BLASTX nr result
ID: Acanthopanax22_contig00000140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax22_contig00000140 (697 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFJ67126.1| hypothetical protein HMPREF9547_01655 [Escherichi... 411 e-144 gb|ESA94720.1| hypothetical protein HMPREF1620_02474 [Escherichi... 411 e-144 gb|EFK44664.1| hypothetical protein HMPREF9346_03695 [Escherichi... 410 e-144 gb|ESA65345.1| hypothetical protein HMPREF1589_04222 [Escherichi... 409 e-143 gb|EFJ81243.1| hypothetical protein HMPREF9534_02739 [Escherichi... 407 e-143 ref|WP_096941481.1| protein YrbL [Escherichia coli] >gi|12498787... 404 e-142 ref|WP_000620405.1| MULTISPECIES: protein YrbL [Proteobacteria] ... 404 e-142 ref|WP_059341328.1| protein YrbL [Escherichia coli] >gi|97539850... 404 e-142 ref|WP_054628191.1| protein YrbL [Escherichia coli] >gi|93768486... 404 e-142 ref|WP_032222339.1| protein YrbL [Escherichia coli] >gi|63388111... 404 e-142 ref|WP_000620398.1| MULTISPECIES: protein YrbL [Escherichia] >gi... 404 e-142 ref|WP_032207200.1| protein YrbL [Escherichia coli] >gi|65210953... 404 e-142 ref|WP_023308377.1| MULTISPECIES: protein YrbL [Enterobacteriace... 404 e-142 ref|WP_021564851.1| protein YrbL [Escherichia coli] >gi|53566839... 404 e-142 ref|WP_000620410.1| MULTISPECIES: protein YrbL [Enterobacteriace... 404 e-142 ref|WP_032230224.1| protein YrbL [Escherichia coli] >gi|59870598... 404 e-141 ref|WP_105484645.1| protein YrbL [Escherichia coli] 403 e-141 ref|WP_097309321.1| protein YrbL [Escherichia coli] 403 e-141 ref|WP_078279574.1| protein YrbL [Escherichia coli] 403 e-141 ref|WP_044863660.1| protein YrbL [Escherichia coli] >gi|94372801... 403 e-141 >gb|EFJ67126.1| hypothetical protein HMPREF9547_01655 [Escherichia coli MS 175-1] gb|EFJ87211.1| hypothetical protein HMPREF9536_02478 [Escherichia coli MS 84-1] gb|EFJ97221.1| hypothetical protein HMPREF9540_02726 [Escherichia coli MS 115-1] gb|EFK01217.1| hypothetical protein HMPREF9548_04076 [Escherichia coli MS 182-1] gb|EFK15287.1| hypothetical protein HMPREF9541_02360 [Escherichia coli MS 116-1] gb|EFK25682.1| hypothetical protein HMPREF9550_02205 [Escherichia coli MS 187-1] gb|EFK65792.1| hypothetical protein HMPREF9347_05354 [Escherichia coli MS 124-1] gb|EFK74684.1| hypothetical protein HMPREF9535_01331 [Escherichia coli MS 78-1] gb|EFK91578.1| hypothetical protein HMPREF9543_01554 [Escherichia coli MS 146-1] gb|EFO60005.1| hypothetical protein HMPREF9348_00952 [Escherichia coli MS 145-7] gb|EFU37103.1| hypothetical protein HMPREF9350_01168 [Escherichia coli MS 85-1] gb|EGB87560.1| hypothetical protein HMPREF9542_02982 [Escherichia coli MS 117-3] gb|ESA66093.1| hypothetical protein HMPREF1591_02031 [Escherichia coli 113303] gb|ESA74977.1| hypothetical protein HMPREF1592_03436 [Escherichia coli 907357] gb|ESD11729.1| hypothetical protein HMPREF1595_00638 [Escherichia coli 907672] gb|ESD19978.1| hypothetical protein HMPREF1598_03040 [Escherichia coli 907710] gb|ESD63429.1| hypothetical protein HMPREF1608_04921 [Escherichia coli 908525] gb|ESD67320.1| hypothetical protein HMPREF1610_03573 [Escherichia coli 908555] gb|ESE08284.1| hypothetical protein HMPREF1616_01366 [Escherichia coli 908658] Length = 229 Score = 411 bits (1057), Expect = e-144 Identities = 200/213 (93%), Positives = 200/213 (93%) Frame = -3 Query: 695 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 516 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL Sbjct: 17 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 76 Query: 515 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXX 336 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 77 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQL 136 Query: 335 XXXXQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 156 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL Sbjct: 137 KRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 196 Query: 155 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 57 WKRFIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 197 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 229 >gb|ESA94720.1| hypothetical protein HMPREF1620_02474 [Escherichia coli 909945-2] Length = 229 Score = 411 bits (1056), Expect = e-144 Identities = 199/213 (93%), Positives = 200/213 (93%) Frame = -3 Query: 695 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 516 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL Sbjct: 17 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 76 Query: 515 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXX 336 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEED+A Sbjct: 77 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDVAQLRQLLKQL 136 Query: 335 XXXXQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 156 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL Sbjct: 137 KRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 196 Query: 155 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 57 WKRFIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 197 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 229 >gb|EFK44664.1| hypothetical protein HMPREF9346_03695 [Escherichia coli MS 119-7] gb|EFK50898.1| hypothetical protein HMPREF9345_02602 [Escherichia coli MS 107-1] gb|EGU97973.1| putative cytoplasmic protein [Escherichia coli MS 79-10] gb|ESC93425.1| hypothetical protein HMPREF1590_03944 [Escherichia coli 113302] gb|ESD72572.1| hypothetical protein HMPREF1609_02942 [Escherichia coli 908541] Length = 229 Score = 410 bits (1054), Expect = e-144 Identities = 199/213 (93%), Positives = 200/213 (93%) Frame = -3 Query: 695 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 516 GDGMIRLSEQ+PLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL Sbjct: 17 GDGMIRLSEQNPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 76 Query: 515 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXX 336 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 77 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQL 136 Query: 335 XXXXQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 156 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL Sbjct: 137 KRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 196 Query: 155 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 57 WKRFIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 197 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 229 >gb|ESA65345.1| hypothetical protein HMPREF1589_04222 [Escherichia coli 113290] Length = 229 Score = 409 bits (1051), Expect = e-143 Identities = 198/213 (92%), Positives = 199/213 (93%) Frame = -3 Query: 695 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 516 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL Sbjct: 17 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 76 Query: 515 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXX 336 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEED+A Sbjct: 77 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDVAQLRQLLKQL 136 Query: 335 XXXXQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 156 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL Sbjct: 137 KRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 196 Query: 155 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 57 WKRFIAQPALAIALQKDLQPRESKTLAL SREA Sbjct: 197 WKRFIAQPALAIALQKDLQPRESKTLALASREA 229 >gb|EFJ81243.1| hypothetical protein HMPREF9534_02739 [Escherichia coli MS 69-1] gb|ESD84508.1| hypothetical protein HMPREF1611_02876 [Escherichia coli 908573] Length = 229 Score = 407 bits (1046), Expect = e-143 Identities = 197/213 (92%), Positives = 198/213 (92%) Frame = -3 Query: 695 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 516 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL Sbjct: 17 GDGMIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRL 76 Query: 515 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXX 336 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEED+A Sbjct: 77 KDWSGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDVAQLRQLLKQL 136 Query: 335 XXXXQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 156 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL Sbjct: 137 KRYLQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERL 196 Query: 155 WKRFIAQPALAIALQKDLQPRESKTLALTSREA 57 WKRFI QPALAIALQKDLQPRESK LALTSREA Sbjct: 197 WKRFITQPALAIALQKDLQPRESKMLALTSREA 229 >ref|WP_096941481.1| protein YrbL [Escherichia coli] gb|PCS63281.1| hypothetical protein BMR44_01290 [Escherichia coli] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLNRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_000620405.1| MULTISPECIES: protein YrbL [Proteobacteria] ref|NP_417674.1| Mg(2+)-starvation-stimulated protein [Escherichia coli str. K-12 substr. MG1655] ref|NP_709006.2| hypothetical protein SF3247 [Shigella flexneri 2a str. 301] sp|P64611.1|YRBL_SHIFL RecName: Full=Uncharacterized protein YrbL sp|P64610.1|YRBL_ECOLI RecName: Full=Uncharacterized protein YrbL gb|AAA58009.1| ORF_o210 [Escherichia coli str. K-12 substr. MG1655] gb|AAC76239.1| Mg(2+)-starvation-stimulated protein [Escherichia coli str. K-12 substr. MG1655] gb|AAP18527.1| hypothetical protein S3465 [Shigella flexneri 2a str. 2457T] gb|AAN44713.2| conserved hypothetical protein [Shigella flexneri 2a str. 301] dbj|BAE77251.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gb|ABV07626.1| conserved hypothetical protein [Escherichia coli HS] gb|ACB04283.1| predicted protein [Escherichia coli str. K-12 substr. DH10B] gb|ACB17966.1| conserved hypothetical protein [Escherichia coli SMS-3-5] gb|EDU66746.1| conserved hypothetical protein [Escherichia coli 53638] gb|EDV61104.1| conserved hypothetical protein [Escherichia coli B7A] gb|EDV81613.1| conserved hypothetical protein [Escherichia coli E22] gb|EDX29125.1| conserved hypothetical protein [Escherichia coli B171] gb|EDX33369.1| conserved hypothetical protein [Shigella dysenteriae 1012] gb|EDX37864.1| conserved hypothetical protein [Escherichia coli 101-1] dbj|BAG79015.1| conserved hypothetical protein [Escherichia coli SE11] emb|CAR00169.1| conserved hypothetical protein [Escherichia coli IAI1] gb|EEH72017.1| hypothetical protein ESCG_00704 [Escherichia sp. 1_1_43] gb|ACR65023.1| predicted protein [Escherichia coli BW2952] emb|CAQ33540.1| predicted protein [Escherichia coli BL21(DE3)] gb|ACT27605.1| conserved hypothetical protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gb|ACT40721.1| hypothetical protein ECB_03072 [Escherichia coli B str. REL606] gb|ACT44876.1| Mg(2+)-starvation-stimulated protein [Escherichia coli BL21(DE3)] dbj|BAI27485.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] dbj|BAI32664.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] dbj|BAI37809.1| conserved predicted protein [Escherichia coli O111:H- str. 11128] gb|ACX38188.1| conserved hypothetical protein [Escherichia coli DH1] dbj|BAI56579.1| conserved hypothetical protein [Escherichia coli SE15] gb|ADA75574.1| hypothetical protein SFxv_3560 [Shigella flexneri 2002017] gb|EFI88124.1| hypothetical protein HMPREF9551_02860 [Escherichia coli MS 196-1] emb|CBJ02973.1| conserved hypothetical protein [Escherichia coli ETEC H10407] gb|EFQ01101.1| conserved hypothetical protein [Escherichia coli 1827-70] gb|EFS12992.1| hypothetical protein SF2457T_3014 [Shigella flexneri 2a str. 2457T] dbj|BAJ44952.1| hypothetical protein ECDH1ME8569_3096 [Escherichia coli DH1] gb|EFU97623.1| conserved hypothetical protein [Escherichia coli 3431] gb|EFW56400.1| Putative uncharacterized protein YrbL [Shigella boydii ATCC 9905] gb|EFW76696.1| Putative protein YrbL [Escherichia coli EC4100B] gb|EFZ40623.1| hypothetical protein ECEPECA14_3726 [Escherichia coli EPECa14] gb|EFZ48734.1| hypothetical protein ECE128010_0861 [Escherichia coli E128010] gb|EFZ64193.1| hypothetical protein ECOK1180_2348 [Escherichia coli OK1180] gb|EFZ68559.1| hypothetical protein ECOK1357_3578 [Escherichia coli OK1357] gb|EGB32393.1| PhoP regulatory network protein YrbL [Escherichia coli E1520] gb|EGB37872.1| PhoP regulatory network protein YrbL [Escherichia coli E482] gb|EGB56752.1| PhoP regulatory network protein YrbL [Escherichia coli H489] gb|EGB65501.1| PhoP regulatory network protein YrbL [Escherichia coli TA007] gb|EGC13454.1| PhoP regulatory network protein YrbL [Escherichia coli E1167] gb|EGH37773.1| putative uncharacterized protein YrbL [Escherichia coli AA86] gb|EGI09600.1| conserved hypothetical protein [Escherichia coli H736] gb|EGI14896.1| conserved hypothetical protein [Escherichia coli M605] gb|EGI39571.1| conserved hypothetical protein [Escherichia coli TA280] gb|EGI49675.1| conserved hypothetical protein [Escherichia coli H299] gb|EGI91633.1| hypothetical protein SD15574_3753 [Shigella dysenteriae 155-74] gb|EGJ05660.1| hypothetical protein SSJG_01708 [Escherichia coli D9] gb|EGJ82756.1| hypothetical protein SF434370_3441 [Shigella flexneri 4343-70] gb|EGJ83277.1| hypothetical protein SFK671_3853 [Shigella flexneri K-671] gb|EGK17929.1| hypothetical protein SFVA6_4133 [Shigella flexneri VA-6] gb|EGK18872.1| hypothetical protein SFK272_4017 [Shigella flexneri K-272] gb|EGK33875.1| hypothetical protein SFK304_4062 [Shigella flexneri K-304] gb|EGK34003.1| hypothetical protein SFK227_3868 [Shigella flexneri K-227] gb|EGM60422.1| hypothetical protein SFJ1713_3709 [Shigella flexneri SFJ17B] gb|AEJ58610.1| hypothetical protein UMNF18_4116 [Escherichia coli UMNF18] gb|EGU26394.1| hypothetical protein IAE_13191 [Escherichia coli XH140A] gb|EGV47124.1| hypothetical protein IAM_12880 [Escherichia coli XH001] gb|EGW66377.1| hypothetical protein EC253486_4236 [Escherichia coli 2534-86] gb|EGW82050.1| hypothetical protein EC30301_3763 [Escherichia coli 3030-1] gb|EGW87784.1| hypothetical protein ECSTECDG1313_4318 [Escherichia coli STEC_DG131-3] gb|EGW92826.1| hypothetical protein ECSTECEH250_3898 [Escherichia coli STEC_EH250] gb|EGX04905.1| hypothetical protein ECG581_3637 [Escherichia coli G58-1] gb|EGX05738.1| hypothetical protein ECSTECH18_4066 [Escherichia coli STEC_H.1.8] gb|EGX15855.1| hypothetical protein ECSTECS1191_4247 [Escherichia coli STEC_S1191] gb|EGX21374.1| hypothetical protein ECTX1999_3837 [Escherichia coli TX1999] dbj|BAL39851.1| predicted protein [Escherichia coli str. K-12 substr. MDS42] gb|EHN83226.1| hypothetical protein ESQG_03110 [Escherichia coli H494] gb|EHN89871.1| hypothetical protein ESRG_00057 [Escherichia coli TA124] gb|EHV53692.1| hypothetical protein ECDEC6A_3961 [Escherichia coli DEC6A] gb|EHV54533.1| hypothetical protein ECDEC6B_3527 [Escherichia coli DEC6B] gb|EHV57766.1| hypothetical protein ECDEC6C_3864 [Escherichia coli DEC6C] gb|EHV68076.1| hypothetical protein ECDEC6D_3864 [Escherichia coli DEC6D] gb|EHV70665.1| hypothetical protein ECDEC6E_3829 [Escherichia coli DEC6E] gb|EHV76010.1| hypothetical protein ECDEC7A_3728 [Escherichia coli DEC7A] gb|EHV84594.1| hypothetical protein ECDEC7C_3774 [Escherichia coli DEC7C] gb|EHV88619.1| hypothetical protein ECDEC7D_3988 [Escherichia coli DEC7D] gb|EHV98651.1| hypothetical protein ECDEC7E_3659 [Escherichia coli DEC7E] gb|EHW06931.1| hypothetical protein ECDEC8A_3951 [Escherichia coli DEC8A] gb|EHW12366.1| hypothetical protein ECDEC8C_4893 [Escherichia coli DEC8C] gb|EHW13514.1| hypothetical protein ECDEC8B_2471 [Escherichia coli DEC8B] gb|EHW22388.1| hypothetical protein ECDEC8D_4387 [Escherichia coli DEC8D] gb|EHW24965.1| hypothetical protein ECDEC8E_4176 [Escherichia coli DEC8E] gb|EHW32477.1| hypothetical protein ECDEC9A_4230 [Escherichia coli DEC9A] gb|EHW37173.1| hypothetical protein ECDEC9B_3891 [Escherichia coli DEC9B] gb|EHW42735.1| hypothetical protein ECDEC9C_4017 [Escherichia coli DEC9C] gb|EHW50126.1| hypothetical protein ECDEC9D_3880 [Escherichia coli DEC9D] gb|EHW53383.1| hypothetical protein ECDEC9E_4373 [Escherichia coli DEC9E] gb|EHW59653.1| hypothetical protein ECDEC10A_4339 [Escherichia coli DEC10A] gb|EHW65071.1| hypothetical protein ECDEC10B_4715 [Escherichia coli DEC10B] gb|EHW69719.1| hypothetical protein ECDEC10C_4766 [Escherichia coli DEC10C] gb|EHW75849.1| hypothetical protein ECDEC10D_4345 [Escherichia coli DEC10D] gb|EHW88457.1| hypothetical protein ECDEC11A_3789 [Escherichia coli DEC11A] gb|EHW88645.1| hypothetical protein ECDEC10F_4803 [Escherichia coli DEC10F] gb|EHX00640.1| hypothetical protein ECDEC11B_3789 [Escherichia coli DEC11B] gb|EHX07109.1| hypothetical protein ECDEC11D_3790 [Escherichia coli DEC11D] gb|EHX09058.1| hypothetical protein ECDEC11C_4114 [Escherichia coli DEC11C] gb|EHX17307.1| hypothetical