = 70/71 (98%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG+NAAPLYKYLKS+KGGLFGD IKWNF+KFLVDK+G+VVDRYAPTTSPL Sbjct: 42 EYPIFDKVDVNGNNAAPLYKYLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPL 101 Query: 181 SIEKDIKKLLG 213 SIEKDIKKLLG Sbjct: 102 SIEKDIKKLLG 112 >gb|PON84601.1| Glutathione peroxidase [Trema orientalis] Length = 168 Score = 141 bits (355), Expect = 1e-39 Identities = 66/73 (90%), Positives = 70/73 (95%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG NAAP+YKYLKSSKG LFGD IKWNF+KFLVDK+GKVVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGDNAAPIYKYLKSSKGSLFGDSIKWNFSKFLVDKEGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >gb|PNT53809.1| hypothetical protein POPTR_001G105200v3 [Populus trichocarpa] Length = 168 Score = 141 bits (355), Expect = 1e-39 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 +YPIFDKVDVNG NAAP+YK+LKS+KGGLFGD IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 96 DYPIFDKVDVNGKNAAPIYKFLKSNKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLGIA Sbjct: 156 SIEKDVKKLLGIA 168 >ref|XP_009346754.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial [Pyrus x bretschneideri] Length = 168 Score = 141 bits (355), Expect = 1e-39 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG AAP+YKYLKSSKGGLFGD+IKWNF+KFLVDK+GKVVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGEKAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLG+A Sbjct: 156 SIEKDVKKLLGVA 168 >gb|EEF51177.1| glutathione peroxidase, putative [Ricinus communis] Length = 168 Score = 141 bits (355), Expect = 1e-39 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNG+NAAP+YK+LKSSKGGLFGD IKWNF+KFLVDKDG VVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGNNAAPIYKFLKSSKGGLFGDGIKWNFSKFLVDKDGNVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLGIA 219 SIEKD+KKLLG+A Sbjct: 156 SIEKDVKKLLGVA 168 >ref|XP_006652625.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Oryza brachyantha] Length = 168 Score = 140 bits (354), Expect = 2e-39 Identities = 66/71 (92%), Positives = 70/71 (98%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKVDVNGSNAAPLYKYLKS+KGGLFGD IKWNF+KFLVDK+G+VVDRYAPTTSPL Sbjct: 96 EYPIFDKVDVNGSNAAPLYKYLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPL 155 Query: 181 SIEKDIKKLLG 213 SIEKDIKKLLG Sbjct: 156 SIEKDIKKLLG 166 >ref|NP_001304349.1| probable phospholipid hydroperoxide glutathione peroxidase [Populus euphratica] gb|AKJ66816.1| glutathione peroxidase [Populus euphratica] Length = 238 Score = 142 bits (359), Expect = 2e-39 Identities = 66/73 (90%), Positives = 73/73 (100%) Frame = +1 Query: 1 EYPIFDKVDVNGSNAAPLYKYLKSSKGGLFGDDIKWNFAKFLVDKDGKVVDRYAPTTSPL 180 EYPIFDKV+VNG+NAAP+YKYLKSSKGGLFGD+IKWNF+KFLVDKDGKVVDRYAPTTSPL Sbjct: 166 EYPIFDKVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPL 225 Query: 181 SIEKDIKKLLGIA 219 SIEK++KKLLGIA Sbjct: 226 SIEKEVKKLLGIA 238