BLASTX nr result
ID: Acanthopanax22_contig00000215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax22_contig00000215 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus... 211 2e-68 sp|Q68RU5.1|YCF15_PANGI PUTATIVE PSEUDOGENE: RecName: Full=Putat... 210 8e-68 ref|YP_009122770.1| ycf15 protein (chloroplast) [Dendropanax den... 206 2e-66 ref|YP_008814901.1| hypothetical chloroplast RF15 (chloroplast) ... 169 9e-52 gb|EPS74523.1| hypothetical protein M569_00240, partial [Genlise... 137 5e-39 gb|AHW52227.1| hypothetical chloroplast RF15 (chloroplast) [Rhaz... 132 1e-37 ref|YP_009461077.1| putative chloroplast RF15 (plastid) [Lamium ... 132 2e-37 ref|YP_009255651.1| ycf15 protein (chloroplast) [Cornus controve... 132 2e-37 ref|YP_009253293.1| Ycf15 (chloroplast) [Bruinsmia polysperma] >... 132 3e-37 gb|AMQ33540.1| hypothetical chloroplast RF15, partial (chloropla... 131 7e-37 gb|ANQ46307.1| ycf15 (chloroplast) [Pogostemon cablin] 131 7e-37 ref|YP_009166730.1| hypothetical chloroplast RF15 (chloroplast) ... 131 7e-37 ref|YP_004935711.1| ycf15 protein (chloroplast) [Sesamum indicum... 131 7e-37 ref|YP_009411944.1| Ycf15 (plastid) [Schima multibracteata] >gi|... 131 7e-37 ref|YP_009364438.1| hypothetical chloroplast RF15 (chloroplast) ... 130 1e-36 ref|YP_009128115.1| conserved hypothetical protein ycf15 (chloro... 130 1e-36 gb|ADZ36326.1| hypothetical protein RF15 (chloroplast) [Camellia... 130 1e-36 ref|YP_009123675.1| hypothetical chloroplast RF15 (chloroplast) ... 130 1e-36 ref|YP_009420939.1| ycf15 (chloroplast) [Caryopteris mongholica]... 130 1e-36 ref|YP_009240856.1| ycf15 protein (chloroplast) [Diplopanax stac... 130 2e-36 >ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] ref|YP_004935614.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] ref|YP_008814988.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] ref|YP_008815005.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] ref|YP_008815075.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] ref|YP_008815092.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] ref|YP_008815162.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] ref|YP_008815179.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] ref|YP_008815249.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] ref|YP_008815266.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] ref|YP_009121218.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] ref|YP_009121235.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] ref|YP_009161724.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] ref|YP_009161741.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] ref|YP_009191984.1| Ycf15 protein (chloroplast) [Panax vietnamensis] ref|YP_009192002.1| Ycf15 protein (chloroplast) [Panax vietnamensis] ref|YP_009241114.1| Ycf15 (chloroplast) [Schefflera heptaphylla] ref|YP_009241096.1| Ycf15 (chloroplast) [Schefflera heptaphylla] gb|AEO92683.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gb|AEO92684.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gb|AGG39087.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gb|AGG39106.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gb|AGG39174.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gb|AGG39193.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gb|AGG39261.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gb|AGG39280.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gb|AGG39348.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gb|AGG39367.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gb|AIA24372.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gb|AIA24389.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gb|AKB99116.1| Ycf15 protein (chloroplast) [Panax notoginseng] gb|AKB99134.1| Ycf15 protein (chloroplast) [Panax notoginseng] gb|AKB99290.1| Ycf15 protein (chloroplast) [Panax vietnamensis] gb|AKB99308.1| Ycf15 protein (chloroplast) [Panax vietnamensis] gb|AKB99377.1| Ycf15 protein (chloroplast) [Panax vietnamensis] gb|AKB99395.1| Ycf15 protein (chloroplast) [Panax vietnamensis] gb|AKG26645.1| Ycf15 (chloroplast) [Panax notoginseng] gb|AKS10998.