BLASTX nr result
ID: Acanthopanax23_contig00001225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00001225 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO46128.1| hypothetical protein CISIN_1g0198172mg, partial [... 80 3e-17 emb|CBI25247.3| unnamed protein product, partial [Vitis vinifera] 85 2e-16 ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis ... 85 2e-16 emb|CDO98260.1| unnamed protein product [Coffea canephora] 84 2e-16 gb|PON68282.1| UV excision repair protein Rad [Trema orientalis] 79 3e-16 gb|PON52756.1| UV excision repair protein Rad [Parasponia anders... 79 3e-16 ref|XP_008381164.1| PREDICTED: ubiquitin receptor RAD23b-like is... 83 4e-16 ref|XP_018504898.1| PREDICTED: ubiquitin receptor RAD23b-like is... 83 6e-16 gb|OUZ99583.1| Ubiquitin-associated domain/translation elongatio... 83 6e-16 ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like is... 83 6e-16 ref|XP_008381163.1| PREDICTED: ubiquitin receptor RAD23b-like is... 83 6e-16 ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [N... 83 6e-16 ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like is... 83 7e-16 ref|XP_011082656.1| ubiquitin receptor RAD23b isoform X1 [Sesamu... 82 1e-15 ref|XP_006845449.1| ubiquitin receptor RAD23b [Amborella trichop... 82 1e-15 ref|XP_022885676.1| ubiquitin receptor RAD23b-like [Olea europae... 82 1e-15 ref|XP_021650549.1| ubiquitin receptor RAD23b-like isoform X2 [H... 82 1e-15 ref|XP_018625666.1| PREDICTED: ubiquitin receptor RAD23b-like is... 81 2e-15 ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like is... 81 2e-15 ref|XP_021653263.1| ubiquitin receptor RAD23b-like isoform X5 [H... 82 2e-15 >gb|KDO46128.1| hypothetical protein CISIN_1g0198172mg, partial [Citrus sinensis] Length = 75 Score = 80.5 bits (197), Expect = 3e-17 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 I+RLEAMGFDRALVIEAFLACDRNEELA NYLLENAGD+ED Sbjct: 35 IQRLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 75 >emb|CBI25247.3| unnamed protein product, partial [Vitis vinifera] Length = 399 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED Sbjct: 359 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 399 >ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera] Length = 411 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED Sbjct: 371 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 411 >emb|CDO98260.1| unnamed protein product [Coffea canephora] Length = 370 Score = 84.3 bits (207), Expect = 2e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA+NYLLENAGDYED Sbjct: 330 IERLEAMGFDRALVIEAFLACDRNEELAINYLLENAGDYED 370 >gb|PON68282.1| UV excision repair protein Rad [Trema orientalis] Length = 100 Score = 79.0 bits (193), Expect = 3e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGF+RALVIEAFLACDRNE+LA NYLLENAGD+ED Sbjct: 60 IERLEAMGFERALVIEAFLACDRNEQLAANYLLENAGDFED 100 >gb|PON52756.1| UV excision repair protein Rad [Parasponia andersonii] Length = 100 Score = 79.0 bits (193), Expect = 3e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGF+RALVIEAFLACDRNE+LA NYLLENAGD+ED Sbjct: 60 IERLEAMGFERALVIEAFLACDRNEQLAANYLLENAGDFED 100 >ref|XP_008381164.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Malus domestica] Length = 315 Score = 83.2 bits (204), Expect = 4e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGDYED Sbjct: 275 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 315 >ref|XP_018504898.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Pyrus x bretschneideri] Length = 371 Score = 83.2 bits (204), Expect = 6e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGDYED Sbjct: 331 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 371 >gb|OUZ99583.1| Ubiquitin-associated domain/translation elongation factor EF-Ts [Macleaya cordata] Length = 373 Score = 83.2 bits (204), Expect = 6e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGDYED Sbjct: 333 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 373 >ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Pyrus x bretschneideri] Length = 374 Score = 83.2 bits (204), Expect = 6e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGDYED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 374 >ref|XP_008381163.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Malus domestica] Length = 374 Score = 83.2 bits (204), Expect = 6e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGDYED Sbjct: 334 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED 374 >ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera] Length = 378 Score = 83.2 bits (204), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGD+ED Sbjct: 338 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED 378 >ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo nucifera] ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo nucifera] Length = 387 Score = 83.2 bits (204), Expect = 7e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGD+ED Sbjct: 347 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED 387 >ref|XP_011082656.1| ubiquitin receptor RAD23b isoform X1 [Sesamum indicum] Length = 361 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IER+EAMGFDRALVIEAFLACDRNEELAVNYLLENAGD+ED Sbjct: 321 IERMEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED 361 >ref|XP_006845449.1| ubiquitin receptor RAD23b [Amborella trichopoda] gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda] Length = 370 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA+NYLLEN GDYED Sbjct: 330 IERLEAMGFDRALVIEAFLACDRNEELAINYLLENPGDYED 370 >ref|XP_022885676.1| ubiquitin receptor RAD23b-like [Olea europaea var. sylvestris] Length = 390 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IER+EAMGFDRALVIEAFLACDRNEELAVNYLLENAGD+ED Sbjct: 350 IERMEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED 390 >ref|XP_021650549.1| ubiquitin receptor RAD23b-like isoform X2 [Hevea brasiliensis] Length = 319 Score = 81.6 bits (200), Expect = 1e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGD+ED Sbjct: 279 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 319 >ref|XP_018625666.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana tomentosiformis] ref|XP_018625667.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana tomentosiformis] Length = 295 Score = 81.3 bits (199), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLE+AGDYED Sbjct: 255 IERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED 295 >ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana sylvestris] ref|XP_016434770.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana tabacum] Length = 296 Score = 81.3 bits (199), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLE+AGDYED Sbjct: 256 IERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED 296 >ref|XP_021653263.1| ubiquitin receptor RAD23b-like isoform X5 [Hevea brasiliensis] Length = 328 Score = 81.6 bits (200), Expect = 2e-15 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +1 Query: 1 IERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED 123 IERLEAMGFDRALVIEAFLACDRNEELA NYLLENAGD+ED Sbjct: 288 IERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED 328