protein ECDEC11E_3787 [Escherichia coli DEC11E] gb|EHX23561.1| hypothetical protein ECDEC12B_4442 [Escherichia coli DEC12B] gb|EHX27523.1| hypothetical protein ECDEC12A_3982 [Escherichia coli DEC12A] gb|EHX28548.1| hypothetical protein ECDEC12C_4085 [Escherichia coli DEC12C] gb|EHX44835.1| hypothetical protein ECDEC12E_3907 [Escherichia coli DEC12E] gb|EHX74801.1| hypothetical protein ECDEC14A_3552 [Escherichia coli DEC14A] gb|EIE38070.1| hypothetical protein OQE_05710 [Escherichia coli J53] gb|EIE56309.1| hypothetical protein ECAI27_15410 [Escherichia coli AI27] gb|EIF18531.1| hypothetical protein UWO_08492 [Escherichia coli O32:H37 str. P4] gb|EIF85024.1| hypothetical protein ESMG_02899 [Escherichia coli M919] gb|EIG47193.1| hypothetical protein ESSG_02126 [Escherichia coli H730] gb|EIG69311.1| hypothetical protein ESBG_02663 [Escherichia sp. 4_1_40B] gb|EIG92971.1| PhoP regulatory network protein YrbL [Escherichia coli 97.0246] gb|EIH02991.1| PhoP regulatory network protein YrbL [Escherichia coli 5.0588] gb|EIH14195.1| PhoP regulatory network protein YrbL [Escherichia coli 97.0259] gb|EIH54849.1| PhoP regulatory network protein YrbL [Escherichia coli 3.2608] gb|EIH66567.1| PhoP regulatory network protein YrbL [Escherichia coli 93.0624] gb|EIH77425.1| PhoP regulatory network protein YrbL [Escherichia coli 4.0522] gb|EIH89736.1| PhoP regulatory network protein YrbL [Escherichia coli JB1-95] gb|EII11968.1| PhoP regulatory network protein YrbL [Escherichia coli 5.0959] gb|EII20995.1| PhoP regulatory network protein YrbL [Escherichia coli 9.0111] gb|EII37193.1| PhoP regulatory network protein YrbL [Escherichia coli 4.0967] gb|EII44424.1| PhoP regulatory network protein YrbL [Escherichia coli 2.3916] gb|EII67962.1| PhoP regulatory network protein YrbL [Escherichia coli 2.4168] gb|EII77897.1| PhoP regulatory network protein YrbL [Escherichia coli 3.2303] gb|EIJ03852.1| PhoP regulatory network protein YrbL [Escherichia coli B41] gb|EIJ15464.1| PhoP regulatory network protein YrbL [Escherichia coli 900105 (10e)] gb|EIL05597.1| hypothetical protein ECO9534_14957 [Escherichia coli O111:H11 str. CVM9534] gb|EIL11310.1| hypothetical protein ECO9450_07093 [Escherichia coli O103:H2 str. CVM9450] gb|EIL17699.1| hypothetical protein ECO9570_14869 [Escherichia coli O111:H8 str. CVM9570] gb|EIL18525.1| hypothetical protein ECO9574_05859 [Escherichia coli O111:H8 str. CVM9574] gb|EIL22789.1| hypothetical protein ECO9545_09916 [Escherichia coli O111:H11 str. CVM9545] gb|EIL32439.1| hypothetical protein ECO9942_04664 [Escherichia coli O26:H11 str. CVM9942] gb|EIL33674.1| hypothetical protein ECO10026_17644 [Escherichia coli O26:H11 str. CVM10026] gb|EIL50734.1| hypothetical protein ECKD1_10395 [Escherichia coli KD1] gb|EIL57162.1| hypothetical protein EC54115_06839 [Escherichia coli 541-15] gb|EIL68070.1| hypothetical protein EC75_08531 [Escherichia coli 75] gb|EIL81787.1| hypothetical protein ECMT8_01383 [Escherichia coli CUMT8] gb|EIQ05845.1| hypothetical protein SF285071_3817 [Shigella flexneri 2850-71] gb|EIQ06542.1| hypothetical protein SFK1770_4340 [Shigella flexneri K-1770] gb|EIQ22873.1| hypothetical protein SFK404_4219 [Shigella flexneri K-404] gb|EIQ26284.1| hypothetical protein SB96558_4115 [Shigella boydii 965-58] gb|EIQ61091.1| hypothetical protein ECEPECA12_3836 [Escherichia coli EPECa12] gb|EIQ68789.1| hypothetical protein SF123566_5561 [Shigella flexneri 1235-66] gb|EJE58182.1| hypothetical protein ECO10224_11168 [Escherichia coli O26:H11 str. CVM10224] gb|EJE58438.1| hypothetical protein ECO9634_12384 [Escherichia coli O111:H8 str. CVM9634] gb|EJE68266.1| hypothetical protein ECO9602_15624 [Escherichia coli O111:H8 str. CVM9602] gb|EJE76885.1| hypothetical protein ECO10021_06242 [Escherichia coli O26:H11 str. CVM10021] gb|EJE91537.1| hypothetical protein ECO9553_29777 [Escherichia coli O111:H11 str. CVM9553] gb|EJE94078.1| hypothetical protein ECO9952_08973 [Escherichia coli O26:H11 str. CVM9952] gb|EJE97076.1| hypothetical protein ECO9455_32642 [Escherichia coli O111:H11 str. CVM9455] gb|EJF05074.1| hypothetical protein ECO10030_28735 [Escherichia coli O26:H11 str. CVM10030] gb|EJL11744.1| hypothetical protein SF660363_3778 [Shigella flexneri 6603-63] gb|EKI16675.1| hypothetical protein ECTW15901_3617 [Escherichia coli TW15901] gb|EKI24981.1| hypothetical protein ECTW00353_3593 [Escherichia coli TW00353] gb|EKI35529.1| hypothetical protein EC3006_3813 [Escherichia coli 3006] gb|EKJ13005.1| hypothetical protein ECEC1865_4484 [Escherichia coli EC1865] gb|EKJ56251.1| hypothetical protein EC01288_3442 [Escherichia coli 0.1288] gb|EKJ83682.1| hypothetical protein ECAD30_09450 [Escherichia coli AD30] gb|EKK41407.1| hypothetical protein EC80566_3418 [Escherichia coli 8.0566] gb|EKK42717.1| phoP regulatory network YrbL family protein [Escherichia coli 8.0569] emb|CCK48521.1| hypothetical protein BN16_38441 [Escherichia coli chi7122] emb|CCJ45835.1| hypothetical protein BN17_31501 [Escherichia coli] gb|EKU01806.1| hypothetical protein CFSAN001630_14958 [Escherichia coli O111:H11 str. CFSAN001630] gb|EKU04589.1| hypothetical protein CFSAN001629_02231 [Escherichia coli O26:H11 str. CFSAN001629] gb|EKU04868.1| hypothetical protein CFSAN001632_00180 [Escherichia coli O111:H8 str. CFSAN001632] gb|ELC14524.1| hypothetical protein WCM_00592 [Escherichia coli KTE10] gb|ELC63061.1| hypothetical protein A137_04054 [Escherichia coli KTE178] gb|ELC82348.1| hypothetical protein A13O_03540 [Escherichia coli KTE189] gb|ELC88798.1| hypothetical protein A13S_03879 [Escherichia coli KTE191] gb|ELD20252.1| hypothetical protein A15U_03677 [Escherichia coli KTE210] gb|ELD39758.1| hypothetical protein A177_03882 [Escherichia coli KTE216] gb|ELD68027.1| hypothetical protein A193_04001 [Escherichia coli KTE234] gb|ELD70344.1| hypothetical protein A191_01283 [Escherichia coli KTE233] gb|ELD95019.1| hypothetical protein A1S7_04137 [Escherichia coli KTE49] gb|ELD96853.1| hypothetical protein A1SA_04214 [Escherichia coli KTE51] gb|ELE16980.1| hypothetical protein A1SK_01179 [Escherichia coli KTE56] gb|ELE40180.1| hypothetical protein A1U5_03899 [Escherichia coli KTE66] gb|ELE53170.1| hypothetical protein A1UM_03907 [Escherichia coli KTE75] gb|ELE61657.1| hypothetical protein A1UQ_03699 [Escherichia coli KTE77] gb|ELE69386.1| hypothetical protein A1UY_03788 [Escherichia coli KTE81] gb|ELE96346.1| hypothetical protein A1WY_03853 [Escherichia coli KTE111] gb|ELF17403.1| hypothetical protein A31A_03891 [Escherichia coli KTE156] gb|ELF27831.1| hypothetical protein A31I_03566 [Escherichia coli KTE162] gb|ELF31738.1| hypothetical protein A31G_00686 [Escherichia coli KTE161] gb|ELF36168.1| hypothetical protein A31Q_03835 [Escherichia coli KTE171] gb|ELF49063.1| hypothetical protein WCG_00830 [Escherichia coli KTE6] gb|ELF71085.1| hypothetical protein WGE_03954 [Escherichia coli KTE42] gb|ELG25589.1| hypothetical protein A1US_03669 [Escherichia coli KTE78] gb|ELG36915.1| hypothetical protein A1UU_00657 [Escherichia coli KTE79] gb|ELG47281.1| hypothetical protein A1WM_02087 [Escherichia coli KTE101] gb|ELG67822.1| hypothetical protein A1YM_00615 [Escherichia coli KTE135] gb|ELG92815.1| hypothetical protein A313_01964 [Escherichia coli KTE147] gb|ELH00787.1| hypothetical protein A317_01228 [Escherichia coli KTE154] gb|ELH13484.1| hypothetical protein A31K_00608 [Escherichia coli KTE165] gb|ELH18764.1| hypothetical protein A133_04135 [Escherichia coli KTE173] gb|ELH23257.1| hypothetical protein A135_04200 [Escherichia coli KTE175] gb|ELH45548.1| hypothetical protein A155_03869 [Escherichia coli KTE197] gb|ELH48918.1| hypothetical protein A15G_04399 [Escherichia coli KTE203] gb|ELH69531.1| hypothetical protein A15W_03806 [Escherichia coli KTE211] gb|ELI04119.1| hypothetical protein WI5_03341 [Escherichia coli KTE104] gb|ELI09032.1| hypothetical protein WI9_03244 [Escherichia coli KTE106] gb|ELI36275.1| hypothetical protein WII_03582 [Escherichia coli KTE120] gb|ELI77593.1| hypothetical protein WK1_03242 [Escherichia coli KTE138] gb|ELI82800.1| hypothetical protein WK3_03224 [Escherichia coli KTE139] gb|ELI93655.1| hypothetical protein WK7_03333 [Escherichia coli KTE148] gb|ELL40713.1| hypothetical protein B185_018378 [Escherichia coli J96] emb|CCP96435.1| Putative uncharacterized protein YrbL [Escherichia coli O10:K5(L):H4 str. ATCC 23506] emb|CCQ00983.1| Putative uncharacterized protein YrbL [Escherichia coli O5:K4(L):H4 str. ATCC 23502] gb|AGC88692.1| hypothetical protein APECO78_19875 [Escherichia coli APEC O78] gb|EMD04897.1| hypothetical protein C202_15811 [Escherichia coli O08] gb|EMD06158.1| hypothetical protein C201_15105 [Escherichia coli S17] gb|EMD07902.1| hypothetical protein A364_16768 [Escherichia coli SEPT362] gb|EMR93445.1| hypothetical protein C4893_31160 [Escherichia coli ONT:H33 str. C48/93] gb|EMS06584.1| hypothetical protein C4390_31640 [Escherichia coli O127:H27 str. C43/90] gb|EMU58836.1| phoP regulatory network YrbL family protein [Escherichia coli MP021552.7] gb|EMU59028.1| phoP regulatory network YrbL family protein [Escherichia coli MP021552.11] gb|EMU67835.1| phoP regulatory network YrbL family protein [Escherichia coli MP021552.12] gb|EMU74777.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.9] gb|EMU76671.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.6] gb|EMU79108.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.5] gb|EMU90016.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.4] gb|EMU91294.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.3] gb|EMU93937.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.2] gb|EMV04604.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.10] gb|EMV08454.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.11] gb|EMV15869.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.12] gb|EMV17267.1| phoP regulatory network YrbL family protein [Escherichia coli C-34666] gb|EMV53299.1| phoP regulatory network YrbL family protein [Escherichia coli 2872000] gb|EMV54297.1| phoP regulatory network YrbL family protein [Escherichia coli 2871950] gb|EMV83032.1| phoP regulatory network YrbL family protein [Escherichia coli 2861200] gb|EMW19660.1| phoP regulatory network YrbL family protein [Escherichia coli 2848050] gb|EMW33248.1| phoP regulatory network YrbL family protein [Escherichia coli 2785200] gb|EMW46670.1| phoP regulatory network YrbL family protein [Escherichia coli 2780750] gb|EMW77252.1| phoP regulatory network YrbL family protein [Escherichia coli 180600] gb|EMW85612.1| phoP regulatory network YrbL family protein [Escherichia coli 180050] gb|EMW93426.1| phoP regulatory network YrbL family protein [Escherichia coli 174750] gb|EMW94092.1| phoP regulatory network YrbL family protein [Escherichia coli ThroopD] gb|EMW97526.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.1] gb|EMX18938.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.1] gb|EMX23111.1| phoP regulatory network YrbL family protein [Escherichia coli MP021566.1] gb|EMX29771.1| phoP regulatory network YrbL family protein [Escherichia coli MP021561.2] gb|EMX36996.1| phoP regulatory network YrbL family protein [Escherichia coli MP021552.8] gb|EMX37462.1| phoP regulatory network YrbL family protein [Escherichia coli MP021017.1] gb|EMX47158.1| phoP regulatory network YrbL family protein [Escherichia coli MP020980.2] gb|EMX53117.1| phoP regulatory network YrbL family protein [Escherichia coli MP020940.1] gb|EMX62187.1| phoP regulatory network YrbL family protein [Escherichia coli Jurua 18/11] gb|EMX83527.1| phoP regulatory network YrbL family protein [Escherichia coli 2719100] gb|EMZ61977.1| phoP regulatory network YrbL family protein [Escherichia coli 174900] gb|EMZ77585.1| phoP regulatory network YrbL family protein [Escherichia coli 2722950] gb|EMZ91297.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.1] gb|EMZ96243.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.1] gb|ENA03249.1| phoP regulatory network YrbL family protein [Escherichia coli P0299438.2] gb|ENA14445.1| phoP regulatory network YrbL family protein [Escherichia coli BCE008_MS-13] gb|ENA19209.1| phoP regulatory network YrbL family protein [Escherichia coli 201600.1] gb|ENA29029.1| phoP regulatory network YrbL family protein [Escherichia coli BCE007_MS-11] gb|ENA38137.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.4] gb|ENA43486.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.2] gb|ENA50320.1| phoP regulatory network YrbL family protein [Escherichia coli 2726950] gb|ENA59191.1| phoP regulatory network YrbL family protein [Escherichia coli 178900] gb|ENA76141.1| phoP regulatory network YrbL family protein [Escherichia coli 2730450] gb|ENA77287.1| phoP regulatory network YrbL family protein [Escherichia coli 2741950] gb|ENA78210.1| phoP regulatory network YrbL family protein [Escherichia coli 2730350] gb|ENA92701.1| phoP regulatory network YrbL family protein [Escherichia coli 2864350] gb|ENB12022.1| phoP regulatory network YrbL family protein [Escherichia coli BCE008_MS-01] gb|ENB19805.1| phoP regulatory network YrbL family protein [Escherichia coli BCE011_MS-01] gb|ENB26059.1| phoP regulatory network YrbL family protein [Escherichia coli BCE030_MS-09] gb|ENB31778.1| phoP regulatory network YrbL family protein [Escherichia coli BCE032_MS-12] gb|ENB86870.1| phoP regulatory network YrbL family protein [Escherichia coli P0299438.10] gb|ENC01869.1| phoP regulatory network YrbL family protein [Escherichia coli P0299438.4] gb|ENC29899.1| phoP regulatory network YrbL family protein [Escherichia coli P0299438.9] gb|ENC89668.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.11] gb|ENC91440.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.8] gb|END50597.1| phoP regulatory network YrbL family protein [Escherichia coli MP020980.1] gb|END55313.1| phoP regulatory network YrbL family protein [Escherichia coli BCE006_MS-23] gb|END65936.1| phoP regulatory network YrbL family protein [Escherichia coli P0299483.1] gb|END77340.1| phoP regulatory network YrbL family protein [Escherichia coli P0299483.2] gb|END80236.1| phoP regulatory network YrbL family protein [Escherichia coli P0299483.3] gb|END89050.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.13] gb|END89888.1| phoP regulatory network YrbL family protein [Escherichia coli P0301904.3] gb|ENE05762.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.2] gb|ENE43788.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.10] gb|ENE54934.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.11] gb|ENE61760.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.12] gb|ENE63355.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.13] gb|ENE69052.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.14] gb|ENE75051.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.15] gb|ENE78973.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.2] gb|ENE85161.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.3] gb|ENE92033.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.4] gb|ENE97380.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.5] gb|ENE98641.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.7] gb|ENF06791.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.8] gb|ENF10082.1| phoP regulatory network YrbL family protein [Escherichia coli P0304777.9] gb|ENF18063.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.11] gb|ENF22477.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.10] gb|ENF28881.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.12] gb|ENF32795.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.14] gb|ENF38679.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.13] gb|ENF44474.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.15] gb|ENF49848.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.6] gb|ENF60910.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.7] gb|ENF66781.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.8] gb|ENF69690.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.9] gb|ENF73877.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.10] gb|ENF81398.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.11] gb|ENF83574.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.12] gb|ENF88561.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.13] gb|ENF95549.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.15] gb|ENG01005.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.3] gb|ENG02331.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.4] gb|ENG10451.