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gb|AKS11016.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gb|AKU70821.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gb|AKU70839.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gb|AMK46219.1| Ycf15 (chloroplast) [Schefflera heptaphylla] gb|AMK46225.1| Ycf15 (chloroplast) [Schefflera heptaphylla] gb|ANS71813.1| Ycf15 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71831.1| Ycf15 (chloroplast) [Eleutherococcus sessiliflorus] gb|ANS71900.1| Ycf15 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71918.1| Ycf15 (chloroplast) [Eleutherococcus gracilistylus] gb|ANS71987.1| Ycf15 (chloroplast) [Aralia elata] gb|ANS72005.1| Ycf15 (chloroplast) [Aralia elata] gb|ARJ61728.1| Ycf15 protein (plastid) [Eleutherococcus senticosus] gb|ARJ61729.1| Ycf15 protein (plastid) [Eleutherococcus senticosus] gb|ATI20907.1| Ycf15 (chloroplast) [Panax stipuleanatus] gb|ATI20925.1| Ycf15 (chloroplast) [Panax stipuleanatus] gb|ATJ26172.1| Ycf15 protein (chloroplast) [Panax sp. VM-2017] gb|ATJ26190.1| Ycf15 protein (chloroplast) [Panax sp. VM-2017] gb|ATJ26338.1| Ycf15 protein (chloroplast) [Panax vietnamensis] gb|ATJ26339.1| Ycf15 protein (chloroplast) [Panax vietnamensis] Length = 100 Score = 211 bits (538), Expect = 2e-68 Identities = 99/100 (99%), Positives = 100/100 (100%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 60 Query: 175 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 56 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH Sbjct: 61 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 100 >sp|Q68RU5.1|YCF15_PANGI PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15 gb|AAT98553.1| ycf15 protein (chloroplast) [Panax ginseng] gb|AAT98572.1| ycf15 protein (chloroplast) [Panax ginseng] gb|AGM15032.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGM15033.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGM15118.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGM15119.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGM15204.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGM15205.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGW31964.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AGW31965.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gb|AIX98613.1| Ycf15 (chloroplast) [Panax ginseng] gb|AIX98631.1| Ycf15 (chloroplast) [Panax ginseng] gb|AKZ29792.1| hypothetical chloroplast RF15 (chloroplast) [Panax quinquefolius] gb|AKZ29809.1| hypothetical chloroplast RF15 (chloroplast) [Panax quinquefolius] Length = 100 Score = 210 bits (534), Expect = 8e-68 Identities = 98/100 (98%), Positives = 100/100 (100%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIFWTLAPWNNMLLLKHGRIEIL+QNTMYGWYELPKQEFLNSEQPVHIFTTKKR Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILEQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 60 Query: 175 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 56 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH Sbjct: 61 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 100 >ref|YP_009122770.1| ycf15 protein (chloroplast) [Dendropanax dentiger] ref|YP_009122787.1| ycf15 protein (chloroplast) [Dendropanax dentiger] ref|YP_009159582.1| Ycf15 (chloroplast) [Dendropanax morbifer] ref|YP_009159600.1| Ycf15 (chloroplast) [Dendropanax morbifer] ref|YP_009191897.1| Ycf15 protein (chloroplast) [Panax japonicus] ref|YP_009191915.1| Ycf15 protein (chloroplast) [Panax japonicus] gb|AJK29899.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gb|AJK29900.