BLASTX nr result
ID: Acanthopanax23_contig00000968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax23_contig00000968 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017244741.1| PREDICTED: classical arabinogalactan protein... 57 3e-07 ref|XP_023762319.1| classical arabinogalactan protein 4-like [La... 54 2e-06 >ref|XP_017244741.1| PREDICTED: classical arabinogalactan protein 10-like [Daucus carota subsp. sativus] gb|KZM98442.1| hypothetical protein DCAR_014196 [Daucus carota subsp. sativus] Length = 135 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 326 PSGSFADGWVNRAVIAGTAITGTCLAIALM 237 PSGSFADGWV+RAVIAGTA+T TCL++ALM Sbjct: 106 PSGSFADGWVHRAVIAGTAVTATCLSMALM 135 >ref|XP_023762319.1| classical arabinogalactan protein 4-like [Lactuca sativa] Length = 126 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 329 VPSGSFADGWVNRAVIAGTAITGTCLAIALM 237 +PSGSFADGWVNRAVIAGTA+ G+ LA+ LM Sbjct: 96 LPSGSFADGWVNRAVIAGTAVAGSFLAVTLM 126