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.5] gb|ENG14652.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.6] gb|ENG15153.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.7] gb|ENG24380.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.8] gb|ENG32393.1| phoP regulatory network YrbL family protein [Escherichia coli P0305260.9] gb|ENG81208.1| phoP regulatory network YrbL family protein [Escherichia coli 178200] gb|ENG89308.1| phoP regulatory network YrbL family protein [Escherichia coli 178850] gb|ENG95121.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.3] gb|ENH07120.1| phoP regulatory network YrbL family protein [Escherichia coli P0301867.7] gb|ENH30651.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.3] gb|ENH31074.1| phoP regulatory network YrbL family protein [Escherichia coli P0304816.4] gb|EOU43375.1| hypothetical protein WC3_03957 [Escherichia coli KTE35] gb|EOU56687.1| hypothetical protein WCS_03700 [Escherichia coli KTE14] gb|EOU88766.1| hypothetical protein WEY_03964 [Escherichia coli KTE34] gb|EOV04929.1| hypothetical protein A151_03767 [Escherichia coli KTE195] gb|EOV16204.1| hypothetical protein A157_04167 [Escherichia coli KTE198] gb|EOV48187.1| hypothetical protein A1SU_03553 [Escherichia coli KTE61] gb|EOV55149.1| hypothetical protein A1U1_03422 [Escherichia coli KTE64] gb|EOV72700.1| hypothetical protein A1UE_04085 [Escherichia coli KTE71] gb|EOW02589.1| hypothetical protein A1WO_04728 [Escherichia coli KTE102] gb|EOW03472.1| hypothetical protein A1WK_04290 [Escherichia coli KTE100] gb|EOW11183.1| hypothetical protein A1WQ_04232 [Escherichia coli KTE103] gb|EOW19313.1| hypothetical protein A1WS_03930 [Escherichia coli KTE107] gb|EOW29898.1| hypothetical protein A1WU_00352 [Escherichia coli KTE108] gb|EOW42446.1| hypothetical protein A1YG_04143 [Escherichia coli KTE130] gb|EOW44736.1| hypothetical protein A1YI_04167 [Escherichia coli KTE132] gb|EOW57502.1| hypothetical protein A319_03560 [Escherichia coli KTE155] emb|CDC82033.1| putative uncharacterized protein [Escherichia coli CAG:4] gb|EQN15440.1| hypothetical protein G684_03513 [Escherichia coli HVH 4 (4-7276109)] gb|EQN24320.1| hypothetical protein G686_03452 [Escherichia coli HVH 6 (3-8296502)] gb|EQN52101.1| hypothetical protein G693_03418 [Escherichia coli HVH 17 (4-7473087)] gb|EQN73517.1| hypothetical protein G697_03431 [Escherichia coli HVH 21 (4-4517873)] gb|EQO27634.1| hypothetical protein G709_04265 [Escherichia coli HVH 33 (4-2174936)] gb|EQP66565.1| hypothetical protein G741_03369 [Escherichia coli HVH 78 (4-2735946)] gb|EQP69583.1| hypothetical protein G742_03438 [Escherichia coli HVH 79 (4-2512823)] gb|EQP87470.1| hypothetical protein G746_03489 [Escherichia coli HVH 84 (4-1021478)] gb|EQP90632.1| hypothetical protein G744_01171 [Escherichia coli HVH 82 (4-2209276)] gb|EQQ12704.1| hypothetical protein G752_03543 [Escherichia coli HVH 90 (4-3191362)] gb|EQQ72983.1| hypothetical protein G772_03229 [Escherichia coli HVH 111 (4-7039018)] gb|EQQ96753.1| hypothetical protein G777_04184 [Escherichia coli HVH 115 (4-4465989)] gb|EQQ99900.1| hypothetical protein G776_03550 [Escherichia coli HVH 115 (4-4465997)] gb|EQR35907.1| hypothetical protein G783_03485 [Escherichia coli HVH 121 (4-6877826)] gb|EQR92154.1| hypothetical protein G796_03329 [Escherichia coli HVH 138 (4-6066704)] gb|EQR93967.1| hypothetical protein G797_03332 [Escherichia coli HVH 139 (4-3192644)] gb|EQS03427.1| hypothetical protein G799_03486 [Escherichia coli HVH 141 (4-5995973)] gb|EQS10904.1| hypothetical protein G801_03394 [Escherichia coli HVH 143 (4-5674999)] gb|EQS32567.1| hypothetical protein G804_03499 [Escherichia coli HVH 146 (4-3189767)] gb|EQS53440.1| hypothetical protein G808_03318 [Escherichia coli HVH 150 (4-3258106)] gb|EQS59604.1| hypothetical protein G816_03321 [Escherichia coli HVH 158 (4-3224287)] gb|EQS63993.1| hypothetical protein G812_03237 [Escherichia coli HVH 154 (4-5636698)] gb|EQS77200.1| hypothetical protein G820_03232 [Escherichia coli HVH 162 (4-5627982)] gb|EQS92209.1| hypothetical protein G822_00065 [Escherichia coli HVH 164 (4-5953081)] gb|EQS93265.1| hypothetical protein G826_04748 [Escherichia coli HVH 171 (4-3191958)] gb|EQT19732.1| hypothetical protein G830_03481 [Escherichia coli HVH 176 (4-3428664)] gb|EQT21441.1| hypothetical protein G829_03592 [Escherichia coli HVH 175 (4-3405184)] gb|EQT42961.1| hypothetical protein G836_03506 [Escherichia coli HVH 184 (4-3343286)] gb|EQT53820.1| hypothetical protein G838_03143 [Escherichia coli HVH 186 (4-3405044)] gb|EQT59328.1| hypothetical protein G840_03456 [Escherichia coli HVH 188 (4-2356988)] gb|EQT70490.1| hypothetical protein G842_00798 [Escherichia coli HVH 190 (4-3255514)] gb|EQU02619.1| hypothetical protein G846_00299 [Escherichia coli HVH 194 (4-2356805)] gb|EQU11106.1| hypothetical protein G849_03438 [Escherichia coli HVH 197 (4-4466217)] gb|EQU20427.1| hypothetical protein G852_03691 [Escherichia coli HVH 200 (4-4449924)] gb|EQU32317.1| hypothetical protein G854_03709 [Escherichia coli HVH 202 (4-3163997)] gb|EQU45065.1| hypothetical protein G857_03561 [Escherichia coli HVH 205 (4-3094677)] gb|EQU72823.1| hypothetical protein G861_00751 [Escherichia coli HVH 209 (4-3062651)] gb|EQV05738.1| hypothetical protein G872_03172 [Escherichia coli HVH 221 (4-3136817)] gb|EQV51743.1| hypothetical protein G884_00556 [Escherichia coli KOEGE 40 (102a)] gb|EQW10784.1| hypothetical protein G897_03365 [Escherichia coli KOEGE 131 (358a)] gb|EQW29231.1| hypothetical protein G902_03512 [Escherichia coli UMEA 3052-1] gb|EQX04879.1| hypothetical protein G921_03083 [Escherichia coli UMEA 3155-1] gb|EQX49794.1| hypothetical protein G929_03440 [Escherichia coli UMEA 3174-1] gb|EQX64215.1| hypothetical protein G934_03396 [Escherichia coli UMEA 3185-1] gb|EQX67194.1| hypothetical protein G933_03344 [Escherichia coli UMEA 3180-1] gb|EQX74280.1| hypothetical protein G936_03397 [Escherichia coli UMEA 3193-1] gb|EQX81580.1| hypothetical protein G937_03350 [Escherichia coli UMEA 3199-1] gb|EQY16064.1| hypothetical protein G943_03661 [Escherichia coli UMEA 3212-1] gb|EQY53894.1| hypothetical protein G953_03317 [Escherichia coli UMEA 3244-1] gb|EQY89295.1| hypothetical protein G964_00544 [Escherichia coli UMEA 3317-1] gb|EQY96660.1| hypothetical protein G967_03424 [Escherichia coli UMEA 3329-1] gb|EQY98576.1| hypothetical protein G965_03328 [Escherichia coli UMEA 3318-1] gb|EQZ33582.1| hypothetical protein G978_03583 [Escherichia coli UMEA 3592-1] gb|EQZ37659.1| hypothetical protein G979_03594 [Escherichia coli UMEA 3609-1] gb|ERA03542.1| hypothetical protein G995_03443 [Escherichia coli UMEA 3805-1] gb|ERA16377.1| hypothetical protein G998_03170 [Escherichia coli UMEA 3889-1] gb|ERA27444.1| hypothetical protein H001_05079 [Escherichia coli UMEA 3955-1] gb|ERA34935.1| hypothetical protein H002_03330 [Escherichia coli UMEA 4075-1] gb|ERA60786.1| hypothetical protein L668_07080 [Escherichia coli 95NR1] gb|ERA91488.1| hypothetical protein G877_03352 [Escherichia coli HVH 228 (4-7787030)] gb|ERA98627.1| hypothetical protein G878_03163 [Escherichia coli KOEGE 3 (4a)] gb|ERB03349.1| hypothetical protein G880_03480 [Escherichia coli KOEGE 10 (25a)] gb|ERB17058.1| hypothetical protein G919_03375 [Escherichia coli UMEA 3151-1] gb|ERB21432.1| hypothetical protein G918_00557 [Escherichia coli UMEA 3150-1] gb|ERB33288.1| hypothetical protein G960_03511 [Escherichia coli UMEA 3292-1] gb|ERC55140.1| phoP regulatory network YrbL family protein [Escherichia coli TW07509] gb|ERE09375.1| hypothetical protein L667_03815 [Escherichia coli 95JB1] gb|ERF97007.1| hypothetical protein CFSAN002237_06960 [Escherichia coli O104:H21 str. CFSAN002237] gb|AGX35179.1| yrbL [synthetic Escherichia coli C321.deltaA] gb|ERO92341.1| hypothetical protein L411_03807 [Escherichia coli BWH 24] gb|ESA31528.1| putative protein YrbL [Escherichia coli SCD1] gb|ESA92673.1| hypothetical protein HMPREF1601_01004 [Escherichia coli 907779] gb|ESC99553.1| hypothetical protein HMPREF1594_01505 [Escherichia coli 907446] gb|ESD06881.1| hypothetical protein HMPREF1596_04556 [Escherichia coli 907700] gb|ESD17677.1| hypothetical protein HMPREF1597_03946 [Escherichia coli 907701] gb|ESD59641.1| hypothetical protein HMPREF1607_02118 [Escherichia coli 908524] gb|ESE00415.1| hypothetical protein HMPREF1614_02250 [Escherichia coli 908624] gb|ESE07801.1| hypothetical protein HMPREF1615_02072 [Escherichia coli 908632] gb|ESE25077.1| hypothetical protein HMPREF1618_00660 [Escherichia coli 908691] gb|AGY85920.1| hypothetical protein P423_18000 [Escherichia coli JJ1886] gb|ESK04708.1| hypothetical protein G968_03211 [Escherichia coli UMEA 3336-1] gb|ESK15775.1| hypothetical protein G723_00916 [Escherichia coli HVH 50 (4-2593475)] gb|ESK25744.1| hypothetical protein G988_03013 [Escherichia coli UMEA 3693-1] gb|ESL20832.1| hypothetical protein L476_03301 [Escherichia coli BIDMC 39] gb|ESL34110.1| hypothetical protein L474_03287 [Escherichia coli BIDMC 37] gb|ESL34822.1| hypothetical protein L475_03489 [Escherichia coli BIDMC 38] gb|ESP34565.1| hypothetical protein G810_03120 [Escherichia coli HVH 152 (4-3447545)] gb|ESP42933.1| hypothetical protein G917_03409 [Escherichia coli UMEA 3148-1] emb|CDJ73656.1| hypothetical protein BN896_2909 [Escherichia coli str. K-12 substr. MC4100] gb|ESS96206.1| putative uncharacterized protein YrbL [Escherichia coli CE516] gb|ESS98509.1| putative uncharacterized protein YrbL [Escherichia coli CE549] gb|EST02563.1| putative uncharacterized protein YrbL [Escherichia coli CE418] gb|EST63274.1| hypothetical protein ECCZ_10130 [Escherichia coli ECC-Z] gb|EST75028.1| hypothetical protein ECA727_22194 [Escherichia coli ECA-727] gb|EST86377.1| hypothetical protein ECC1470_05285 [Escherichia coli ECC-1470] gb|EST88491.1| hypothetical protein ECA0157_03377 [Escherichia coli ECA-0157] gb|ETD58172.1| hypothetical protein Q459_08035 [Escherichia coli ATCC BAA-2215] gb|ETD65616.1| hypothetical protein Q458_00350 [Escherichia coli ATCC BAA-2209] gb|ETE25856.1| hypothetical protein V412_25065 [Escherichia coli LAU-EC7] gb|ETF16504.1| hypothetical protein G831_03092 [Escherichia coli HVH 177 (4-2876612)] gb|ETI76896.1| hypothetical protein Q457_12015 [Escherichia coli ATCC BAA-2196] gb|ETI77334.1| hypothetical protein Q460_11660 [Escherichia coli ATCC BAA-2219] gb|ETJ24065.1| hypothetical protein Q609_ECAC01450G0006 [Escherichia coli DORA_A_5_14_21] gb|ETJ57480.1| hypothetical protein Q456_0219040 [Escherichia coli ATCC BAA-2193] emb|CDK81933.1| Putative uncharacterized protein YrbL [Escherichia coli IS25] emb|CDK70727.1| Putative uncharacterized protein YrbL [Klebsiella pneumoniae IS22] emb|CDK56728.1| Putative uncharacterized protein YrbL [Escherichia coli IS9] emb|CDL06208.1| Putative uncharacterized protein YrbL [Escherichia coli IS35] emb|CDK90569.1| Putative uncharacterized protein YrbL [Escherichia coli IS29] gb|ETS27657.1| hypothetical protein N444_07485 [Escherichia coli O6:H16:CFA/II str. B2C] gb|ETX89021.1| hypothetical protein L456_03494 [Escherichia coli BIDMC 20B] gb|ETX93492.1| hypothetical protein L455_07795 [Escherichia coli BIDMC 20A] gb|ETY46698.1| hypothetical protein L404_03489 [Escherichia coli BWH 34] emb|CDL42545.1| Putative uncharacterized protein YrbL [Escherichia coli ISC41] gb|EWC56428.1| hypothetical protein G654_05485 [Escherichia coli EC096/10] gb|EYB43456.1| hypothetical protein BU69_21020 [Escherichia coli] gb|EYB46962.1| hypothetical protein BU68_25875 [Escherichia coli] gb|EYB50702.1| hypothetical protein BU65_17705 [Escherichia coli] gb|EYD81182.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S1_C1] gb|EYD82058.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S3_C1] gb|EYD95880.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S4_C3] gb|EYD97348.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S4_C2] gb|EYE19993.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S1_C3] gb|EYE33415.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S1_C1] gb|EYU73051.1| hypothetical protein BX60_23585 [Escherichia coli O111:NM str. 2010C-4221] gb|EYU78336.1| hypothetical protein BX62_06320 [Escherichia coli O121:H19 str. 2010C-4254] gb|EYU85917.1| hypothetical protein BX63_04140 [Escherichia coli O26:NM str. 2010C-4347] gb|EYU87151.1| hypothetical protein BX56_24470 [Escherichia coli O45:H2 str. 2010C-3876] gb|EYU90262.1| hypothetical protein BX59_19550 [Escherichia coli O111:NM str. 2010C-4086] gb|EYU92273.1| hypothetical protein BX58_18310 [Escherichia coli O111:NM str. 2010C-3977] gb|EYV01303.1| hypothetical protein BX54_08780 [Escherichia coli O121:H19 str. 2010C-3840] gb|EYV13753.1| hypothetical protein BX52_07790 [Escherichia coli O121:H19 str. 2010C-3609] gb|EYV63522.1| hypothetical protein BX40_23250 [Escherichia coli O103:H11 str. 2010C-3214] gb|EYV79248.1| hypothetical protein BX32_03685 [Escherichia coli O121:H19 str. 2009EL1412] gb|EYV81881.1| hypothetical protein BX25_05430 [Escherichia coli O121:H19 str. 2009C-4659] gb|EYV89369.1| hypothetical protein BY42_17500 [Escherichia coli O6:H16 str. 99-3165] gb|EYW91231.1| hypothetical protein BX03_07290 [Escherichia coli O111:NM str. 08-4487] gb|EYW97990.1| hypothetical protein BX00_21370 [Escherichia coli O118:H16 str. 08-3651] gb|EYX19411.1| hypothetical protein BW97_12160 [Escherichia coli O69:H11 str. 07-4281] gb|EYX75961.1| hypothetical protein BY07_06315 [Escherichia coli O111:NM str. 2011C-3679] gb|EYX78731.1| hypothetical protein BY05_09385 [Escherichia coli O111:NM str. 2011C-3632] gb|EYX86264.1| hypothetical protein BY08_14645 [Escherichia coli O103:H2 str. 2011C-3750] gb|EYX90840.1| hypothetical protein BY03_23170 [Escherichia coli O111:NM str. 2011C-3573] gb|EYX96398.1| hypothetical protein BY02_17005 [Escherichia coli O121:H19 str. 2011C-3537] gb|EYY09705.1| hypothetical protein BX97_25600 [Escherichia coli O111:NM str. 2011C-3362] gb|EYY11763.1| hypothetical protein BX93_23665 [Escherichia coli O111:NM str. 2011C-3170] gb|EYY12068.1| hypothetical protein BX94_13725 [Escherichia coli O121:H19 str. 2011C-3216] gb|EYY20578.1| hypothetical protein BX92_18905 [Escherichia coli O121:H19 str. 2011C-3108] gb|EYY26100.1| hypothetical protein BX91_10355 [Escherichia coli O121:H19 str. 2011C-3072] gb|EYY28450.1| hypothetical protein BX87_17310 [Escherichia coli O121:H19 str. 2010EL1058] gb|EYY37496.1| hypothetical protein BX84_17590 [Escherichia coli O121:H19 str. 2010C-4989] gb|EYY48219.1| hypothetical protein BX81_24980 [Escherichia coli O165:H25 str. 2010C-4874] gb|EYY48603.1| hypothetical protein BX82_19820 [Escherichia coli O121:H19 str. 2010C-4966] gb|EYY59282.1| hypothetical protein BX79_12550 [Escherichia coli O121:H19 str. 2010C-4824] gb|EYY63134.1| hypothetical protein BX77_20325 [Escherichia coli O111:NM str. 2010C-4818] gb|EYY64587.1| hypothetical protein BX76_21655 [Escherichia coli O111:NM str. 2010C-4799] gb|EYY73524.1| hypothetical protein BX74_19745 [Escherichia coli O111:NM str. 2010C-4746] gb|EYY78596.1| hypothetical protein BX75_19100 [Escherichia coli O26:NM str. 2010C-4788] gb|EYY82421.1| hypothetical protein BX73_19550 [Escherichia coli O111:NM str. 2010C-4735] gb|EYY91638.1| hypothetical protein BX72_03615 [Escherichia coli O121:H19 str. 2010C-4732] gb|EYY91729.1| hypothetical protein BX71_19720 [Escherichia coli O111:NM str. 2010C-4715] gb|EYZ01662.1| hypothetical protein BX70_23400 [Escherichia coli O111:NM str. 2010C-4622] gb|EYZ04852.1| hypothetical protein BX69_15990 [Escherichia coli O111:NM str. 2010C-4592] gb|EYZ24392.1| hypothetical protein BX65_10150 [Escherichia coli O103:H2 str. 2010C-4433] gb|EYZ49953.1| hypothetical protein BW93_04260 [Escherichia coli O121:H19 str. 06-3822] gb|EYZ61563.1| hypothetical protein BW88_01070 [Escherichia coli O79:H7 str. 06-3501] gb|EYZ65294.1| hypothetical protein BW90_16010 [Escherichia coli O118:H16 str. 06-3612] gb|EYZ83167.1| hypothetical protein BW82_14630 [Escherichia coli O111:NM str. 04-3211] gb|EYZ86398.1| hypothetical protein BW83_03690 [Escherichia coli O121:H19 str. 06-3003] gb|EYZ90728.1| hypothetical protein BW84_13685 [Escherichia coli O118:H16 str. 06-3256] gb|EYZ96644.1| hypothetical protein BW79_06340 [Escherichia coli O119:H4 str. 03-3458] gb|EZA03599.1| hypothetical protein BW80_15890 [Escherichia coli O111:NM str. 03-3484] gb|EZA08567.1| hypothetical protein BW77_16410 [Escherichia coli O121:H19 str. 03-3227] gb|EZA31708.1| hypothetical protein BW74_00450 [Escherichia coli O45:H2 str. 01-3147] gb|EZA36004.1| hypothetical