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gb|AKB99203.1| Ycf15 protein (chloroplast) [Panax japonicus] gb|AKB99221.1| Ycf15 protein (chloroplast) [Panax japonicus] gb|AKQ20772.1| Ycf15 (chloroplast) [Dendropanax morbifer] gb|AKQ20790.1| Ycf15 (chloroplast) [Dendropanax morbifer] Length = 100 Score = 206 bits (525), Expect = 2e-66 Identities = 98/100 (98%), Positives = 99/100 (99%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIF TLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR Sbjct: 1 METLVSSIFLTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 60 Query: 175 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 56 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH Sbjct: 61 STGFRIGPESEGRLECQQASIIEFTRPDSTHFGNVQCQSH 100 >ref|YP_008814901.1| hypothetical chloroplast RF15 (chloroplast) [Aralia undulata] ref|YP_008814918.1| hypothetical chloroplast RF15 (chloroplast) [Aralia undulata] gb|AGG39000.1| hypothetical chloroplast RF15 (chloroplast) [Aralia undulata] gb|AGG39019.1| hypothetical chloroplast RF15 (chloroplast) [Aralia undulata] Length = 109 Score = 169 bits (428), Expect(2) = 9e-52 Identities = 81/87 (93%), Positives = 83/87 (95%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 60 Query: 175 STGFRIGPESEGRLECQQASIIEFTRP 95 STGFRIGPESEGRLECQQAS + T P Sbjct: 61 STGFRIGPESEGRLECQQASSPDPTVP 87 Score = 62.4 bits (150), Expect(2) = 9e-52 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 108 NSPDPTVPILGTSSAKVTEWVNRQSLKRTM 19 +SPDPTVPILGTSSAKVTEWVNRQSLKRTM Sbjct: 80 SSPDPTVPILGTSSAKVTEWVNRQSLKRTM 109 >gb|EPS74523.1| hypothetical protein M569_00240, partial [Genlisea aurea] Length = 92 Score = 137 bits (344), Expect = 5e-39 Identities = 66/74 (89%), Positives = 67/74 (90%) Frame = -2 Query: 370 LGGRVVETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIF 191 LGGRVVETL+SSIFWTLAPWNNMLL KHGRIEILDQ TMYGWYELPKQEFLNSEQPV IF Sbjct: 1 LGGRVVETLLSSIFWTLAPWNNMLLPKHGRIEILDQKTMYGWYELPKQEFLNSEQPVQIF 60 Query: 190 TTKKRSTGFRIGPE 149 TTKK FRIGPE Sbjct: 61 TTKKYWILFRIGPE 74 >gb|AHW52227.1| hypothetical chloroplast RF15 (chloroplast) [Rhazya stricta] gb|AHW52245.1| hypothetical chloroplast RF15 (chloroplast) [Rhazya stricta] Length = 64 Score = 132 bits (332), Expect = 1e-37 Identities = 61/64 (95%), Positives = 63/64 (98%) Frame = -2 Query: 370 LGGRVVETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIF 191 +GGRVVETLVSSIFWTLAPWNNMLLLKHGRIEI+DQNTMYGWYELPKQEFLNSEQPV IF Sbjct: 1 MGGRVVETLVSSIFWTLAPWNNMLLLKHGRIEIVDQNTMYGWYELPKQEFLNSEQPVQIF 60 Query: 190 TTKK 179 TTKK Sbjct: 61 TTKK 64 >ref|YP_009461077.1| putative chloroplast RF15 (plastid) [Lamium album] ref|YP_009461095.1| putative chloroplast RF15 (plastid) [Lamium album] ref|YP_009461166.1| putative chloroplast RF15 (plastid) [Lamium galeobdolon] ref|YP_009461184.1| putative chloroplast RF15 (plastid) [Lamium galeobdolon] gb|AUT82363.1| putative chloroplast RF15 (plastid) [Lamium album] gb|AUT82364.1| putative chloroplast RF15 (plastid) [Lamium album] gb|AUT82452.1| putative chloroplast RF15 (plastid) [Lamium galeobdolon] gb|AUT82453.1| putative chloroplast RF15 (plastid) [Lamium galeobdolon] Length = 82 Score = 132 bits (332), Expect = 2e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 GILFRIGPE 69 >ref|YP_009255651.1| ycf15 protein (chloroplast) [Cornus controversa] ref|YP_009255668.1| ycf15 protein (chloroplast) [Cornus controversa] gb|AND96944.1| ycf15 protein (chloroplast) [Cornus controversa] gb|AND96945.1| ycf15 protein (chloroplast) [Cornus controversa] Length = 82 Score = 132 bits (332), Expect = 2e-37 Identities = 63/69 (91%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009253293.1| Ycf15 (chloroplast) [Bruinsmia polysperma] ref|YP_009253312.1| Ycf15 (chloroplast) [Bruinsmia polysperma] ref|YP_009407525.1| Ycf15 (chloroplast) [Sinojackia xylocarpa] ref|YP_009407545.1| Ycf15 (chloroplast) [Sinojackia xylocarpa] ref|YP_009419970.1| Ycf15 (plastid) [Melliodendron xylocarpum] ref|YP_009419987.1| Ycf15 (plastid) [Melliodendron xylocarpum] ref|YP_009419883.1| Ycf15 (plastid) [Sinojackia rehderiana] ref|YP_009419900.1| Ycf15 (plastid) [Sinojackia rehderiana] gb|ANB78766.1| Ycf15 (chloroplast) [Bruinsmia polysperma] gb|ANB78785.1| Ycf15 (chloroplast) [Bruinsmia polysperma] gb|ASA46555.1| Ycf15 (chloroplast) [Sinojackia xylocarpa] gb|ASA46556.1| Ycf15 (chloroplast) [Sinojackia xylocarpa] gb|ASM46636.1| Ycf15 (plastid) [Sinojackia rehderiana] gb|ASM46637.1| Ycf15 (plastid) [Sinojackia rehderiana] gb|ASM46721.1| Ycf15 (plastid) [Melliodendron xylocarpum] gb|ASM46722.1| Ycf15 (plastid) [Melliodendron xylocarpum] Length = 82 Score = 132 bits (331), Expect = 3e-37 Identities = 63/73 (86%), Positives = 65/73 (89%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPESEGR 137 FRIGPE R Sbjct: 61 WILFRIGPERRRR 73 >gb|AMQ33540.1| hypothetical chloroplast RF15, partial (chloroplast) [Haplostachys linearifolia] Length = 81 Score = 131 bits (329), Expect = 7e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >gb|ANQ46307.1| ycf15 (chloroplast) [Pogostemon cablin] Length = 82 Score = 131 bits (329), Expect = 7e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKD 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009166730.1| hypothetical chloroplast RF15 (chloroplast) [Tanaecium tetragonolobum] ref|YP_009242108.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne haliakalae] ref|YP_009242126.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne haliakalae] ref|YP_009242196.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne bifida] ref|YP_009242214.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne bifida] ref|YP_009242284.1| hypothetical chloroplast RF15 (chloroplast) [Haplostachys haplostachya] ref|YP_009242302.1| hypothetical chloroplast RF15 (chloroplast) [Haplostachys haplostachya] ref|YP_009242372.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia velutina] ref|YP_009242390.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia velutina] ref|YP_009242460.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne kanehoana] ref|YP_009242478.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne kanehoana] ref|YP_009242548.1| hypothetical chloroplast RF15 (chloroplast) [Stachys chamissonis] ref|YP_009242566.1| hypothetical chloroplast RF15 (chloroplast) [Stachys chamissonis] ref|YP_009242636.1| hypothetical chloroplast RF15 (chloroplast) [Stachys coccinea] ref|YP_009242654.1| hypothetical chloroplast RF15 (chloroplast) [Stachys coccinea] ref|YP_009242724.1| hypothetical chloroplast RF15 (chloroplast) [Stachys sylvatica] ref|YP_009242742.1| hypothetical chloroplast RF15 (chloroplast) [Stachys sylvatica] ref|YP_009242812.1| hypothetical chloroplast RF15 (chloroplast) [Stachys byzantina] ref|YP_009242830.1| hypothetical chloroplast RF15 (chloroplast) [Stachys byzantina] ref|YP_009270957.1| Ycf15 (chloroplast) [Perilla setoyensis] ref|YP_009270975.1| Ycf15 (chloroplast) [Perilla setoyensis] ref|YP_009270781.1| Ycf15 (chloroplast) [Perilla citriodora] ref|YP_009270799.1| Ycf15 (chloroplast) [Perilla citriodora] ref|YP_009270869.1| Ycf15 (chloroplast) [Perilla frutescens] ref|YP_009270887.1| Ycf15 (chloroplast) [Perilla frutescens] ref|YP_009460820.1| Ycf15 (plastid) [Galeopsis tetrahit] ref|YP_009460838.1| Ycf15 (plastid) [Galeopsis tetrahit] gb|ALB78298.1| hypothetical chloroplast RF15 (chloroplast) [Tanaecium tetragonolobum] gb|AMQ32905.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne haliakalae] gb|AMQ32924.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne haliakalae] gb|AMQ32992.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia waimeae] gb|AMQ33012.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia waimeae] gb|AMQ33080.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne bifida] gb|AMQ33100.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne bifida] gb|AMQ33168.1| hypothetical chloroplast RF15 (chloroplast) [Haplostachys haplostachya] gb|AMQ33188.1| hypothetical chloroplast RF15 (chloroplast) [Haplostachys haplostachya] gb|AMQ33256.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia velutina] gb|AMQ33276.1| hypothetical chloroplast RF15 (chloroplast) [Phyllostegia velutina] gb|AMQ33364.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne sessilis] gb|AMQ33432.