BLASTX nr result
ID: Acanthopanax23_contig00001077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00001077 (690 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017225616.1| PREDICTED: F-box/FBD/LRR-repeat protein At2g... 57 5e-06 >ref|XP_017225616.1| PREDICTED: F-box/FBD/LRR-repeat protein At2g26030-like [Daucus carota subsp. sativus] Length = 382 Score = 57.4 bits (137), Expect = 5e-06 Identities = 34/68 (50%), Positives = 41/68 (60%) Frame = -3 Query: 682 LTLSFSTIQVISSDPDFSEYPPSPFGNLKCLKLDKLQFDRFHHGNLPTKSLNHVINYLLS 503 L LS TIQ + PD SEY PSP NLK L L L +P++S ++VINYLLS Sbjct: 302 LKLSSETIQFLRRVPDLSEYQPSPLCNLKFLYLQGLD-------EIPSRSTDYVINYLLS 354 Query: 502 SSPGAAIL 479 +SP A IL Sbjct: 355 NSPHAEIL 362