protein BW70_06310 [Escherichia coli O174:H8 str. 04-3038] gb|EZA41017.1| hypothetical protein BW69_01955 [Escherichia coli O103:H11 str. 04-3023] gb|EZA42614.1| hypothetical protein BW68_13790 [Escherichia coli O26:H11 str. 05-3646] gb|EZA62961.1| hypothetical protein BY39_16230 [Escherichia coli O104:H21 str. 94-3025] gb|EZA63017.1| hypothetical protein BY39_16190 [Escherichia coli O104:H21 str. 94-3025] gb|EZA74399.1| hypothetical protein BY40_12895 [Escherichia coli O157:H16 str. 98-3133] gb|EZA77468.1| hypothetical protein BY43_08210 [Escherichia coli O25:NM str. E2539C1] gb|EZA78717.1| hypothetical protein BY44_10025 [Escherichia coli O6:H16 str. F5656C1] gb|EZA86356.1| hypothetical protein BY46_06185 [Escherichia coli O111:H8 str. F6627] gb|EZA92894.1| hypothetical protein BY47_13960 [Escherichia coli O121:H19 str. F6714] gb|EZC50486.1| hypothetical protein BY80_19555 [Escherichia coli O121:H19 str. K5198] gb|EZC53967.1| hypothetical protein BY81_16035 [Escherichia coli O121:H19 str. K5269] gb|EZD28431.1| hypothetical protein BY97_10095 [Escherichia coli O111:NM str. K6723] gb|EZD31998.1| hypothetical protein BY96_04340 [Escherichia coli O111:NM str. K6722] gb|EZD38517.1| hypothetical protein BY98_14005 [Escherichia coli O111:NM str. K6728] gb|EZD42459.1| hypothetical protein BY99_15740 [Escherichia coli O111:NM str. K6890] gb|EZD43111.1| hypothetical protein BZ00_16835 [Escherichia coli O111:NM str. K6895] gb|EZD55384.1| hypothetical protein BZ01_12905 [Escherichia coli O111:NM str. K6897] gb|EZD56316.1| hypothetical protein BZ02_09720 [Escherichia coli O111:NM str. K6898] gb|EZD61632.1| hypothetical protein BZ04_03325 [Escherichia coli O111:NM str. K6908] gb|EZD61731.1| hypothetical protein BZ03_08950 [Escherichia coli O111:NM str. K6904] gb|EZD71912.1| hypothetical protein BZ05_02450 [Escherichia coli O111:NM str. K6915] gb|EZD97843.1| hypothetical protein BX09_20965 [Escherichia coli O145:H28 str. 2009C-3292] gb|EZE02897.1| hypothetical protein BX08_15620 [Escherichia coli O103:H2 str. 2009C-3279] gb|EZE11161.1| hypothetical protein BX06_10040 [Escherichia coli O69:H11 str. 08-4661] gb|EZE13410.1| hypothetical protein BX10_20740 [Escherichia coli O121:H7 str. 2009C-3299] gb|EZE23143.1| hypothetical protein BX14_10240 [Escherichia coli O45:H2 str. 2009C-3686] gb|EZE24393.1| hypothetical protein BX12_18155 [Escherichia coli O69:H11 str. 2009C-3601] gb|EZE27361.1| hypothetical protein BX11_21605 [Escherichia coli O123:H11 str. 2009C-3307] gb|EZE41164.1| hypothetical protein BX18_11015 [Escherichia coli O111:NM str. 2009C-4006] gb|EZE43935.1| hypothetical protein BX19_12330 [Escherichia coli O121:H19 str. 2009C-4050] gb|EZE52385.1| hypothetical protein BX20_25875 [Escherichia coli O111:NM str. 2009C-4052] gb|EZE57912.1| hypothetical protein BX23_10420 [Escherichia coli O118:H16 str. 2009C-4446] gb|EZE65059.1| hypothetical protein BX29_19385 [Escherichia coli O45:H2 str. 2009C-4780] gb|EZE74943.1| hypothetical protein BX27_04580 [Escherichia coli O121:H19 str. 2009C-4750] gb|EZE80990.1| hypothetical protein BX31_18370 [Escherichia coli O121:H19 str. 2009EL1302] gb|EZE99454.1| hypothetical protein BX53_16985 [Escherichia coli O121:H19 str. 2010C-3794] gb|EZG33857.1| hypothetical protein AU10_23900 [Escherichia coli E1728] gb|EZG46313.1| hypothetical protein BW86_25995 [Escherichia coli O26:H11 str. 06-3464] gb|EZG48068.1| hypothetical protein BW81_22730 [Escherichia coli O26:H11 str. 03-3500] gb|EZG59282.1| hypothetical protein BX64_17380 [Escherichia coli O26:H11 str. 2010C-4430] gb|EZG60646.1| hypothetical protein BX78_22485 [Escherichia coli O26:H11 str. 2010C-4819] gb|EZG70785.1| hypothetical protein BX85_26735 [Escherichia coli O26:H11 str. 2010C-5028] gb|EZG81749.1| hypothetical protein BX88_18850 [Escherichia coli O26:H11 str. 2010EL-1699] gb|EZG87803.1| hypothetical protein BX95_11675 [Escherichia coli O26:H11 str. 2011C-3270] gb|EZG90315.1| hypothetical protein BY01_09910 [Escherichia coli O26:H11 str. 2011C-3506] gb|EZG94079.1| hypothetical protein BX98_19325 [Escherichia coli O26:H11 str. 2011C-3387] gb|EZH02539.1| hypothetical protein BX96_08055 [Escherichia coli O26:H11 str. 2011C-3282] gb|EZH07902.1| hypothetical protein BY06_23925 [Escherichia coli O26:H11 str. 2011C-3655] gb|EZH12787.1| hypothetical protein BX15_14380 [Escherichia coli O26:H11 str. 2009C-3689] gb|EZH15489.1| hypothetical protein BX13_14055 [Escherichia coli O26:H11 str. 2009C-3612] gb|EZH27881.1| hypothetical protein BX17_04710 [Escherichia coli O26:H11 str. 2009C-3996] gb|EZH29801.1| hypothetical protein BX28_13225 [Escherichia coli O26:H11 str. 2009C-4760] gb|EZH30539.1| hypothetical protein BX30_18205 [Escherichia coli O26:H11 str. 2009C-4826] gb|EZH40345.1| hypothetical protein BX38_08830 [Escherichia coli O26:H11 str. 2010C-3051] gb|EZH43778.1| hypothetical protein BX41_16965 [Escherichia coli O26:H11 str. 2010C-3472] gb|EZH50105.1| hypothetical protein BX55_18795 [Escherichia coli O26:H11 str. 2010C-3871] gb|EZH57405.1| hypothetical protein BX57_24825 [Escherichia coli O26:H11 str. 2010C-3902] gb|EZH58837.1| hypothetical protein BX61_08215 [Escherichia coli O26:H11 str. 2010C-4244] gb|EZJ18461.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S4_C3] gb|EZJ20978.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S4_C3] gb|EZJ27306.1| phoP regulatory network YrbL family protein [Escherichia coli 1-392-07_S4_C2] gb|EZJ34995.1| phoP regulatory network YrbL family protein [Escherichia coli 1-250-04_S4_C2] gb|EZJ40381.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S4_C2] gb|EZJ52424.1| phoP regulatory network YrbL family protein [Escherichia coli 1-250-04_S4_C1] gb|EZJ59896.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S4_C1] gb|EZJ67627.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S4_C1] gb|EZJ68329.1| phoP regulatory network YrbL family protein [Escherichia coli 1-392-07_S3_C3] gb|EZJ70463.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S3_C3] gb|EZJ81630.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S3_C2] gb|EZJ90374.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S3_C1] gb|EZJ94171.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S1_C3] gb|EZK06325.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S1_C3] gb|EZK12094.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S1_C3] gb|EZK16791.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S1_C2] gb|EZK28824.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S1_C1] gb|EZK29995.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S1_C2] gb|EZK41831.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S1_C1] gb|EZQ26729.1| hypothetical protein BX39_10200 [Escherichia coli O111:NM str. 2010C-3053] gb|EZQ38448.1| hypothetical protein BX21_16825 [Escherichia coli O111:H8 str. 2009C-4126] gb|EZQ51092.1| hypothetical protein BX99_00175 [Escherichia coli O111:H8 str. 2011C-3453] gb|EZQ57690.1| hypothetical protein AF56_02990 [Escherichia coli BIDMC 83] gb|KCW97773.1| hypothetical protein DP79_08580 [Escherichia coli] gb|KDA62124.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S1_C1] gb|KDA67038.1| phoP regulatory network YrbL family protein [Escherichia coli 1-182-04_S1_C2] gb|KDA83310.1| phoP regulatory network YrbL family protein [Escherichia coli 2-011-08_S3_C3] gb|KDA88665.1| phoP regulatory network YrbL family protein [Escherichia coli 1-176-05_S4_C2] emb|CDP73719.1| Putative uncharacterized protein yrbL [Escherichia coli] emb|CDP74986.1| Putative uncharacterized protein [Escherichia coli D6-117.29] gb|KDF65478.1| hypothetical protein AE34_03765 [Escherichia coli BIDMC 59] gb|KDF71874.1| hypothetical protein AE33_03491 [Escherichia coli BIDMC 58] gb|KDF84358.1| hypothetical protein AE37_02610 [Escherichia coli BIDMC 62] gb|KDF85213.1| hypothetical protein AE38_02106 [Escherichia coli BIDMC 63] gb|KDF90209.1| hypothetical protein AE39_03274 [Escherichia coli BIDMC 64] gb|KDF99757.1| hypothetical protein AE45_03144 [Escherichia coli BIDMC 70] gb|KDG20334.1| hypothetical protein AE49_02552 [Escherichia coli BIDMC 74] gb|KDG23567.1| hypothetical protein AE50_03636 [Escherichia coli BIDMC 75] gb|KDG26463.1| hypothetical protein AE51_03189 [Escherichia coli BIDMC 76] gb|KDG38862.1| hypothetical protein AE53_01349 [Escherichia coli BIDMC 78] gb|KDG43842.1| hypothetical protein AE54_03007 [Escherichia coli BIDMC 79] gb|KDG49259.1| hypothetical protein AF24_03499 [Escherichia coli CHS 68] gb|KDG58687.1| hypothetical protein AF25_01552 [Escherichia coli CHS 69] gb|KDG62174.1| hypothetical protein AF43_03656 [Escherichia coli MGH 57] gb|KDG69955.1| hypothetical protein AE10_03576 [Escherichia coli UCI 51] gb|KDG76702.1| hypothetical protein AE12_03101 [Escherichia coli UCI 53] gb|KDM74499.1| hypothetical protein DA88_03515 [Escherichia coli] gb|KDM89001.1| hypothetical protein DC22_16140 [Escherichia coli] gb|KDN04751.1| putative uncharacterized protein YrbL [Escherichia coli] emb|CDN83951.1| hypothetical protein EC958_3607 [Escherichia coli O25b:H4-ST131] gb|KDS97135.1| phoP regulatory network YrbL family protein [Escherichia coli 2-011-08_S3_C1] gb|KDS97814.1| phoP regulatory network YrbL family protein [Escherichia coli 2-011-08_S1_C3] gb|KDT11056.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S1_C3] gb|KDT17773.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S3_C1] gb|KDT34826.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S1_C1] gb|KDT38780.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S3_C1] gb|KDT45882.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S4_C2] gb|KDT48957.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S3_C2] gb|KDT68537.1| phoP regulatory network YrbL family protein [Escherichia coli 3-267-03_S3_C1] gb|KDT71950.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S3_C1] gb|KDT76141.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S3_C3] gb|KDT82230.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S1_C2] gb|KDT84262.1| phoP regulatory network YrbL family protein [Escherichia coli 3-475-03_S4_C1] gb|KDT93620.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S4_C1] gb|KDU13278.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S3_C2] gb|KDU17099.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S3_C3] gb|KDU32722.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S4_C2] gb|KDU40350.1| phoP regulatory network YrbL family protein [Escherichia coli 3-073-06_S4_C1] gb|KDU43201.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S1_C3] gb|KDU48216.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S1_C1] gb|KDU54091.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S4_C1] gb|KDU56960.1| phoP regulatory network YrbL family protein [Escherichia coli 3-475-03_S4_C2] gb|KDU63579.1| phoP regulatory network YrbL family protein [Escherichia coli 4-203-08_S1_C1] gb|KDV19023.1| hypothetical protein BW73_10310 [Escherichia coli O111:NM str. 01-3076] gb|KDV33753.1| hypothetical protein BU59_13995 [Escherichia coli O69:H11 str. 07-3763] gb|KDV36829.1| hypothetical protein BU56_09830 [Escherichia coli O145:H25 str. 07-3858] gb|KDV53631.1| hypothetical protein BU57_19265 [Escherichia coli O121:H19 str. 2011C-3609] gb|KDV58431.1| hypothetical protein BU54_10230 [Escherichia coli O45:H2 str. 2010C-4211] gb|KDV63423.1| hypothetical protein BU64_15185 [Escherichia coli O128:H2 str. 2011C-3317] gb|KDV68854.1| hypothetical protein BU58_16140 [Escherichia coli O26:H11 str. 2011C-3274] gb|KDV74512.1| hypothetical protein BU63_21510 [Escherichia coli O118:H16 str. 07-4255] gb|KDV80854.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S4_C2] gb|KDV81195.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S3_C3] gb|KDV83333.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S4_C3] gb|KDW00135.1| phoP regulatory network YrbL family protein [Escherichia coli 2-156-04_S1_C3] gb|KDW06287.1| phoP regulatory network YrbL family protein [Escherichia coli 2-156-04_S3_C3] gb|KDW14185.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S3_C1] gb|KDW16611.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S1_C1] gb|KDW17757.1| phoP regulatory network YrbL family protein [Escherichia coli 2-156-04_S4_C1] gb|KDW29700.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S1_C2] gb|KDW38988.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S1_C3] gb|KDW45390.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S4_C2] gb|KDW52227.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S1_C3] gb|KDW60049.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S3_C1] gb|KDW61465.1| phoP regulatory network YrbL family protein [Escherichia coli 1-392-07_S3_C2] gb|KDW69113.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S3_C3] gb|KDW86784.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S4_C1] gb|KDW93681.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S1_C2] gb|KDX04934.1| phoP regulatory network YrbL family protein [Escherichia coli 1-392-07_S3_C1] gb|KDX21933.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S3_C3] gb|KDX23947.1| phoP regulatory network YrbL family protein [Escherichia coli 2-156-04_S4_C2] gb|KDX47078.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S3_C2] gb|KDX52390.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S4_C1] gb|KDX56211.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S3_C1] gb|KDX88320.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S3_C3] gb|KDX94596.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S4_C2] gb|KDX95624.1| phoP regulatory network YrbL family protein [Escherichia coli 2-316-03_S3_C1] gb|KDY21887.1| phoP regulatory network YrbL family protein [Escherichia coli 2-316-03_S4_C3] gb|KDY41563.1| phoP regulatory network YrbL family protein [Escherichia coli 2-427-07_S4_C1] gb|KDY43858.1| phoP regulatory network YrbL family protein [Escherichia coli 2-427-07_S4_C2] gb|KDY53398.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S3_C1] gb|KDY62093.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S3_C2] gb|KDY65347.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S3_C3] gb|KDY71869.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S4_C2] gb|KDY78648.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S4_C3] gb|KDY81402.1| phoP regulatory network YrbL family protein [Escherichia coli 2-474-04_S1_C1] gb|KDZ01317.1| phoP regulatory network YrbL family protein [Escherichia coli 2-474-04_S1_C2] gb|KDZ26337.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S1_C1] gb|KDZ29108.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S1_C2] gb|KDZ35221.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S1_C3] gb|KDZ39088.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S3_C1] gb|KDZ86854.1| phoP regulatory network YrbL family protein [Escherichia coli 3-073-06_S4_C3] gb|KDZ88421.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S1_C2] gb|KDZ91061.1| phoP regulatory network YrbL family protein [Escherichia coli 3-105-05_S1_C3] gb|KEJ37979.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S1_C3] gb|KEJ48359.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S4_C1] gb|KEJ55313.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S4_C1] gb|KEJ66464.1| phoP regulatory network YrbL family protein [Escherichia coli 3-020-07_S3_C2] gb|KEJ72966.1| phoP regulatory network YrbL family protein [Escherichia coli 5-366-08_S1_C3] gb|KEJ75618.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S3_C2] gb|KEK89361.1| phoP regulatory network YrbL family protein [Escherichia coli 3-475-03_S3_C2] gb|KEK95066.1| phoP regulatory network YrbL family protein [Escherichia coli 4-203-08_S1_C2] gb|KEL01474.1| phoP regulatory network YrbL family protein [Escherichia coli 4-203-08_S1_C3] gb|KEL03917.1| phoP regulatory network YrbL family protein [Escherichia coli 4-203-08_S3_C3] gb|KEL15614.1| phoP regulatory network YrbL family protein [Escherichia coli 4-203-08_S3_C2] gb|KEL25564.1| phoP regulatory network YrbL family protein [Escherichia coli 5-172-05_S4_C2] gb|KEL28200.1| phoP regulatory network YrbL family protein [Escherichia coli 3-373-03_S4_C3] gb|KEL34949.1| phoP regulatory network YrbL family protein [Escherichia coli 5-366-08_S4_C2] gb|KEL37483.1| phoP regulatory network YrbL family protein [Escherichia coli 5-172-05_S4_C1] gb|KEL44585.1| phoP regulatory network YrbL family protein [Escherichia coli 5-172-05_S3_C3] gb|KEL60003.1| phoP regulatory network YrbL family protein [Escherichia coli 5-172-05_S4_C3] gb|KEL69431.1| phoP regulatory network YrbL family protein [Escherichia coli 5-366-08_S1_C1] gb|KEL90356.