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne kanehoana] gb|AMQ33452.1| hypothetical chloroplast RF15 (chloroplast) [Stenogyne kanehoana] gb|AMQ33520.1| hypothetical chloroplast RF15 (chloroplast) [Haplostachys linearifolia] gb|AMQ33608.1| hypothetical chloroplast RF15 (chloroplast) [Stachys chamissonis] gb|AMQ33628.1| hypothetical chloroplast RF15 (chloroplast) [Stachys chamissonis] gb|AMQ33696.1| hypothetical chloroplast RF15 (chloroplast) [Stachys coccinea] gb|AMQ33716.1| hypothetical chloroplast RF15 (chloroplast) [Stachys coccinea] gb|AMQ33784.1| hypothetical chloroplast RF15 (chloroplast) [Stachys sylvatica] gb|AMQ33804.1| hypothetical chloroplast RF15 (chloroplast) [Stachys sylvatica] gb|AMQ33872.1| hypothetical chloroplast RF15 (chloroplast) [Stachys byzantina] gb|AMQ33892.1| hypothetical chloroplast RF15 (chloroplast) [Stachys byzantina] gb|AMR74153.1| Ycf15 (chloroplast) [Perilla frutescens] gb|AMR74171.1| Ycf15 (chloroplast) [Perilla frutescens] gb|AMR74241.1| Ycf15 (chloroplast) [Perilla frutescens var. acuta] gb|AMR74259.1| Ycf15 (chloroplast) [Perilla frutescens var. acuta] gb|AMR74329.1| Ycf15 (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74347.1| Ycf15 (chloroplast) [Perilla frutescens f. crispidiscolor] gb|AMR74417.1| Ycf15 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74435.1| Ycf15 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74505.1| Ycf15 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74523.1| Ycf15 (chloroplast) [Perilla frutescens var. crispa] gb|AMR74593.1| Ycf15 (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74611.1| Ycf15 (chloroplast) [Perilla frutescens var. frutescens] gb|AMR74681.1| Ycf15 (chloroplast) [Perilla citriodora] gb|AMR74699.1| Ycf15 (chloroplast) [Perilla citriodora] gb|AMR74769.1| Ycf15 (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74787.1| Ycf15 (chloroplast) [Perilla frutescens var. hirtella] gb|AMR74857.1| Ycf15 (chloroplast) [Perilla setoyensis] gb|AMR74875.1| Ycf15 (chloroplast) [Perilla setoyensis] gb|ALO62167.2| hypothetical chloroplast RF15 (chloroplast) [Crescentia cujete] gb|ANW48619.1| hypothetical chloroplast RF15 (chloroplast) [Crescentia cujete] gb|AUT82106.1| Ycf15 (plastid) [Galeopsis tetrahit] gb|AUT82107.1| Ycf15 (plastid) [Galeopsis tetrahit] Length = 82 Score = 131 bits (329), Expect = 7e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_004935711.1| ycf15 protein (chloroplast) [Sesamum indicum] ref|YP_004935728.1| ycf15 protein (chloroplast) [Sesamum indicum] gb|AEO92751.1| ycf15 protein (chloroplast) [Sesamum indicum] gb|AEO92768.1| ycf15 protein (chloroplast) [Sesamum indicum] gb|AGL45380.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 82 Score = 131 bits (329), Expect = 7e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009411944.1| Ycf15 (plastid) [Schima multibracteata] ref|YP_009411961.1| Ycf15 (plastid) [Schima multibracteata] ref|YP_009411596.1| Ycf15 (plastid) [Schima argentea] ref|YP_009411613.1| Ycf15 (plastid) [Schima argentea] ref|YP_009411683.1| Ycf15 (plastid) [Schima brevipedicellata] ref|YP_009411700.1| Ycf15 (plastid) [Schima brevipedicellata] ref|YP_009411770.1| Ycf15 (plastid) [Schima crenata] ref|YP_009411787.1| Ycf15 (plastid) [Schima crenata] ref|YP_009411857.1| Ycf15 (plastid) [Schima khasiana] ref|YP_009411874.1| Ycf15 (plastid) [Schima khasiana] ref|YP_009412031.1| Ycf15 (plastid) [Schima noronhae] ref|YP_009412048.1| Ycf15 (plastid) [Schima noronhae] ref|YP_009412118.1| Ycf15 (plastid) [Schima remotiserrata] ref|YP_009412135.1| Ycf15 (plastid) [Schima remotiserrata] ref|YP_009412205.1| Ycf15 (plastid) [Schima sericans] ref|YP_009412222.1| Ycf15 (plastid) [Schima sericans] ref|YP_009412292.1| Ycf15 (plastid) [Schima sinensis] ref|YP_009412309.1| Ycf15 (plastid) [Schima sinensis] ref|YP_009412379.1| Ycf15 (plastid) [Schima superba] ref|YP_009412396.1| Ycf15 (plastid) [Schima superba] ref|YP_009412466.1| Ycf15 (plastid) [Schima wallichii] ref|YP_009412483.1| Ycf15 (plastid) [Schima wallichii] ref|YP_009415450.1| Ycf15 (plastid) [Stewartia sinensis] ref|YP_009415467.1| Ycf15 (plastid) [Stewartia sinensis] ref|YP_009415972.1| Ycf15 (plastid) [Gordonia brandegeei] ref|YP_009415989.1| Ycf15 (plastid) [Gordonia brandegeei] ref|YP_009416059.1| Ycf15 (plastid) [Stewartia crassifolia] ref|YP_009416076.1| Ycf15 (plastid) [Stewartia crassifolia] ref|YP_009416233.1| Ycf15 (plastid) [Stewartia cordifolia] ref|YP_009416250.1| Ycf15 (plastid) [Stewartia cordifolia] ref|YP_009416320.1| Ycf15 (plastid) [Stewartia rubiginosa] ref|YP_009416337.1| Ycf15 (plastid) [Stewartia rubiginosa] ref|YP_009416581.1| Ycf15 (plastid) [Adinandra angustifolia] ref|YP_009416598.1| Ycf15 (plastid) [Adinandra angustifolia] ref|YP_009418143.1| Ycf15 (plastid) [Stewartia malacodendron] ref|YP_009418160.1| Ycf15 (plastid) [Stewartia malacodendron] ref|YP_009418839.1| Ycf15 (plastid) [Gordonia lasianthus] ref|YP_009418856.1| Ycf15 (plastid) [Gordonia lasianthus] ref|YP_009419361.1| Ycf15 (plastid) [Barringtonia racemosa] ref|YP_009419378.1| Ycf15 (plastid) [Barringtonia racemosa] ref|YP_009417388.1| Ycf15 (plastid) [Adinandra millettii] ref|YP_009417405.1| Ycf15 (plastid) [Adinandra millettii] ref|YP_009418056.1| Ycf15 (plastid) [Stewartia pteropetiolata] ref|YP_009418073.1| Ycf15 (plastid) [Stewartia pteropetiolata] ref|YP_009418230.1| Ycf15 (plastid) [Franklinia alatamaha] ref|YP_009418247.1| Ycf15 (plastid) [Franklinia alatamaha] ref|YP_009418491.1| Ycf15 (plastid) [Stewartia ovata] ref|YP_009418508.1| Ycf15 (plastid) [Stewartia ovata] ref|YP_009418578.1| Ycf15 (plastid) [Stewartia calcicola] ref|YP_009418595.1| Ycf15 (plastid) [Stewartia calcicola] ref|YP_009418665.1| Ycf15 (plastid) [Stewartia pseudocamellia] ref|YP_009418682.1| Ycf15 (plastid) [Stewartia pseudocamellia] ref|YP_009418752.1| Ycf15 (plastid) [Stewartia rostrata] ref|YP_009418769.1| Ycf15 (plastid) [Stewartia rostrata] ref|YP_009419013.1| Ycf15 (plastid) [Barringtonia fusicarpa] ref|YP_009419030.1| Ycf15 (plastid) [Barringtonia fusicarpa] ref|YP_009419535.1| Ycf15 (plastid) [Sladenia celastrifolia] ref|YP_009419552.1| Ycf15 (plastid) [Sladenia celastrifolia] gb|ADZ36339.1| hypothetical protein RF15 (chloroplast) [Franklinia alatamaha] gb|ASK06608.1| Ycf15 (plastid) [Schima argentea] gb|ASK06609.1| Ycf15 (plastid) [Schima argentea] gb|ASK06695.1| Ycf15 (plastid) [Schima brevipedicellata] gb|ASK06696.1| Ycf15 (plastid) [Schima brevipedicellata] gb|ASK06782.1| Ycf15 (plastid) [Schima crenata] gb|ASK06783.1| Ycf15 (plastid) [Schima crenata] gb|ASK06869.1| Ycf15 (plastid) [Schima khasiana] gb|ASK06870.1| Ycf15 (plastid) [Schima khasiana] gb|ASK06956.1| Ycf15 (plastid) [Schima multibracteata] gb|ASK06957.1| Ycf15 (plastid) [Schima multibracteata] gb|ASK07043.1| Ycf15 (plastid) [Schima noronhae] gb|ASK07044.1| Ycf15 (plastid) [Schima noronhae] gb|ASK07130.1| Ycf15 (plastid) [Schima remotiserrata] gb|ASK07131.1| Ycf15 (plastid) [Schima remotiserrata] gb|ASK07217.1| Ycf15 (plastid) [Schima sericans] gb|ASK07218.1| Ycf15 (plastid) [Schima sericans] gb|ASK07304.1| Ycf15 (plastid) [Schima sinensis] gb|ASK07305.1| Ycf15 (plastid) [Schima sinensis] gb|ASK07391.1| Ycf15 (plastid) [Schima superba] gb|ASK07392.1| Ycf15 (plastid) [Schima superba] gb|ASK07478.1| Ycf15 (plastid) [Schima wallichii] gb|ASK07479.1| Ycf15 (plastid) [Schima wallichii] gb|ASM42202.1| Ycf15 (plastid) [Stewartia sinensis] gb|ASM42218.1| Ycf15 (plastid) [Stewartia sinensis] gb|ASM43069.1| Ycf15 (plastid) [Gordonia brandegeei] gb|ASM43070.1| Ycf15 (plastid) [Gordonia brandegeei] gb|ASM43330.1| Ycf15 (plastid) [Stewartia crassifolia] gb|ASM43331.1| Ycf15 (plastid) [Stewartia crassifolia] gb|ASM43678.1| Ycf15 (plastid) [Stewartia pteropetiolata] gb|ASM43679.1| Ycf15 (plastid) [Stewartia pteropetiolata] gb|ASM43942.1| Ycf15 (plastid) [Stewartia malacodendron] gb|ASM43958.1| Ycf15 (plastid) [Stewartia malacodendron] gb|ASM44026.1| Ycf15 (plastid) [Franklinia alatamaha] gb|ASM44027.1| Ycf15 (plastid) [Franklinia alatamaha] gb|ASM44113.1| Ycf15 (plastid) [Stewartia cordifolia] gb|ASM44114.1| Ycf15 (plastid) [Stewartia cordifolia] gb|ASM44287.1| Ycf15 (plastid) [Stewartia rubiginosa] gb|ASM44288.1| Ycf15 (plastid) [Stewartia rubiginosa] gb|ASM44548.1| Ycf15 (plastid) [Stewartia ovata] gb|ASM44549.1| Ycf15 (plastid) [Stewartia ovata] gb|ASM44635.1| Ycf15 (plastid) [Stewartia calcicola] gb|ASM44636.1| Ycf15 (plastid) [Stewartia calcicola] gb|ASM44726.1| Ycf15 (plastid) [Schima brevipedicellata] gb|ASM44742.1| Ycf15 (plastid) [Schima brevipedicellata] gb|ASM44896.1| Ycf15 (plastid) [Stewartia pseudocamellia] gb|ASM44897.1| Ycf15 (plastid) [Stewartia pseudocamellia] gb|ASM44986.1| Ycf15 (plastid) [Stewartia rostrata] gb|ASM45002.1| Ycf15 (plastid) [Stewartia rostrata] gb|ASM45070.1| Ycf15 (plastid) [Gordonia lasianthus] gb|ASM45071.1| Ycf15 (plastid) [Gordonia lasianthus] gb|ASM45418.1| Ycf15 (plastid) [Barringtonia fusicarpa] gb|ASM45419.1| Ycf15 (plastid) [Barringtonia fusicarpa] gb|ASM45766.1| Ycf15 (plastid) [Barringtonia racemosa] gb|ASM45767.1| Ycf15 (plastid) [Barringtonia racemosa] gb|ASM45940.1| Ycf15 (plastid) [Adinandra angustifolia] gb|ASM45941.1| Ycf15 (plastid) [Adinandra angustifolia] gb|ASM46027.1| Ycf15 (plastid) [Adinandra millettii] gb|ASM46028.1| Ycf15 (plastid) [Adinandra millettii] gb|ASM46201.1| Ycf15 (plastid) [Sladenia celastrifolia] gb|ASM46202.1| Ycf15 (plastid) [Sladenia celastrifolia] Length = 82 Score = 131 bits (329), Expect = 7e-37 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009364438.1| hypothetical chloroplast RF15 (chloroplast) [Lysionotus pauciflorus] ref|YP_009364456.1| hypothetical chloroplast RF15 (chloroplast) [Lysionotus pauciflorus] ref|YP_009437513.1| hypothetical chloroplast RF15 (chloroplast) [Primulina eburnea] ref|YP_009437531.1| hypothetical chloroplast RF15 (chloroplast) [Primulina eburnea] ref|YP_009437601.1| hypothetical chloroplast RF15 (chloroplast) [Primulina liboensis] ref|YP_009437619.1| hypothetical chloroplast RF15 (chloroplast) [Primulina liboensis] gb|ARF05952.1| hypothetical chloroplast RF15 (chloroplast) [Lysionotus pauciflorus] gb|ARF05953.1| hypothetical chloroplast RF15 (chloroplast) [Lysionotus pauciflorus] gb|ATG27928.1| hypothetical chloroplast RF15 (chloroplast) [Primulina brachytricha var. magnibracteata] gb|ATG27929.1| hypothetical chloroplast RF15 (chloroplast) [Primulina brachytricha var. magnibracteata] gb|ATG28016.1| hypothetical chloroplast RF15 (chloroplast) [Primulina eburnea] gb|ATG28017.1| hypothetical chloroplast RF15 (chloroplast) [Primulina eburnea] gb|ATG28104.1| hypothetical chloroplast RF15 (chloroplast) [Primulina liboensis] gb|ATG28105.1| hypothetical chloroplast RF15 (chloroplast) [Primulina liboensis] Length = 82 Score = 130 bits (328), Expect = 1e-36 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKC 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009128115.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia deliciosa] ref|YP_009128132.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia deliciosa] ref|YP_009128032.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] ref|YP_009128049.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] ref|YP_009298404.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia polygama] ref|YP_009298421.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia polygama] ref|YP_009298487.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia tetramera] ref|YP_009298504.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia tetramera] ref|YP_009378720.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia arguta] ref|YP_009378737.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia arguta] ref|YP_009378804.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia eriantha] ref|YP_009378821.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia eriantha] ref|YP_009378888.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia kolomikta] ref|YP_009378905.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia kolomikta] gb|AJO26130.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AJO26147.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AJO26213.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AJO26230.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AJO26296.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia deliciosa] gb|AJO26313.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia deliciosa] gb|AJO26379.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AJO26396.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia chinensis] gb|AON77161.