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S3_C1] gb|KEL99388.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S3_C3] gb|KEM03710.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S4_C2] gb|KEM05069.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S4_C1] gb|KEM19794.1| phoP regulatory network YrbL family protein [Escherichia coli 6-319-05_S3_C1] gb|KEM28438.1| phoP regulatory network YrbL family protein [Escherichia coli 6-319-05_S3_C2] gb|KEM30353.1| phoP regulatory network YrbL family protein [Escherichia coli 6-319-05_S4_C2] gb|KEM38694.1| phoP regulatory network YrbL family protein [Escherichia coli 6-537-08_S1_C1] gb|KEM46442.1| phoP regulatory network YrbL family protein [Escherichia coli 6-175-07_S4_C3] gb|KEM58727.1| phoP regulatory network YrbL family protein [Escherichia coli 6-319-05_S4_C3] gb|KEM59518.1| phoP regulatory network YrbL family protein [Escherichia coli 6-319-05_S3_C3] gb|KEM60970.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S1_C2] gb|KEM70642.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S3_C1] gb|KEM89577.1| phoP regulatory network YrbL family protein [Escherichia coli 6-537-08_S4_C1] gb|KEM99306.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S1_C3] gb|KEN01202.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S3_C3] gb|KEN11190.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S4_C2] gb|KEN22217.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S3_C2] gb|KEN22588.1| phoP regulatory network YrbL family protein [Escherichia coli 8-415-05_S1_C1] gb|KEN40354.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S4_C1] gb|KEN46346.1| phoP regulatory network YrbL family protein [Escherichia coli 6-537-08_S1_C2] gb|KEN53120.1| phoP regulatory network YrbL family protein [Escherichia coli 6-537-08_S1_C3] gb|KEN53566.1| phoP regulatory network YrbL family protein [Escherichia coli 7-233-03_S4_C3] gb|KEN61718.1| phoP regulatory network YrbL family protein [Escherichia coli 6-537-08_S4_C2] gb|KEN75523.1| phoP regulatory network YrbL family protein [Escherichia coli 2-052-05_S3_C2] gb|KEN87688.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S3_C1] gb|KEN95322.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S3_C2] gb|KEO07330.1| phoP regulatory network YrbL family protein [Escherichia coli 8-415-05_S1_C2] gb|KEO07842.1| phoP regulatory network YrbL family protein [Escherichia coli 2-177-06_S3_C3] gb|KEO14989.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S4_C3] gb|KEO22211.1| phoP regulatory network YrbL family protein [Escherichia coli 5-366-08_S4_C1] gb|KEO37456.1| phoP regulatory network YrbL family protein [Escherichia coli 2-460-02_S1_C2] gb|KEO96886.1| hypothetical protein EH66_01945 [Escherichia coli] gb|KEP09092.1| hypothetical protein EH62_04760 [Escherichia coli] gb|KEP16206.1| hypothetical protein EH63_10125 [Escherichia coli] gb|KEP77831.1| hypothetical protein AU08_0215290 [Escherichia coli E1140] gb|AIF38502.1| hypothetical protein HQ24_16500 [Escherichia coli KLY] gb|AIF63527.1| hypothetical protein L960_3704c [Escherichia coli B7A] emb|CDU40910.1| Putative uncharacterized protein yrbL [Escherichia coli] emb|CDW59050.1| YrbL-PhoP reg domain containing protein [Trichuris trichiura] gb|KFF38460.1| hypothetical protein BC97_0201665 [Escherichia coli] gb|KFF53311.1| hypothetical protein BC99_0303520 [Escherichia coli] gb|KFH78277.1| hypothetical protein GR04_13880 [Escherichia coli] gb|KFH84624.1| hypothetical protein GR05_06125 [Escherichia coli] gb|KFH91942.1| hypothetical protein GR06_06110 [Escherichia coli] gb|KFH98934.1| hypothetical protein GR02_13400 [Escherichia coli] gb|AIL37546.1| hypothetical protein SFy_4632 [Shigella flexneri 2003036] gb|AIL42493.1| hypothetical protein SFyv_4708 [Shigella flexneri Shi06HN006] emb|CEE06196.1| conserved hypothetical protein [Escherichia coli] gb|AIN33550.1| Mg(2+)-starvation-stimulated protein [Escherichia coli BW25113] gb|KFZ96868.1| phoP regulatory network YrbL family protein [Shigella flexneri] gb|KGA86409.1| hypothetical protein KV39_12490 [Escherichia coli] emb|CDY62150.1| predicted protein [Escherichia coli] emb|CDZ21988.1| predicted protein [Escherichia coli] gb|AIT36375.1| hypothetical protein LI75_19825 [Escherichia coli FAP1] gb|KGL70076.1| hypothetical protein L670_10352 [Escherichia coli NCTC 50110] gb|KGM62085.1| putative protein YrbL [Escherichia coli G3/10] gb|KGM66746.1| putative protein YrbL [Escherichia coli] gb|KGM71871.1| putative protein YrbL [Escherichia coli] gb|KGM75760.1| putative protein YrbL [Escherichia coli] gb|KGM84065.1| putative protein YrbL [Escherichia coli] gb|KGM85422.1| putative protein YrbL [Escherichia coli] gb|KGP09945.1| hypothetical protein JQ58_19410 [Escherichia coli] gb|KGP10042.1| hypothetical protein JQ57_17485 [Escherichia coli] gb|KGP20656.1| hypothetical protein JQ56_03230 [Escherichia coli] gb|KGP38044.1| hypothetical protein JQ59_19420 [Escherichia coli] gb|KGP47508.1| hypothetical protein LS89_18125 [Escherichia coli] gb|KGP50029.1| hypothetical protein LS90_18215 [Escherichia coli] gb|KGT04326.1| hypothetical protein GY32_19705 [Escherichia coli] gb|KGT12896.1| hypothetical protein JO89_13820 [Escherichia coli] gb|KGT17630.1| hypothetical protein JO90_19405 [Escherichia coli] gb|KGT21913.1| hypothetical protein JO87_04625 [Escherichia coli] gb|KGT27937.1| hypothetical protein JO88_05745 [Escherichia coli] gb|KGT32781.1| hypothetical protein JO86_03815 [Escherichia coli] emb|CDX08641.1| hypothetical protein,PhoP regulatory network protein YrbL [Shigella flexneri] gb|KHD42343.1| hypothetical protein LS39_07170 [Escherichia coli] gb|KHD46533.1| hypothetical protein LS40_22290 [Escherichia coli] gb|KHD54707.1| hypothetical protein LS41_01265 [Escherichia coli] gb|KHD56996.1| hypothetical protein LS42_14165 [Escherichia coli] gb|KHG73625.1| hypothetical protein PU77_12840 [Escherichia coli] gb|KHG76574.1| hypothetical protein PU76_21905 [Escherichia coli] gb|KHG86723.1| hypothetical protein PU74_18730 [Escherichia coli] gb|KHH01626.1| hypothetical protein PU72_02225 [Escherichia coli] gb|KHH10525.1| hypothetical protein PU69_05140 [Escherichia coli] gb|KHH13576.1| hypothetical protein PU67_20560 [Escherichia coli] gb|KHH20004.1| hypothetical protein PU68_05495 [Escherichia coli] gb|KHH29155.1| hypothetical protein PU62_11815 [Escherichia coli] gb|KHH32859.1| hypothetical protein PU61_09310 [Escherichia coli] gb|KHH46287.1| hypothetical protein PU58_12675 [Escherichia coli] gb|KHH51854.1| hypothetical protein PU56_16210 [Escherichia coli] gb|KHH58214.1| hypothetical protein PU55_21310 [Escherichia coli] gb|KHH70391.1| hypothetical protein PU52_12030 [Escherichia coli] gb|KHH93749.1| hypothetical protein PU46_13950 [Escherichia coli] gb|KHH94823.1| hypothetical protein PU47_02450 [Escherichia coli] gb|KHI11767.1| hypothetical protein PU43_00800 [Escherichia coli] gb|KHI13735.1| hypothetical protein PU40_19325 [Escherichia coli] gb|KHI13910.1| hypothetical protein PU36_17330 [Escherichia coli] gb|KHI44667.1| hypothetical protein PU27_17175 [Escherichia coli] gb|KHI56856.1| hypothetical protein PU26_15340 [Escherichia coli] gb|KHI66380.1| hypothetical protein PU20_17540 [Escherichia coli] gb|KHI73311.1| hypothetical protein PU19_07350 [Escherichia coli] gb|KHI84361.1| hypothetical protein PU18_05070 [Escherichia coli] gb|KHJ00174.1| hypothetical protein PU11_14930 [Escherichia coli] gb|KHJ07276.1| hypothetical protein PU08_13270 [Escherichia coli] gb|KHJ13760.1| hypothetical protein PU10_07345 [Escherichia coli] gb|KHJ16491.1| hypothetical protein PU06_19770 [Escherichia coli] gb|KHJ26151.1| hypothetical protein PU04_10770 [Escherichia coli] gb|AIZ29680.1| hypothetical protein ER2796_3301 [Escherichia coli ER2796] gb|AIZ53005.1| hypothetical protein ER3413_3301 [Escherichia coli K-12] gb|AIZ84269.1| hypothetical protein HW42_20885 [Escherichia coli] gb|AIZ88847.1| hypothetical protein HW43_20995 [Escherichia coli] gb|AIZ89783.1| hypothetical protein EO53_01735 [Escherichia coli str. K-12 substr. MG1655] emb|CEK07224.1| hypothetical protein ECO26H__610057 [Escherichia coli O26:H11] gb|AJB53240.1| hypothetical protein RR31_16820 [Escherichia coli] gb|KIG32375.1| hypothetical protein PU66_10330 [Escherichia coli] gb|KIG39180.1| hypothetical protein PU70_11270 [Escherichia coli] gb|KIG41299.1| hypothetical protein PU65_11995 [Escherichia coli] gb|KIG59526.1| hypothetical protein PU45_03840 [Escherichia coli] gb|KIG65412.1| hypothetical protein PU39_17690 [Escherichia coli] gb|KIG69903.1| hypothetical protein PU41_16200 [Escherichia coli] gb|KIG73325.1| hypothetical protein PU37_21400 [Escherichia coli] gb|KIG84245.1| hypothetical protein PU30_22035 [Escherichia coli] gb|KIH00484.1| hypothetical protein PU23_01620 [Escherichia coli] gb|KIH08206.1| hypothetical protein PU21_00585 [Escherichia coli] gb|KIH15830.1| hypothetical protein PU17_10625 [Escherichia coli] gb|KIH16064.1| hypothetical protein PU09_00735 [Escherichia coli] gb|KIH27884.1| hypothetical protein PU07_07340 [Escherichia coli] gb|KIH36573.1| hypothetical protein PD07_08280 [Escherichia coli] gb|AJF58026.1| Mg(2+)-starvation-stimulated protein [Escherichia coli 1303] gb|AJF78325.1| hypothetical protein TH69_16000 [Escherichia coli] gb|AJG10239.1| Mg(2+)-starvation-stimulated protein [Escherichia coli ECC-1470] gb|AJH11841.1| hypothetical protein SR36_15795 [Escherichia coli] gb|KIQ41575.1| hypothetical protein IY33_09005 [Escherichia coli] gb|KIQ46795.1| hypothetical protein IY32_08835 [Escherichia coli] gb|AJO85276.1| hypothetical protein SY51_18470 [Escherichia coli] gb|KIZ59088.1| hypothetical protein UH28_17850 [Escherichia coli] gb|KIZ60377.1| hypothetical protein UH34_19240 [Escherichia coli] gb|KIZ75019.1| hypothetical protein UH35_05290 [Escherichia coli] gb|KIZ77457.1| hypothetical protein UH32_13585 [Escherichia coli] gb|KIZ84142.1| hypothetical protein UH29_07585 [Escherichia coli] gb|KIZ86389.1| hypothetical protein UH37_18380 [Escherichia coli] gb|KIZ95333.1| hypothetical protein UH33_00035 [Escherichia coli] gb|KIZ98708.1| hypothetical protein UH36_05495 [Escherichia coli] gb|KJA04553.1| hypothetical protein UH27_01240 [Escherichia coli] gb|KJA07802.1| hypothetical protein UH30_04180 [Escherichia coli] gb|KJD93668.1| hypothetical protein LV67_01200 [Escherichia coli] gb|KJI03683.1| hypothetical protein UO94_13380 [Escherichia coli] gb|KJI11537.1| hypothetical protein UO92_08170 [Escherichia coli] gb|KJI24726.1| hypothetical protein UO95_10200 [Escherichia coli] gb|KJJ67741.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|KJW28377.1| hypothetical protein UN87_19455 [Escherichia coli] gb|KJW29269.1| hypothetical protein UN88_07265 [Escherichia coli] gb|KJW31409.1| hypothetical protein UN86_15300 [Escherichia coli] gb|KJW41873.1| hypothetical protein UN89_07570 [Escherichia coli] gb|KJW59893.1| hypothetical protein UN92_08755 [Escherichia coli] gb|KJW63998.1| hypothetical protein UN94_16010 [Escherichia coli] gb|KJW68770.1| hypothetical protein UN93_03095 [Escherichia coli] gb|KJW74982.1| hypothetical protein UN95_07035 [Escherichia coli] gb|KJY13358.1| hypothetical protein UC21_00560 [Escherichia coli] gb|AKA92389.1| uncharacterized protein YrbL [Escherichia coli VR50] emb|CQR82632.1| hypothetical protein b3207 [Escherichia coli K-12] gb|AKC14628.1| hypothetical protein VK74_19240 [Escherichia coli] gb|AKD62653.1| hypothetical protein SH05_20330 [Escherichia coli K-12] gb|AKD67027.1| hypothetical protein SH02_20285 [Escherichia coli K-12] gb|AKD71381.1| hypothetical protein SH08_20330 [Escherichia coli K-12] gb|AKD75747.1| hypothetical protein SH03_20225 [Escherichia coli K-12] gb|AKD80156.1| hypothetical protein SH06_20530 [Escherichia coli K-12] gb|AKD84525.1| hypothetical protein SH04_20215 [Escherichia coli K-12] gb|AKD88882.1| hypothetical protein SH07_20220 [Escherichia coli K-12] gb|AKD93312.1| hypothetical protein SF31_20560 [Escherichia coli K-12] gb|KKK00834.1| hypothetical protein CR63_16060 [Escherichia coli NB8] gb|KKO27472.1| hypothetical protein XA43_07940 [Escherichia coli] gb|KKO32442.1| hypothetical protein XA40_01625 [Escherichia coli] gb|KKO35096.1| hypothetical protein XA41_05600 [Escherichia coli] gb|KKO40367.1| hypothetical protein XA44_02720 [Escherichia coli] gb|AKF22403.1| hypothetical protein DP32_18895 [Escherichia coli] gb|AKF56980.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|AKF61120.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|AKF65258.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|AKF69398.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|AKF73537.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|KLD52556.1| hypothetical protein XB00_04070 [Escherichia coli] gb|KLG34299.1| hypothetical protein WQ65_04945 [Escherichia coli] gb|KLG37018.1| hypothetical protein WQ86_06020 [Escherichia coli] gb|KLG44663.1| hypothetical protein WQ92_04310 [Escherichia coli] gb|KLG47181.1| hypothetical protein WR16_06520 [Escherichia coli] gb|KLG54889.1| hypothetical protein WQ74_07180 [Escherichia coli] gb|KLG64048.1| hypothetical protein WQ95_03845 [Escherichia coli] gb|KLG67843.1| hypothetical protein WR00_11170 [Escherichia coli] gb|KLG88795.1| hypothetical protein WQ77_13035 [Escherichia coli] gb|KLG89799.1| hypothetical protein WR05_17195 [Escherichia coli] gb|KLH02005.1| hypothetical protein WR03_01035 [Escherichia coli] gb|KLH08651.1| hypothetical protein WQ88_09980 [Escherichia coli] gb|KLH15933.1| hypothetical protein WR23_04005 [Escherichia coli] gb|KLH16274.1| hypothetical protein WQ72_14870 [Escherichia coli] gb|KLH22287.1| hypothetical protein WR13_15860 [Escherichia coli] gb|KLH28177.1| hypothetical protein WR17_10695 [Escherichia coli] gb|KLH36941.1| hypothetical protein WQ69_11110 [Escherichia coli] gb|KLH44447.1| hypothetical protein WQ84_06980 [Escherichia coli] gb|KLH48907.1| hypothetical protein WQ99_16065 [Escherichia coli] gb|KLH51738.1| hypothetical protein WQ70_12585 [Escherichia coli] gb|KLH58535.1| hypothetical protein WQ64_13400 [Escherichia coli] gb|KLH68559.1| hypothetical protein WQ79_08240 [Escherichia coli] gb|KLH68977.1| hypothetical protein WQ73_12260 [Escherichia coli] gb|KLH92613.1| hypothetical protein WR18_16715 [Escherichia coli] gb|AKM36761.1| hypothetical protein PCN061_3295 [Escherichia coli PCN061] gb|KLU97481.1| hypothetical protein N621_04415 [Escherichia coli] gb|KLW97112.1| hypothetical protein SK64_03986 [Escherichia coli] gb|KLW97973.1| hypothetical protein SK67_05016 [Escherichia coli] gb|KLX02410.1| hypothetical protein SK65_02595 [Escherichia coli] gb|KLX21426.1| hypothetical protein SK70_03486 [Escherichia coli] gb|KLX27165.1| hypothetical protein SK72_03504 [Escherichia coli] gb|KLX31541.1| hypothetical protein SK71_03259 [Escherichia coli] gb|KLX34540.1| hypothetical protein SK73_03277 [Escherichia coli] gb|KLX53616.1| hypothetical protein SK77_03249 [Escherichia coli] gb|KLX58206.1| hypothetical protein SK78_02461 [Escherichia coli] gb|KLX62845.1| hypothetical protein SK74_03509 [Escherichia coli] gb|KLX74292.1| hypothetical protein SK81_03161 [Escherichia coli] gb|KLX86395.1| hypothetical protein SK84_03823 [Escherichia coli] gb|KLY06140.1| hypothetical protein SK86_02641 [Escherichia coli] gb|AKN49079.1| hypothetical protein TZ57_15865 [Escherichia coli] gb|AKO58670.1| hypothetical protein AA953_22875 [Escherichia coli] gb|AKP86188.1| hypothetical protein J444_3509 [Escherichia coli ACN001] emb|CEP56424.1| PhoP regulatory network protein YrbL [Shigella flexneri 2a] gb|KMV38477.1| hypothetical protein ACM16_17590 [Escherichia coli] gb|KMV43698.1| hypothetical protein ACM17_18155 [Escherichia coli] gb|KMV48520.1| hypothetical protein ACM19_17590 [Escherichia coli] gb|KMV57629.1| hypothetical protein ACM21_16085 [Escherichia coli] gb|AKR22021.1| hypothetical protein ADS71_16445 [Escherichia coli] gb|AKR26376.1| hypothetical protein ADZ27_16445 [Escherichia coli] gb|AKR30849.1| hypothetical protein ADZ28_16445 [Escherichia coli] gb|KNF19621.1| hypothetical protein WQ94_05830 [Escherichia coli] gb|KNF37768.1| hypothetical protein WR26_15415 [Escherichia coli] gb|KNF58690.1| hypothetical protein WQ98_12635 [Escherichia coli] gb|KNF63206.1| hypothetical protein WR15_24360 [Escherichia coli] gb|KNF65716.1| hypothetical protein WQ67_11395 [Escherichia coli] gb|KNF78694.1| hypothetical protein WQ83_00795 [Escherichia coli] gb|KNF81109.1| hypothetical protein WQ89_06560 [Escherichia coli] gb|KNF86796.1| hypothetical protein WQ78_07645 [Escherichia coli] gb|KNF90604.1| hypothetical protein WQ75_20675 [Escherichia coli] gb|KNF98368.1| hypothetical protein WR14_05155 [Escherichia coli] gb|KNG05499.1| hypothetical protein WQ90_23795 [Escherichia coli] gb|KNG15864.1| hypothetical protein WQ93_14920 [Escherichia coli] gb|KNG23770.1| hypothetical protein WQ97_13160 [Escherichia coli] gb|KNY54001.1| hypothetical protein AGA24_20330 [Escherichia coli] gb|KNY59308.1| hypothetical protein AGA22_20925 [Escherichia coli] gb|KNY66418.1| hypothetical protein AGA21_00320 [Escherichia coli] gb|KNY77712.1| hypothetical protein AGA26_04150 [Escherichia coli] gb|KNY89276.1| hypothetical protein AGA29_11420 [Escherichia coli] gb|KNZ00141.1| hypothetical protein AGA37_00680 [Escherichia coli] gb|KNZ05513.1| hypothetical protein AGA31_00990 [Escherichia coli] gb|KNZ09930.1| hypothetical protein AGA36_03205 [Escherichia coli] gb|KNZ13915.1| hypothetical protein AGA20_08920 [Escherichia coli] gb|KNZ28097.1| hypothetical protein AGA32_00330 [Escherichia coli] gb|KOA24386.1| hypothetical protein AC065_15415 [Escherichia coli] gb|KOA30722.1| hypothetical protein AC066_10495 [Escherichia coli] emb|CTX24221.1| protein [Escherichia coli] emb|CTX23990.1| protein [Escherichia coli] emb|CTW40739.1| protein [Escherichia coli] emb|CTW81263.1| protein [Escherichia coli] emb|CTR18144.1| protein [Escherichia coli] emb|CTR13948.1| protein [Escherichia coli] emb|CTU20460.1| protein [Escherichia coli] emb|CTU35948.1| protein [Escherichia coli] emb|CTR15586.1| protein [Escherichia coli] emb|CTU50328.1| protein [Escherichia coli] emb|CTR14120.1| protein [Escherichia coli] emb|CTU42175.1| protein [Escherichia coli] emb|CTU40291.1| protein [Escherichia coli] emb|CTU38112.1| protein [Escherichia coli] emb|CTT62277.1| protein [Escherichia coli] emb|CTT96584.1| protein [Escherichia coli] emb|CTV59417.1| protein [Escherichia coli] emb|CTR40170.1| protein [Escherichia coli] emb|CTR46162.1| protein [Escherichia coli] emb|CTV35874.1| protein [Escherichia coli] emb|CTW01373.1| protein [Escherichia coli] emb|CTT97109.1| protein [Escherichia coli] emb|CTR57043.1| protein [Escherichia coli] emb|CTR53404.1| protein [Escherichia coli] emb|CTT98967.1| protein [Escherichia coli] emb|CTV35768.1| protein [Escherichia coli] emb|CTU66106.1| protein [Escherichia coli] emb|CTS47983.1| protein [Escherichia coli] emb|CTR62452.1| protein [Escherichia coli] emb|CTV34088.1| protein [Escherichia coli] emb|CTV57189.1| protein [Escherichia coli] emb|CTW34419.1| protein [Escherichia coli] emb|CTS59433.1| protein [Escherichia coli] emb|CTU51182.1| protein [Escherichia coli] emb|CTS52023.1| protein [Escherichia coli] emb|CTS25065.1| protein [Escherichia coli] emb|CTS58628.1| protein [Escherichia coli] emb|CTS34219.1| protein [Escherichia coli] emb|CTW02077.1| protein [Escherichia coli] emb|CTV08020.1| protein [Escherichia coli] emb|CTR59464.1| protein [Escherichia coli] emb|CTT96021.1| protein [Escherichia coli] emb|CTV34047.1| protein [Escherichia coli] emb|CTS71337.1| protein [Escherichia coli] emb|CTU66667.1| protein [Escherichia coli] emb|CTR97737.1| protein [Escherichia coli] emb|CTU02430.1| protein [Escherichia coli] emb|CTS32631.1| protein [Escherichia coli] emb|CTW04607.1| protein [Escherichia coli] emb|CTS09456.1| protein [Escherichia coli] emb|CTT54781.1| protein [Escherichia coli] emb|CTV00486.1| protein [Escherichia coli] emb|CTU67532.1| protein [Escherichia coli] emb|CTV15843.1| protein [Escherichia coli] emb|CTT08583.1| protein [Escherichia coli] emb|CTV05612.1| protein [Escherichia coli] emb|CTR80001.1| protein [Escherichia coli] emb|CTS77216.1| protein [Escherichia coli] emb|CTV55388.1| protein [Escherichia coli] emb|CTT00269.1| protein [Escherichia coli] emb|CTV38740.1| protein [Escherichia coli] emb|CTW05237.1| protein [Escherichia coli] emb|CTR92142.1| protein [Escherichia coli] emb|CTT55523.1| protein [Escherichia coli] emb|CTU93240.1| protein [Escherichia coli] emb|CTS91600.1| protein [Escherichia coli] emb|CTW02046.1| protein [Escherichia coli] emb|CTV08570.1| protein [Escherichia coli] emb|CTV19842.1| protein [Escherichia coli] emb|CTS03840.1| protein [Escherichia coli] emb|CTV33509.1| protein [Escherichia coli] emb|CTS93066.1| protein [Escherichia coli] emb|CTS81023.1| protein [Escherichia coli] emb|CTV89786.1| protein [Escherichia coli] emb|CTU85598.1| protein [Escherichia coli] emb|CTR86802.1| protein [Escherichia coli] emb|CTU72726.1| protein [Escherichia coli] emb|CTU80038.1| protein [Escherichia coli] emb|CTU91031.1| protein [Escherichia coli] emb|CTV01098.1| protein [Escherichia coli] emb|CTS80183.1| protein [Escherichia coli] emb|CTT25470.1| protein [Escherichia coli] emb|CTX81185.1| protein [Escherichia coli] emb|CTY47230.1| protein [Escherichia coli] emb|CTZ29537.1| protein [Escherichia coli] emb|CTZ63600.1| protein [Escherichia coli] emb|CTY57333.1| protein [Escherichia coli] emb|CTZ55805.1| protein [Escherichia coli] emb|CTY42943.1| protein [Escherichia coli] emb|CTZ19659.1| protein [Escherichia coli] emb|CTY06106.1| protein [Escherichia coli] emb|CTY38034.1| protein [Escherichia coli] emb|CTX99149.1| protein [Escherichia coli] emb|CTX86060.1| protein [Escherichia coli] emb|CTX46783.1| protein [Escherichia coli] emb|CTY19633.1| protein [Escherichia coli] emb|CTZ14816.1| protein [Escherichia coli] emb|CTX58323.1| protein [Escherichia coli] emb|CTY86482.1| protein [Escherichia coli] emb|CTZ20724.1| protein [Escherichia coli] emb|CTZ18484.1| protein [Escherichia coli] emb|CTZ04044.1| protein [Escherichia coli] emb|CTZ02122.1| protein [Escherichia coli] emb|CTZ45037.1| protein [Escherichia coli] emb|CTY10408.1| protein [Escherichia coli] emb|CTY86205.1| protein [Escherichia coli] emb|CTY33056.1| protein [Escherichia coli] emb|CTZ50615.1| protein [Escherichia coli] emb|CTZ52616.1| protein [Escherichia coli] emb|CUA42448.1| protein [Escherichia coli] emb|CUA27707.1| protein [Escherichia coli] emb|CUA29829.1| protein [Escherichia coli] emb|CUA39145.1| protein [Escherichia coli] gb|KOR07045.1| hypothetical protein ABW50_01940 [Escherichia coli] gb|ALB33239.1| hypothetical protein SR35_16355 [Escherichia coli] emb|CUH57464.1| Mg(2+)-starvation-stimulated protein [Escherichia coli KRX] emb|CUJ87892.1| PhoP regulatory network protein YrbL [Achromobacter sp. ATCC35328] emb|CUQ98459.1| Putative uncharacterized protein YrbL [Escherichia coli] emb|CTX57473.1| protein [Escherichia coli] emb|CTX61741.1| protein [Escherichia coli] emb|CTX29041.1| protein [Escherichia coli] emb|CTX47982.1| protein [Escherichia coli] emb|CTX77693.1| protein [Escherichia coli] emb|CTX33264.1| protein [Escherichia coli] gb|ALI39104.1| hypothetical protein QQ24_06330 [Escherichia coli str. K-12 substr. MG1655] gb|ALI43504.1| hypothetical protein QR62_06335 [Escherichia coli] gb|ALI47900.1| hypothetical protein QR63_06335 [Escherichia coli] gb|KPO10644.1| hypothetical protein ACU57_14365 [Escherichia coli] gb|KPO14710.1| hypothetical protein ACU62_03155 [Escherichia coli] gb|KPO18199.1| hypothetical protein VM39_00575 [Escherichia coli] gb|KPO28336.1| hypothetical protein ACU70_20075 [Escherichia coli] gb|KPO29575.1| hypothetical protein ACU65_04580 [Escherichia coli] gb|KPO30168.1| hypothetical protein ACU75_23170 [Escherichia coli] gb|KPO54755.1| hypothetical protein ACU79_14400 [Escherichia coli] gb|KPO82522.1| hypothetical protein ACU91_07510 [Escherichia coli] gb|KPO83871.1| hypothetical protein ACU87_24370 [Escherichia coli] gb|KPO92164.1| hypothetical protein ACU88_21550 [Escherichia coli] gb|KPO95637.1| hypothetical protein ACU83_18620 [Escherichia coli] gb|KPQ49102.1| Uncharacterized protein YrbL [Escherichia coli TW10598] gb|ALJ95743.1| Mg(2+)-starvation-stimulated protein [Escherichia coli K-12] gb|ALJ96320.1| Mg(2+)-starvation-stimulated protein [Escherichia coli K-12] gb|KQB25788.1| hypothetical protein APV31_17570 [Escherichia coli] gb|KQI78357.1| hypothetical protein AM258_02115 [Escherichia coli] gb|KQI85182.1| hypothetical protein AM260_14845 [Escherichia coli] gb|KQI97560.1| hypothetical protein AM263_08545 [Escherichia coli] gb|KQJ10261.1| hypothetical protein AM265_06575 [Escherichia coli] gb|KQJ18863.1| hypothetical protein AM266_02735 [Escherichia coli] gb|KQJ25630.1| hypothetical protein AM268_05810 [Escherichia coli] gb|KQJ32102.1| hypothetical protein AM269_00825 [Escherichia coli] gb|KQJ35758.1| hypothetical protein AM271_00325 [Escherichia coli] gb|KQJ44042.1| hypothetical protein AM272_02290 [Escherichia coli] gb|ALL88688.1| hypothetical protein MJ49_14260 [Escherichia coli] gb|ALL95294.1| hypothetical protein AKK22_22485 [Escherichia coli] gb|KRR54531.1| hypothetical protein EC2732_06516 [Escherichia coli VL2732] gb|KRR62759.1| hypothetical protein EC2874_06025 [Escherichia coli VL2874] gb|ALN47272.1| hypothetical protein ASE18_14825 [Escherichia coli] gb|KRT18835.1| hypothetical protein ASU34_07490 [Escherichia coli] gb|KRV72838.1| hypothetical protein AO733_03070 [Escherichia coli] gb|KRV93275.1| hypothetical protein AO737_07320 [Escherichia coli] gb|KRV94722.1| hypothetical protein AO743_05515 [Escherichia coli] gb|KST26546.1| hypothetical protein APZ14_04375 [Escherichia coli] gb|KST34396.1| hypothetical protein APZ13_06545 [Escherichia coli] gb|ALQ57782.1| hypothetical protein AB850_04370 [Escherichia coli] gb|ALQ71200.1| hypothetical protein ATL78_00355 [Escherichia coli] gb|KSW84154.1| hypothetical protein APT75_20435 [Escherichia coli] gb|KSX78726.1| hypothetical protein APT93_17480 [Escherichia coli] gb|KSY23259.1| hypothetical protein APU01_13295 [Escherichia coli] gb|KSY67229.1| hypothetical protein APU07_11690 [Escherichia coli] gb|KSY84274.1| hypothetical protein APU13_10045 [Escherichia coli] gb|KSY93110.1| hypothetical protein APU12_08635 [Escherichia coli] gb|KSZ13638.1| hypothetical protein APU18_16320 [Escherichia coli] gb|ALT51099.1| hypothetical protein AUO99_14570 [Escherichia coli] gb|KUG76042.1| hypothetical protein ARC97_06140 [Escherichia coli] gb|KUG84140.1| hypothetical protein ARC90_14330 [Escherichia coli] gb|KUG86722.1| hypothetical protein ARC88_10230 [Escherichia coli] gb|KUG88937.1| hypothetical protein ARC95_08765 [Escherichia coli] gb|KUG99208.1| hypothetical protein ARC93_07445 [Escherichia coli] gb|KUH03129.1| hypothetical protein ARC82_12905 [Escherichia coli] gb|KUH09515.1| hypothetical protein ARC99_18090 [Escherichia coli] gb|KUH16316.1| hypothetical protein ARC94_14750 [Escherichia coli] gb|KUH27941.1| hypothetical protein ARC91_14180 [Escherichia coli] gb|ALX54109.1| hypothetical protein AVR67_18515 [Escherichia coli] gb|ALX59315.1| hypothetical protein AVR68_18540 [Escherichia coli] gb|ALX64142.1| hypothetical protein AVR73_19025 [Escherichia coli] gb|ALY14756.1| hypothetical protein ACN002_3298 [Escherichia coli] emb|CUW81556.1| hypothetical protein BN3204_320089 [Escherichia coli] gb|KUR84180.1| hypothetical protein AWE63_02870 [Escherichia coli] gb|KUS19605.1| hypothetical protein AWE59_06700 [Escherichia coli] gb|KUS34322.1| hypothetical protein AWE68_17960 [Escherichia coli] gb|KUS51497.1| hypothetical protein AWE72_18255 [Escherichia coli] gb|KUS64685.1| hypothetical protein AWE53_09995 [Escherichia coli] gb|KUS86392.1| hypothetical protein AWE74_13290 [Escherichia coli] gb|KUT26708.1| hypothetical protein AWE58_09740 [Escherichia coli] gb|KUT47442.1| hypothetical protein AWE99_00665 [Escherichia coli] gb|KUT53987.1| hypothetical protein AWF01_21955 [Escherichia coli] gb|KUT75866.1| hypothetical protein AWF06_02815 [Escherichia coli] gb|KUT85868.1| hypothetical protein AWF05_19395 [Escherichia coli] gb|KUT87253.1| hypothetical protein AWF07_22615 [Escherichia coli] gb|KUT87344.1| hypothetical protein AWF09_22065 [Escherichia coli] gb|KUT89359.1| hypothetical protein AWF08_11375 [Escherichia coli] gb|KUU22366.1| hypothetical protein AWF19_04275 [Escherichia coli] gb|KUU33425.1| hypothetical protein AWF17_24285 [Escherichia coli] gb|KUU49093.1| hypothetical protein AWF23_26270 [Escherichia coli] gb|KUU51838.1| hypothetical protein AWF21_02480 [Escherichia coli] gb|KUU63282.1| hypothetical protein AWF24_05745 [Escherichia coli] gb|KUU77942.1| hypothetical protein AWF32_13180 [Escherichia coli] gb|KUU78924.1| hypothetical protein AWF33_16860 [Escherichia coli] gb|KUV05893.1| hypothetical protein AWF38_20665 [Escherichia coli] gb|KUV12701.1| hypothetical protein AWF37_00945 [Escherichia coli] gb|KUV16898.1| hypothetical protein AWF39_09650 [Escherichia coli] gb|KUV20624.1| hypothetical protein AWF41_02655 [Escherichia coli] gb|KUV29430.1| hypothetical protein AWF42_11310 [Escherichia coli] gb|KUV39578.1| hypothetical protein AWF43_04800 [Escherichia coli] gb|KUV51145.1| hypothetical protein AWE91_25655 [Escherichia coli] gb|KUV57704.1| hypothetical protein AWE93_12925 [Escherichia coli] gb|KUV64513.1| hypothetical protein AWF46_03160 [Escherichia coli] gb|KUV74888.1| hypothetical protein AWF47_24470 [Escherichia coli] gb|KUV89299.1| hypothetical protein AWF49_24460 [Escherichia coli] gb|KUV96449.1| hypothetical protein AWF50_04845 [Escherichia coli] gb|KUW00804.1| hypothetical protein AWF52_07810 [Escherichia coli] gb|KUW01964.1| hypothetical protein AWF54_10920 [Escherichia coli] gb|KUW14052.1| hypothetical protein AWF58_21460 [Escherichia coli] gb|KUW31875.1| hypothetical protein AWF61_09735 [Escherichia coli] gb|KUW42448.1| hypothetical protein AWF63_12740 [Escherichia coli] gb|KUW44307.1| hypothetical protein AWF64_15330 [Escherichia coli] gb|KUW52552.1| hypothetical protein AWF65_24950 [Escherichia coli] gb|KUW57334.1| hypothetical protein AWF66_00845 [Escherichia coli] gb|KUW57496.1| hypothetical protein AWF68_03740 [Escherichia coli] gb|KUW64003.1| hypothetical protein AWF67_07970 [Escherichia coli] gb|KUW68809.1| hypothetical protein AWF70_19195 [Escherichia coli] gb|KUW73635.1| hypothetical protein AWF71_20335 [Escherichia coli] gb|KUW99693.1| hypothetical protein AWF76_20080 [Escherichia coli] gb|KUX05018.1| hypothetical protein AWF75_06970 [Escherichia coli] gb|KUX20940.1| hypothetical protein AWF79_08745 [Escherichia coli] gb|KUX37944.1| hypothetical protein AWF82_24970 [Escherichia coli] gb|KUX44766.1| hypothetical protein AWF83_06055 [Escherichia coli] gb|KUX48221.1| hypothetical protein AWF85_02900 [Escherichia coli] gb|KUX54722.1| hypothetical protein AWF86_23365 [Escherichia coli] gb|KUX57075.1| hypothetical protein AWF87_24145 [Escherichia coli] gb|KUX58175.1| hypothetical protein AWF88_01210 [Escherichia coli] gb|KUX74647.1| hypothetical protein AWF90_24520 [Escherichia coli] gb|KUX94265.1| hypothetical protein AWF95_06915 [Escherichia coli] gb|KUX94437.1| hypothetical protein AWF94_24900 [Escherichia coli] gb|KUY04094.1| hypothetical protein AWF96_01105 [Escherichia coli] gb|KUY04702.1| hypothetical protein AWF98_11485 [Escherichia coli] gb|KUY06490.1| hypothetical protein AWF97_06050 [Escherichia coli] gb|KUY10783.1| hypothetical protein AWF99_00820 [Escherichia coli] gb|KVI20492.1| hypothetical protein AWF84_09300 [Escherichia coli] gb|AMB52714.1| hypothetical protein AWB62_02060 [Escherichia coli] gb|AMC96102.1| hypothetical protein AW869_07645 [Escherichia coli str. K-12 substr. MG1655] gb|AMH23848.1| hypothetical protein C2566_19425 [Escherichia coli B] gb|AMH28165.1| hypothetical protein C3029_20045 [Escherichia coli B] gb|AMH31817.1| hypothetical protein DHB4_16235 [Escherichia coli K-12] gb|AMH36538.1| hypothetical protein C3026_17450 [Escherichia coli K-12] gb|KXG57226.1| hypothetical protein LT31_03774 [Escherichia coli] gb|KXG64389.1| hypothetical protein LT28_02797 [Escherichia coli] gb|KXG65659.1| hypothetical protein LT29_01290 [Escherichia coli] gb|KXG72177.1| hypothetical protein LT30_01232 [Escherichia coli] gb|AMF90159.1| protein YrbL [Escherichia coli] gb|KXH93525.1| hypothetical protein AXE67_19255 [Escherichia coli] gb|KXH97053.1| hypothetical protein AXE66_16225 [Escherichia coli] gb|KXI01119.1| hypothetical protein AXE68_16245 [Escherichia coli] gb|KXI09462.1| hypothetical protein AXE69_06435 [Escherichia coli] emb|CUW22798.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|AML00297.1| hypothetical protein AWN69_09790 [Escherichia coli str. K-12 substr. MG1655] gb|AML06468.1| hypothetical protein AVR74_17605 [Escherichia coli] gb|AML11148.1| hypothetical protein AVR75_16765 [Escherichia coli] gb|AML16161.1| hypothetical protein AVR72_18535 [Escherichia coli] gb|AML21098.1| hypothetical protein AVR69_18370 [Escherichia coli] gb|KXK77867.1| hypothetical protein AUS13_17815 [Escherichia coli] gb|KXK80120.1| hypothetical protein AUS52_15860 [Escherichia coli] gb|KXK88228.1| hypothetical protein AUS51_05445 [Escherichia coli] gb|KXL09213.1| hypothetical protein AXH16_23280 [Escherichia coli] gb|KXL35531.1| hypothetical protein AXH10_20345 [Escherichia coli] gb|KXL59071.1| hypothetical protein AUS26_18180 [Escherichia coli] gb|KXL62273.1| hypothetical protein AUS22_12400 [Escherichia coli] gb|KXL69554.1| hypothetical protein AUS12_04835 [Escherichia coli] gb|KXL79909.1| hypothetical protein AUS15_15805 [Escherichia coli] gb|KXL80059.1| hypothetical protein AUS48_09445 [Escherichia coli] gb|KXL83416.1| hypothetical protein AUS14_07410 [Escherichia coli] gb|KXL91916.1| hypothetical protein AUS16_11085 [Escherichia coli] gb|KXL95347.1| hypothetical protein AUS49_19785 [Escherichia coli] gb|KXL95575.1| hypothetical protein AUS17_01360 [Escherichia coli] gb|KXM05505.1| hypothetical protein AUS19_02825 [Escherichia coli] gb|KXM11494.1| hypothetical protein AUS50_00345 [Escherichia coli] gb|KXM21058.1| hypothetical protein AUS20_01535 [Escherichia coli] gb|KXM29245.1| hypothetical protein AUS21_07220 [Escherichia coli] gb|KXM30731.1| hypothetical protein AUS25_05745 [Escherichia coli] gb|KXM44532.1| hypothetical protein AUS23_04345 [Escherichia coli] gb|KXM46720.1| hypothetical protein AUS29_06660 [Escherichia coli] gb|KXM49799.1| hypothetical protein AUS28_06680 [Escherichia coli] gb|KXM51572.1| hypothetical protein AUS30_01045 [Escherichia coli] gb|KXM59383.1| hypothetical protein AUS32_00590 [Escherichia coli] gb|KXM65245.1| hypothetical protein AUS33_02790 [Escherichia coli] gb|KXM69234.1| hypothetical protein AUS34_19120 [Escherichia coli] gb|KXM80409.1| hypothetical protein AUS31_02830 [Escherichia coli] gb|KXM83657.1| hypothetical protein AUS41_22285 [Escherichia coli] gb|KXN06167.1| hypothetical protein AUS38_09680 [Escherichia coli] gb|KXN13624.1| hypothetical protein AUS46_03750 [Escherichia coli] gb|KXN15343.1| hypothetical protein AUS47_03985 [Escherichia coli] gb|KXN18962.1| hypothetical protein AUS45_16335 [Escherichia coli] gb|KXN28055.1| hypothetical protein AUS40_07165 [Escherichia coli] gb|KXN28665.1| hypothetical protein AUS18_07495 [Escherichia coli] gb|KXN43560.1| hypothetical protein AUS53_08305 [Escherichia coli] gb|KXN49832.1| hypothetical protein AUS43_02720 [Escherichia coli] gb|KXN50223.1| hypothetical protein AUS44_08930 [Escherichia coli] gb|KXN53105.1| hypothetical protein AUS42_19620 [Escherichia coli] gb|KXN55481.1| hypothetical protein AUS27_01220 [Escherichia coli] gb|KXP21919.1| hypothetical protein AUQ36_14210 [Escherichia coli] gb|KXP22465.1| hypothetical protein AUP76_06940 [Escherichia coli] gb|KXP34522.1| hypothetical protein AUQ35_11830 [Escherichia coli] gb|KXP37052.1| hypothetical protein AUP97_16985 [Escherichia coli] gb|KXP37715.1| hypothetical protein AUP79_04000 [Escherichia coli] gb|KXP48981.1| hypothetical protein AUQ30_03640 [Escherichia coli] gb|KXP53412.1| hypothetical protein AUQ19_10075 [Escherichia coli] gb|KXP54116.1| hypothetical protein AUQ34_06005 [Escherichia coli] gb|KXP59501.1| hypothetical protein AUP86_07395 [Escherichia coli] gb|KXP67598.1| hypothetical protein AUP84_00970 [Escherichia coli] gb|KXP70258.1| hypothetical protein AUP82_06925 [Escherichia coli] gb|KXP77902.1| hypothetical protein AUP83_06255 [Escherichia coli] gb|KXP81614.1| hypothetical protein AUP77_17470 [Escherichia coli] gb|KXP87683.1| hypothetical protein AUP78_02215 [Escherichia coli] gb|KXQ02310.1| hypothetical protein AUP90_03315 [Escherichia coli] gb|KXQ04902.1| hypothetical protein AUP87_03245 [Escherichia coli] gb|KXQ09832.1| hypothetical protein AUP96_14640 [Escherichia coli] gb|KXQ10086.1| hypothetical protein AUP98_07570 [Escherichia coli] gb|KXQ23038.1| hypothetical protein AUP95_02115 [Escherichia coli] gb|KXQ23167.1| hypothetical protein AUP92_03075 [Escherichia coli] gb|KXQ25642.1| hypothetical protein AUP94_13375 [Escherichia coli] gb|KXQ38357.1| hypothetical protein AUP88_02395 [Escherichia coli] gb|KXQ41502.1| hypothetical protein AUQ01_05175 [Escherichia coli] gb|KXQ45707.1| hypothetical protein AUP89_11780 [Escherichia coli] gb|KXQ46720.1| hypothetical protein AUP93_15900 [Escherichia coli] gb|KXQ56928.1| hypothetical protein AUQ04_06055 [Escherichia coli] gb|KXQ59498.1| hypothetical protein AUQ09_10225 [Escherichia coli] gb|KXQ60764.1| hypothetical protein AUQ07_15650 [Escherichia coli] gb|KXQ67543.1| hypothetical protein AUQ00_08785 [Escherichia coli] gb|KXQ72439.1| hypothetical protein AUQ10_09640 [Escherichia coli] gb|KXQ76544.1| hypothetical protein AUP99_13195 [Escherichia coli] gb|KXQ79725.1| hypothetical protein AUQ18_13890 [Escherichia coli] gb|KXQ82969.1| hypothetical protein AUQ02_15780 [Escherichia coli] gb|KXQ90575.1| hypothetical protein AUQ06_11515 [Escherichia coli] gb|KXQ94626.1| hypothetical protein AUQ17_18625 [Escherichia coli] gb|KXR02246.1| hypothetical protein AUQ05_03125 [Escherichia coli] gb|KXR05672.1| hypothetical protein AUQ14_11495 [Escherichia coli] gb|KXR08856.1| hypothetical protein AUQ15_12075 [Escherichia coli] gb|KXR12933.1| hypothetical protein AUQ12_07790 [Escherichia coli] gb|KXR19263.1| hypothetical protein AUQ16_12075 [Escherichia coli] gb|KXR24481.1| hypothetical protein AUQ21_07605 [Escherichia coli] gb|KXR26404.1| hypothetical protein AUQ20_19735 [Escherichia coli] gb|KXR33407.1| hypothetical protein AUQ22_13275 [Escherichia coli] gb|KXR44277.1| hypothetical protein AUQ27_06345 [Escherichia coli] gb|KXR49902.1| hypothetical protein AUQ31_01730 [Escherichia coli] gb|KXR51585.1| hypothetical protein AUQ26_09825 [Escherichia coli] gb|KXR59999.1| hypothetical protein AUQ28_16205 [Escherichia coli] gb|KXR70006.1| hypothetical protein AUQ33_15665 [Escherichia coli] gb|KXR73925.1| hypothetical protein AUQ23_09045 [Escherichia coli] gb|KXR81623.1| hypothetical protein AUQ25_11860 [Escherichia coli] gb|KXR83654.1| hypothetical protein AUQ29_13860 [Escherichia coli] gb|KXR88180.1| hypothetical protein AUP80_07330 [Escherichia coli] gb|KXR94057.1| hypothetical protein AUQ13_03155 [Escherichia coli] gb|KXS00199.1| hypothetical protein AUP91_03410 [Escherichia coli] gb|KXS01439.1| hypothetical protein AUP81_05140 [Escherichia coli] gb|AMM38155.1| hypothetical protein AVR76_18245 [Escherichia coli] gb|AMM77775.1| hypothetical protein AOT98_08230 [Shigella flexneri 1a] emb|CUU95407.1| hypothetical protein HMVEC_590149 [Escherichia coli] gb|AMN59527.1| hypothetical protein AD867_18440 [Shigella flexneri 2a] gb|AMN64364.1| hypothetical protein AD871_18640 [Shigella flexneri 4c] gb|KXU67202.1| hypothetical protein AWN71_13470 [Escherichia coli] gb|KXU69495.1| hypothetical protein AWN70_10650 [Escherichia coli] gb|KXU77717.1| hypothetical protein AWN72_21890 [Escherichia coli] emb|CUX83024.1| hypothetical protein BN3564_40760 [Escherichia coli] gb|AMQ53024.1| hypothetical protein AX202_18645 [Escherichia coli JJ1887] gb|AMR24734.1| hypothetical protein A0259_19785 [Shigella sp. PAMC 28760] gb|KYL38652.1| hypothetical protein ECEG1_17135 [Escherichia coli] gb|KYN59902.1| hypothetical protein AZ620_15685 [Escherichia coli] gb|KYN60992.1| hypothetical protein AZ625_14220 [Escherichia coli] gb|KYO69798.1| hypothetical protein LT27_02036 [Escherichia coli] gb|KYO74122.1| hypothetical protein LT26_00380 [Escherichia coli] gb|KYR04535.1| hypothetical protein AML00_24580 [Escherichia coli] gb|KYR05403.1| hypothetical protein AMK98_25170 [Escherichia coli] gb|KYR11120.1| hypothetical protein AMK99_15340 [Escherichia coli] gb|KYR26404.1| hypothetical protein AML03_20025 [Escherichia coli] gb|KYR32631.1| hypothetical protein AML01_00810 [Escherichia coli] gb|KYR40894.1| hypothetical protein AML04_12560 [Escherichia coli] gb|KYR49006.1| hypothetical protein AML07_19420 [Escherichia coli] gb|KYR58357.1| hypothetical protein AML09_20225 [Escherichia coli] gb|KYR88407.1| hypothetical protein AML14_18330 [Escherichia coli] gb|KYR95643.1| hypothetical protein AML16_13715 [Escherichia coli] gb|KYS12205.1| hypothetical protein AML20_25690 [Escherichia coli] gb|KYS21431.1| hypothetical protein AML19_01545 [Escherichia coli] gb|KYS24838.1| hypothetical protein AML21_12550 [Escherichia coli] gb|KYS35865.1| hypothetical protein AML24_15130 [Escherichia coli] gb|KYS38774.1| hypothetical protein AML23_16695 [Escherichia coli] gb|KYS58000.1| hypothetical protein AML26_00950 [Escherichia coli] gb|KYS67380.1| hypothetical protein AML30_13575 [Escherichia coli] gb|KYS67487.1| hypothetical protein AML32_25010 [Escherichia coli] gb|KYS96148.1| hypothetical protein AML40_10140 [Escherichia coli] gb|KYT05329.1| hypothetical protein AML42_21635 [Escherichia coli] gb|KYT16925.1| hypothetical protein AML44_05090 [Escherichia coli] gb|KYT23702.1| hypothetical protein AML47_22035 [Escherichia coli] gb|KYT38681.1| hypothetical protein AML29_02930 [Escherichia coli] gb|KYT54481.1| hypothetical protein AML45_08505 [Escherichia coli] gb|KYT63059.1| hypothetical protein AML50_16950 [Escherichia coli] gb|KYT72141.1| hypothetical protein AML54_08270 [Escherichia coli] gb|KYT84294.1| hypothetical protein AML78_17275 [Escherichia coli] gb|KYT87176.1| hypothetical protein AML64_09595 [Escherichia coli] gb|KYU08266.1| hypothetical protein AML58_05115 [Escherichia coli] gb|KYU15967.1| hypothetical protein AML57_00700 [Escherichia coli] gb|KYU37569.1| hypothetical protein AML62_04500 [Escherichia coli] gb|KYU40123.1| hypothetical protein AML63_12265 [Escherichia coli] gb|KYU42594.1| hypothetical protein AML65_13655 [Escherichia coli] gb|KYU54771.1| hypothetical protein AML68_22170 [Escherichia coli] gb|KYU69218.1| hypothetical protein AML74_15220 [Escherichia coli] gb|KYU85989.1| hypothetical protein AML75_03655 [Escherichia coli] gb|KYU91546.1| hypothetical protein AML77_10395 [Escherichia coli] gb|KYU99426.1| hypothetical protein AML80_14890 [Escherichia coli] gb|KYV09756.1| hypothetical protein AML81_10440 [Escherichia coli] gb|KYV31736.1| hypothetical protein AMK77_14635 [Escherichia coli] gb|KYV37266.1| hypothetical protein AML39_04955 [Escherichia coli] gb|KYV45611.1| hypothetical protein AMK79_17825 [Escherichia coli] gb|KYV72936.1| hypothetical protein AMK83_06260 [Escherichia coli] gb|KYV84080.1| hypothetical protein AMK85_10030 [Escherichia coli] gb|KYV89702.1| hypothetical protein AMK87_06990 [Escherichia coli] gb|KYV92613.1| hypothetical protein AMK86_05610 [Escherichia coli] gb|KYW01698.1| hypothetical protein AMK89_14220 [Escherichia coli] gb|KYW02992.1| hypothetical protein AMK88_08200 [Escherichia coli] gb|KYW09909.1| hypothetical protein AMK91_15225 [Escherichia coli] gb|KYW12654.1| hypothetical protein AMK90_02920 [Escherichia coli] gb|KYW22952.1| hypothetical protein AMK92_16960 [Escherichia coli] gb|KYW24655.1| hypothetical protein AMK94_19005 [Escherichia coli] gb|KYW30017.1| hypothetical protein AMK95_16105 [Escherichia coli] gb|KYW67765.1| hypothetical protein AML86_04495 [Escherichia coli] gb|AMU83787.1| hypothetical protein Y979_17225 [Escherichia coli str. Sanji] gb|AMX14112.1| hypothetical protein A4X18_11720 [Escherichia coli] gb|AMX30781.1| hypothetical protein A4R39_11110 [Escherichia coli] gb|AMX34687.1| hypothetical protein A4R38_05785 [Escherichia coli] gb|AMX41244.1| hypothetical protein A4R37_15420 [Escherichia coli] gb|KZH10718.1| hypothetical protein AWG42_13535 [Escherichia coli] gb|KZH12001.1| hypothetical protein AWG44_04245 [Escherichia coli] gb|KZH16220.1| hypothetical protein AWG35_24860 [Escherichia coli] gb|KZH20259.1| hypothetical protein AWG33_15975 [Escherichia coli] gb|KZH42695.1| hypothetical protein AWG54_03870 [Escherichia coli] gb|KZH42877.1| hypothetical protein AWG37_14440 [Escherichia coli] gb|KZH50715.1| hypothetical protein AWG57_01240 [Escherichia coli] gb|KZH76139.1| hypothetical protein AWG52_14225 [Escherichia coli] gb|KZH86751.1| hypothetical protein AWG59_15575 [Escherichia coli] gb|KZH92053.1| hypothetical protein AWG56_13695 [Escherichia coli] gb|KZH94944.1| hypothetical protein AWG61_04285 [Escherichia coli] gb|KZH96696.1| hypothetical protein AWG58_08455 [Escherichia coli] gb|KZI13211.1| hypothetical protein AWG67_22795 [Escherichia coli] gb|KZI34990.1| hypothetical protein AWG66_08155 [Escherichia coli] gb|KZI49164.1| hypothetical protein AWG72_22230 [Escherichia coli] gb|KZI63061.1| hypothetical protein AWG65_08560 [Escherichia coli] gb|KZI65164.1| hypothetical protein AWG70_02100 [Escherichia coli] gb|KZI72140.1| hypothetical protein AWG69_11130 [Escherichia coli] gb|KZI83356.1| hypothetical protein AWG76_18995 [Escherichia coli] gb|KZI89697.1| hypothetical protein AWG81_00125 [Escherichia coli] gb|KZI97597.1| hypothetical protein AWG85_19375 [Escherichia coli] gb|KZJ03344.1| hypothetical protein AWG84_16055 [Escherichia coli] gb|KZJ03746.1| hypothetical protein AWG89_20535 [Escherichia coli] gb|KZJ04512.1| hypothetical protein AWG93_13015 [Escherichia coli] gb|KZJ18853.1| hypothetical protein AWG73_09045 [Escherichia coli] gb|KZJ20152.1| hypothetical protein AWG79_20055 [Escherichia coli] gb|KZJ32830.1| hypothetical protein AWG83_26205 [Escherichia coli] gb|KZJ33655.1| hypothetical protein AWG87_13945 [Escherichia coli] gb|KZJ34633.1| hypothetical protein AWG80_04490 [Escherichia coli] gb|KZJ41136.1| hypothetical protein AWG82_04260 [Escherichia coli] gb|KZJ47752.1| hypothetical protein AWG92_16285 [Escherichia coli] gb|KZJ60566.1| hypothetical protein AWG86_03655 [Escherichia coli] gb|KZJ78997.1| hypothetical protein AWG91_09295 [Escherichia coli] gb|KZJ88654.1| hypothetical protein AWG96_18405 [Escherichia coli] gb|KZO66749.1| hypothetical protein AAW07_14410 [Escherichia coli] gb|KZO71601.1| hypothetical protein AAW09_09410 [Escherichia coli] gb|KZO79889.1| hypothetical protein AAW05_07400 [Escherichia coli] gb|KZO87133.1| hypothetical protein TH55_09950 [Escherichia coli] gb|KZO87779.1| hypothetical protein TH54_00270 [Escherichia coli] gb|KZP39433.1| hypothetical protein XF29_14370 [Escherichia coli] gb|OAC01617.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC02899.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC10873.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC12176.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC19071.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC22744.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC24087.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC33826.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC39905.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAC42792.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|OAE56929.1| hypothetical protein A7J46_15670 [Escherichia coli] gb|OAE73540.1| hypothetical protein A7J65_09300 [Escherichia coli] gb|OAF22857.1| hypothetical protein AVR70_14375 [Escherichia coli] gb|OAF36188.1| hypothetical protein AXK32_14950 [Escherichia coli] gb|OAF38701.1| hypothetical protein AXK30_17840 [Escherichia coli] gb|OAF92122.1| hypothetical protein PPECC9_31300 [Escherichia coli PCN009] gb|OAI32875.1| hypothetical protein A6M24_06730 [Escherichia coli] gb|ANE59532.1| hypothetical protein A5956_07225 [Escherichia coli] gb|OAM48245.1| hypothetical protein A6732_16135 [Escherichia coli] gb|OAO53924.1| hypothetical protein OO98_14645 [Escherichia coli] gb|OAO67151.1| hypothetical protein OO97_00325 [Escherichia coli] gb|OAO73287.1| hypothetical protein OK10_14520 [Escherichia coli] gb|OAP68297.1| hypothetical protein A8A56_14210 [Escherichia coli] gb|OAR95824.1| hypothetical protein AYO03_01950 [Escherichia coli] gb|OAS06891.1| hypothetical protein AYO07_10295 [Escherichia coli] gb|OAV61944.1| hypothetical protein A6I93_02860 [Escherichia coli] gb|OAY13330.1| hypothetical protein A9Y77_10030 [Escherichia coli] gb|ANK03678.1| yrbL [Escherichia coli O25b:H4] gb|ANK07760.1| hypothetical protein A9X67_02640 [Escherichia coli] emb|CTQ83642.1| hypothetical protein ECOLI_370279 [Escherichia coli] gb|ANK50335.1| hypothetical protein WM90_00205 [Escherichia coli] gb|ANM83993.1| hypothetical protein A8V37_16390 [Escherichia coli] gb|OBU90807.1| hypothetical protein AWH50_015220 [Escherichia coli] gb|ANO91130.1| hypothetical protein GJ11_20890 [Escherichia coli] gb|ANP09218.1| hypothetical protein CP48_19580 [Escherichia coli] gb|ANP34172.1| hypothetical protein AB847_20670 [Escherichia coli] gb|ANO28186.1| hypothetical protein BAY41_04535 [Escherichia coli] emb|SCA73067.