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia polygama] gb|AON77162.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia polygama] gb|AON77244.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia tetramera] gb|AON77245.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia tetramera] gb|AON77331.1| conserved hypothetical protein ycf15 (chloroplast) [Clematoclethra scandens subsp. hemsleyi] gb|AON77348.1| conserved hypothetical protein ycf15 (chloroplast) [Clematoclethra scandens subsp. hemsleyi] gb|ARI43573.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia arguta] gb|ARI43592.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia arguta] gb|ARI43657.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia eriantha] gb|ARI43676.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia eriantha] gb|ARI43741.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia kolomikta] gb|ARI43760.1| conserved hypothetical protein ycf15 (chloroplast) [Actinidia kolomikta] gb|ASD34380.1| conserved hypothetical protein Ycf15 (chloroplast) [Actinidia kolomikta] gb|ASD34397.1| conserved hypothetical protein Ycf15 (chloroplast) [Actinidia kolomikta] gb|AUB30111.1| conserved hypothetical protein Ycf15 (chloroplast) [Actinidia arguta] gb|AUB30128.1| conserved hypothetical protein Ycf15 (chloroplast) [Actinidia arguta] Length = 82 Score = 130 bits (328), Expect = 1e-36 Identities = 62/75 (82%), Positives = 66/75 (88%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV +FTTKK Sbjct: 1 METLLSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQLFTTKKY 60 Query: 175 STGFRIGPESEGRLE 131 FRIGPE + E Sbjct: 61 WILFRIGPERGRKAE 75 >gb|ADZ36326.1| hypothetical protein RF15 (chloroplast) [Camellia obtusifolia] Length = 82 Score = 130 bits (328), Expect = 1e-36 Identities = 62/75 (82%), Positives = 66/75 (88%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL+SSIFWTLAPWNN+LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLLSSIFWTLAPWNNILLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPESEGRLE 131 FRIGPE + E Sbjct: 61 WILFRIGPERRRKAE 75 >ref|YP_009123675.1| hypothetical chloroplast RF15 (chloroplast) [Iochroma stenanthum] gb|AJN90548.1| hypothetical chloroplast RF15 (chloroplast) [Iochroma stenanthum] prf||1211235CB ORF 87 Length = 87 Score = 130 bits (328), Expect = 1e-36 Identities = 67/87 (77%), Positives = 69/87 (79%), Gaps = 1/87 (1%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 VETLVSSIFWTLAPW NMLLLKHGRIEILDQNTMYGWYELPKQEFLNS+QPV IFTTKK Sbjct: 1 VETLVSSIFWTLAPWKNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSKQPVQIFTTKKY 60 Query: 175 STGFRIGPESEGRLECQQ-ASIIEFTR 98 FRIGPE + IEFTR Sbjct: 61 WILFRIGPERRRKAGMPTGVYYIEFTR 87 >ref|YP_009420939.1| ycf15 (chloroplast) [Caryopteris mongholica] ref|YP_009420955.1| ycf15 (chloroplast) [Caryopteris mongholica] gb|ASQ40524.1| ycf15 (chloroplast) [Caryopteris mongholica] gb|ASQ40540.1| ycf15 (chloroplast) [Caryopteris mongholica] Length = 82 Score = 130 bits (327), Expect = 1e-36 Identities = 62/69 (89%), Positives = 63/69 (91%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETL SSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLFSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69 >ref|YP_009240856.1| ycf15 protein (chloroplast) [Diplopanax stachyanthus] ref|YP_009240839.1| ycf15 protein (chloroplast) [Diplopanax stachyanthus] gb|AJO25263.1| ycf15 protein (chloroplast) [Diplopanax stachyanthus] gb|AJO25264.1| ycf15 protein (chloroplast) [Diplopanax stachyanthus] gb|AQU64698.1| Ycf15 (chloroplast) [Camptotheca acuminata] gb|AQU64699.1| Ycf15 (chloroplast) [Camptotheca acuminata] gb|ATN40539.1| Ycf15 protein (chloroplast) [Camptotheca acuminata] Length = 82 Score = 130 bits (326), Expect = 2e-36 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -2 Query: 355 VETLVSSIFWTLAPWNNMLLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKR 176 +ETLVSSIFWTLAPWNNMLLLK+GRIEILDQNTMYGWYELPKQEFLNSEQPV IFTTKK Sbjct: 1 METLVSSIFWTLAPWNNMLLLKYGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKY 60 Query: 175 STGFRIGPE 149 FRIGPE Sbjct: 61 WILFRIGPE 69