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|OCK71202.1| hypothetical protein BBZ58_16030 [Escherichia coli] gb|OCO55193.1| hypothetical protein AN669_0214170 [Escherichia coli] gb|OCQ14854.1| hypothetical protein AGA39_12990 [Escherichia coli] gb|OCQ33368.1| hypothetical protein A6I95_18220 [Escherichia coli] gb|OCS82155.1| hypothetical protein BBZ54_16710 [Escherichia coli] gb|OCT08291.1| hypothetical protein ECO37_19615 [Escherichia coli] gb|OCW50686.1| hypothetical protein BEI66_16130 [Escherichia coli] gb|OCW80154.1| hypothetical protein A8R19_03790 [Escherichia coli] gb|ODA85394.1| hypothetical protein A9D65_08005 [Escherichia coli] gb|ODB43314.1| hypothetical protein A9J90_19625 [Escherichia coli] gb|ODH28947.1| hypothetical protein A6803_16200 [Escherichia coli] gb|ODJ16442.1| hypothetical protein BFR10_02285 [Shigella sp. FC1180] gb|ODJ17401.1| hypothetical protein BFR09_01895 [Shigella sp. FC1172] gb|ODJ40609.1| hypothetical protein A6I97_16010 [Escherichia coli] gb|AOM43588.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|AOM56167.1| hypothetical protein BCV59_17575 [Escherichia coli] gb|AOM59722.1| hypothetical protein CFSAN004177_08985 [Escherichia coli] gb|AOO71418.1| hypothetical protein NEB5A_16385 [Escherichia coli] gb|AOR21432.1| hypothetical protein BBP24_20305 [Escherichia coli] gb|OEI04679.1| hypothetical protein A9R46_18745 [Escherichia coli] gb|OEI06653.1| hypothetical protein A9R45_17575 [Escherichia coli] gb|OEI11320.1| hypothetical protein A9R47_05605 [Escherichia coli] gb|OEI16405.1| hypothetical protein A9R48_19920 [Escherichia coli] gb|OEI26041.1| hypothetical protein A9R49_12365 [Escherichia coli] gb|OEI31484.1| hypothetical protein A9R44_21670 [Escherichia coli] gb|OEI36318.1| hypothetical protein A9R50_17685 [Escherichia coli] gb|OEI44105.1| hypothetical protein A9R51_04275 [Escherichia coli] gb|OEI59113.1| hypothetical protein A9R56_09995 [Escherichia coli] gb|OEI63008.1| hypothetical protein A9R57_12520 [Escherichia coli] gb|OEL44759.1| hypothetical protein BHF05_03545 [Escherichia coli] gb|OEL46196.1| hypothetical protein BHF06_13510 [Escherichia coli] gb|OEL60555.1| hypothetical protein BHF08_05715 [Escherichia coli] gb|OEL65283.1| hypothetical protein BHF11_20690 [Escherichia coli] gb|OEL80459.1| hypothetical protein BHF13_20040 [Escherichia coli] gb|OEM22500.1| hypothetical protein BHF22_08925 [Escherichia coli] gb|OEM36123.1| hypothetical protein BHF26_20595 [Escherichia coli] gb|OEM43641.1| hypothetical protein BHF25_06560 [Escherichia coli] gb|OEM60098.1| hypothetical protein BHF29_02510 [Escherichia coli] gb|OEM66231.1| hypothetical protein BHF31_13410 [Escherichia coli] gb|OEM86531.1| hypothetical protein BHF36_22760 [Escherichia coli] gb|OEM99867.1| hypothetical protein BHF39_18300 [Escherichia coli] gb|OEN05146.1| hypothetical protein BHF38_03255 [Escherichia coli] gb|OEN14774.1| hypothetical protein BHF41_09725 [Escherichia coli] gb|OEN35849.1| hypothetical protein BHF44_18165 [Escherichia coli] gb|OEN45208.1| hypothetical protein BHF47_00440 [Escherichia coli] gb|OEN47466.1| hypothetical protein BHF48_15520 [Escherichia coli] gb|OEN55301.1| hypothetical protein BHF49_08440 [Escherichia coli] gb|OEN72323.1| hypothetical protein BHF54_17875 [Escherichia coli] gb|OEN79414.1| hypothetical protein BHF53_08515 [Escherichia coli] gb|OEN86526.1| hypothetical protein BHF55_02705 [Escherichia coli] gb|OEN89168.1| hypothetical protein BHF56_00685 [Escherichia coli] gb|OEO11993.1| hypothetical protein BHF61_06650 [Escherichia coli] gb|AOT31071.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|OFE30092.1| hypothetical protein BBJ27_19490 [Escherichia coli] emb|SDO36698.1| PhoP regulatory network protein YrbL [Shigella sonnei] gb|OHW33404.1| hypothetical protein BKL90_20090 [Escherichia coli] gb|APA24745.1| hypothetical protein ATO45_04755 [Escherichia coli] gb|OII55365.1| hypothetical protein BFX01_07650 [Escherichia coli] gb|OII91269.1| hypothetical protein BHE99_06675 [Escherichia coli] gb|OII93177.1| hypothetical protein BHE98_06350 [Escherichia coli] gb|OII96711.1| hypothetical protein BHF02_07090 [Escherichia coli] gb|OIJ07973.1| hypothetical protein BHF01_07010 [Escherichia coli] emb|SCQ10065.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|APC53366.1| hypothetical protein BL257_16130 [Escherichia coli str. K-12 substr. W3110] gb|OIZ65276.1| hypothetical protein BJI68_19235 [Escherichia coli] gb|OJF88959.1| hypothetical protein AQF51_11860 [Escherichia coli] gb|APE54943.1| hypothetical protein BSG22_17170 [Escherichia coli] gb|APE59894.1| hypothetical protein BSG21_17200 [Escherichia coli] gb|APE64773.1| hypothetical protein BSG23_17205 [Escherichia coli] gb|APE69609.1| hypothetical protein BSG24_17175 [Escherichia coli] gb|APE90313.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|OJH22264.1| hypothetical protein ECNA114_019255 [Escherichia coli NA114] gb|APG34947.1| hypothetical protein BLJ80_09330 [Escherichia coli] gb|OJK86281.1| hypothetical protein BK250_06745 [Escherichia coli] gb|OJK93895.1| hypothetical protein BK252_04300 [Escherichia coli] gb|OJK95523.1| hypothetical protein BK251_12220 [Escherichia coli] gb|OJL03817.1| hypothetical protein BK255_20675 [Escherichia coli] gb|OJL07672.1| hypothetical protein BK254_04515 [Escherichia coli] gb|OJL08169.1| hypothetical protein BK253_07635 [Escherichia coli] gb|OJL19719.1| hypothetical protein BK256_07760 [Escherichia coli] gb|OJL23278.1| hypothetical protein BK258_09700 [Escherichia coli] gb|OJL30178.1| hypothetical protein BK257_00620 [Escherichia coli] gb|OJL50878.1| hypothetical protein BK264_02235 [Escherichia coli] gb|OJL59208.1| hypothetical protein BK261_00865 [Escherichia coli] gb|OJL74867.1| hypothetical protein BK269_09130 [Escherichia coli] gb|OJL79127.1| hypothetical protein BK268_09670 [Escherichia coli] gb|OJL92261.1| hypothetical protein BK271_21140 [Escherichia coli] gb|OJL98271.1| hypothetical protein BK272_03790 [Escherichia coli] gb|OJM07242.1| hypothetical protein BK273_10680 [Escherichia coli] gb|OJM15527.1| hypothetical protein BK276_16750 [Escherichia coli] gb|OJM25363.1| hypothetical protein BK275_01035 [Escherichia coli] gb|OJM32079.1| hypothetical protein BK280_18985 [Escherichia coli] gb|OJM35618.1| hypothetical protein BK279_11225 [Escherichia coli] gb|OJM37899.1| hypothetical protein BK278_07910 [Escherichia coli] gb|OJM48925.1| hypothetical protein BK281_07895 [Escherichia coli] gb|OJM53081.1| hypothetical protein BK282_03575 [Escherichia coli] gb|OJM54439.1| hypothetical protein BK283_15710 [Escherichia coli] gb|OJM59406.1| hypothetical protein BK284_21490 [Escherichia coli] gb|OJM74406.1| hypothetical protein BK286_03740 [Escherichia coli] gb|OJM75205.1| hypothetical protein BK288_20080 [Escherichia coli] gb|OJM77902.1| hypothetical protein BK287_08310 [Escherichia coli] gb|OJM90615.1| hypothetical protein BK291_13320 [Escherichia coli] gb|OJM95745.1| hypothetical protein BK292_10140 [Escherichia coli] gb|OJN00948.1| hypothetical protein BK293_15010 [Escherichia coli] gb|OJN07841.1| hypothetical protein BK295_15845 [Escherichia coli] gb|OJN13139.1| hypothetical protein BK294_01070 [Escherichia coli] gb|OJN16734.1| hypothetical protein BK296_13130 [Escherichia coli] gb|OJN18812.1| hypothetical protein BK298_23145 [Escherichia coli] gb|OJN31043.1| hypothetical protein BK299_10300 [Escherichia coli] gb|OJN31406.1| hypothetical protein BK297_07180 [Escherichia coli] gb|OJN37529.1| hypothetical protein BK300_11340 [Escherichia coli] gb|OJN48694.1| hypothetical protein BK301_05355 [Escherichia coli] gb|OJN49778.1| hypothetical protein BK302_01560 [Escherichia coli] gb|OJN51486.1| hypothetical protein BK303_18705 [Escherichia coli] gb|OJN52491.1| hypothetical protein BK304_22600 [Escherichia coli] gb|OJN56781.1| hypothetical protein BK305_21235 [Escherichia coli] gb|OJN65092.1| hypothetical protein BK306_16365 [Escherichia coli] gb|OJN74015.1| hypothetical protein BK309_23165 [Escherichia coli] gb|OJN74941.1| hypothetical protein BK307_07525 [Escherichia coli] gb|OJN83440.1| hypothetical protein BK290_13890 [Escherichia coli] gb|OJN88060.1| hypothetical protein BK310_16515 [Escherichia coli] gb|OJN97961.1| hypothetical protein BK311_10145 [Escherichia coli] gb|OJN99302.1| hypothetical protein BK308_08925 [Escherichia coli] gb|OJO05227.1| hypothetical protein BK312_10180 [Escherichia coli] gb|OJO09760.1| hypothetical protein BK313_12470 [Escherichia coli] gb|OJO19185.1| hypothetical protein BK314_06825 [Escherichia coli] gb|OJO23992.1| hypothetical protein BK315_03135 [Escherichia coli] gb|OJO24364.1| hypothetical protein BK316_13205 [Escherichia coli] gb|OJO30838.1| hypothetical protein BK318_18880 [Escherichia coli] gb|OJO35902.1| hypothetical protein BK317_00470 [Escherichia coli] gb|OJO42520.1| hypothetical protein BK320_18735 [Escherichia coli] gb|OJO48976.1| hypothetical protein BK321_18145 [Escherichia coli] gb|OJO59808.1| hypothetical protein BK323_09685 [Escherichia coli] gb|OJO69421.1| hypothetical protein BK324_03185 [Escherichia coli] gb|OJO73649.1| hypothetical protein BK325_03455 [Escherichia coli] gb|OJO77480.1| hypothetical protein BK327_15210 [Escherichia coli] gb|OJO80736.1| hypothetical protein BK326_02145 [Escherichia coli] gb|OJO89306.1| hypothetical protein BK330_08865 [Escherichia coli] gb|OJO93588.1| hypothetical protein BK328_03015 [Escherichia coli] gb|OJO94716.1| hypothetical protein BK329_03625 [Escherichia coli] gb|OJO97204.1| hypothetical protein BK331_17615 [Escherichia coli] gb|OJP09341.1| hypothetical protein BK332_04435 [Escherichia coli] gb|OJP17355.1| hypothetical protein BK336_18115 [Escherichia coli] gb|OJP25118.1| hypothetical protein BK337_21800 [Escherichia coli] gb|OJP36578.1| hypothetical protein BK338_03740 [Escherichia coli] gb|OJP40507.1| hypothetical protein BK339_00500 [Escherichia coli] gb|OJP44767.1| hypothetical protein BK340_11375 [Escherichia coli] gb|OJP44929.1| hypothetical protein BK342_16355 [Escherichia coli] gb|OJP53039.1| hypothetical protein BK341_10805 [Escherichia coli] gb|OJP58654.1| hypothetical protein BK343_09630 [Escherichia coli] gb|OJP64489.1| hypothetical protein BK344_07260 [Escherichia coli] gb|OJP70390.1| hypothetical protein BK345_07260 [Escherichia coli] gb|OJP74128.1| hypothetical protein BK346_04700 [Escherichia coli] gb|OJP79304.1| hypothetical protein BK347_02255 [Escherichia coli] gb|OJP82439.1| hypothetical protein BK348_07215 [Escherichia coli] gb|OJQ01470.1| hypothetical protein BK352_02050 [Escherichia coli] gb|OJQ02844.1| hypothetical protein BK354_22380 [Escherichia coli] gb|OJQ15323.1| hypothetical protein BK353_01455 [Escherichia coli] gb|OJQ18896.1| hypothetical protein BK356_18410 [Escherichia coli] gb|OJQ24749.1| hypothetical protein BK357_14765 [Escherichia coli] gb|OJQ30670.1| hypothetical protein BK358_13700 [Escherichia coli] gb|OJQ35109.1| hypothetical protein BK359_15525 [Escherichia coli] gb|OJQ41302.1| hypothetical protein BK360_07920 [Escherichia coli] gb|OJQ48867.1| hypothetical protein BK361_10375 [Escherichia coli] gb|OJQ52424.1| hypothetical protein BK363_03240 [Escherichia coli] gb|OJQ55882.1| hypothetical protein BK362_08340 [Escherichia coli] gb|OJQ58706.1| hypothetical protein BK365_18505 [Escherichia coli] gb|OJQ66199.1| hypothetical protein BK366_22220 [Escherichia coli] gb|OJQ66800.1| hypothetical protein BK364_03330 [Escherichia coli] gb|OJQ75709.1| hypothetical protein BK368_16015 [Escherichia coli] gb|OJQ76156.1| hypothetical protein BK367_12120 [Escherichia coli] gb|OJQ86307.1| hypothetical protein BK369_06140 [Escherichia coli] gb|OJQ89351.1| hypothetical protein BK370_10615 [Escherichia coli] gb|OJQ94322.1| hypothetical protein BK371_10710 [Escherichia coli] gb|OJQ99212.1| hypothetical protein BK372_10940 [Escherichia coli] gb|OJR04849.1| hypothetical protein BK373_10095 [Escherichia coli] gb|OJR09453.1| hypothetical protein BK374_08540 [Escherichia coli] gb|OJR23088.1| hypothetical protein BK376_11820 [Escherichia coli] gb|OJR23395.1| hypothetical protein BK377_04690 [Escherichia coli] gb|OJR30561.1| hypothetical protein BK378_16300 [Escherichia coli] gb|OJR37657.1| hypothetical protein BK379_00765 [Escherichia coli] gb|OJR41249.1| hypothetical protein BK380_01215 [Escherichia coli] gb|OJR54006.1| hypothetical protein BK383_16045 [Escherichia coli] gb|OJR62006.1| hypothetical protein BK385_05620 [Escherichia coli] gb|OJR73289.1| hypothetical protein BK384_02185 [Escherichia coli] gb|OJR81918.1| hypothetical protein BK389_07450 [Escherichia coli] gb|OJR84596.1| hypothetical protein BK390_18000 [Escherichia coli] gb|OJR90602.1| hypothetical protein BK387_19825 [Escherichia coli] gb|OJR92278.1| hypothetical protein BK392_17790 [Escherichia coli] gb|OJS01221.1| hypothetical protein BK391_13275 [Escherichia coli] gb|OJS06757.1| hypothetical protein BK394_19165 [Escherichia coli] gb|OJS14251.1| hypothetical protein BK395_01600 [Escherichia coli] gb|OJS21508.1| hypothetical protein BK398_14875 [Escherichia coli] gb|OJS29955.1| hypothetical protein BK397_06500 [Escherichia coli] gb|OJS30693.1| hypothetical protein BK396_06110 [Escherichia coli] gb|OJS34103.1| hypothetical protein BK401_22365 [Escherichia coli] gb|OJS48194.1| hypothetical protein BK403_20225 [Escherichia coli] gb|OJS59020.1| hypothetical protein BK404_15395 [Escherichia coli] gb|OJS61779.1| hypothetical protein BK405_01355 [Escherichia coli] gb|OJS72087.1| hypothetical protein BK406_13875 [Escherichia coli] gb|OJS79721.1| hypothetical protein BK408_02320 [Escherichia coli] gb|OJS92129.1| hypothetical protein BK409_02775 [Escherichia coli] gb|OJZ35682.1| hypothetical protein BSO19_07345 [Escherichia coli] gb|APJ63953.1| hypothetical protein RG25_20105 [Escherichia coli] gb|APJ66792.1| hypothetical protein RG26_10880 [Escherichia coli] gb|APJ83815.1| hypothetical protein RG30_19730 [Escherichia coli] gb|APJ85596.1| hypothetical protein RG31_03265 [Escherichia coli] gb|APJ89688.1| hypothetical protein RG32_01560 [Escherichia coli] gb|APJ96691.1| hypothetical protein RG33_14330 [Escherichia coli] gb|APK01983.1| hypothetical protein RG34_15455 [Escherichia coli] gb|APK04803.1| hypothetical protein RG35_03645 [Escherichia coli] gb|APK12510.1| hypothetical protein RG36_20495 [Escherichia coli] gb|APK17156.1| hypothetical protein RG37_18655 [Escherichia coli] gb|APK25577.1| hypothetical protein RG39_13045 [Escherichia coli] gb|APK30433.1| hypothetical protein RG40_14280 [Escherichia coli] gb|APK36650.1| hypothetical protein RG41_23620 [Escherichia coli] gb|APK40728.1| hypothetical protein RG42_19475 [Escherichia coli] gb|APK42264.1| hypothetical protein RG43_02765 [Escherichia coli] gb|APK51975.1| hypothetical protein RG45_04000 [Escherichia coli] gb|APK72237.1| hypothetical protein RG49_17240 [Escherichia coli] gb|APK75094.1| hypothetical protein RG50_08170 [Escherichia coli] gb|APK81479.1| hypothetical protein RG51_16330 [Escherichia coli] gb|APK90427.1| hypothetical protein RG53_15750 [Escherichia coli] gb|APL08655.1| hypothetical protein RG57_10095 [Escherichia coli] gb|APL18343.1| hypothetical protein RG59_09570 [Escherichia coli] gb|APL33291.1| hypothetical protein RG62_11125 [Escherichia coli] gb|APL61445.1| hypothetical protein RG68_13055 [Escherichia coli] gb|APL71961.1| hypothetical protein RG70_16235 [Escherichia coli] gb|APL79510.1| hypothetical protein RG72_06865 [Escherichia coli] gb|APL85055.1| hypothetical protein RG29_10840 [Escherichia coli] gb|APL88889.1| hypothetical protein RG73_03305 [Escherichia coli] gb|APL51887.1| hypothetical protein RG66_10435 [Escherichia coli] gb|OKA62276.1| hypothetical protein BHL56_21935 [Escherichia coli] gb|OKB70572.1| hypothetical protein BMT49_25515 [Escherichia coli] gb|OKL78704.1| yrbLprotein [Escherichia coli] gb|OKO60195.1| hypothetical protein BSF34_17845 [Escherichia coli] gb|OKS99419.1| hypothetical protein ACN58_13335 [Escherichia coli] gb|OKS99812.1| hypothetical protein ACN54_16925 [Escherichia coli] gb|OKT08447.1| hypothetical protein ACN55_09435 [Escherichia coli] gb|OKT16266.1| hypothetical protein ACN59_15680 [Escherichia coli] gb|OKT19976.1| hypothetical protein ACN57_24355 [Escherichia coli] gb|OKT28043.1| hypothetical protein ACN66_19535 [Escherichia coli] gb|OKT35690.1| hypothetical protein ACN62_04850 [Escherichia coli] gb|OKT44965.1| hypothetical protein ACN60_14415 [Escherichia coli] gb|OKT45823.1| hypothetical protein ACN63_05415 [Escherichia coli] gb|OKT53865.1| hypothetical protein ACN64_14745 [Escherichia coli] gb|OKT57757.1| hypothetical protein ACN73_20535 [Escherichia coli] gb|OKT73066.1| hypothetical protein ACN67_18225 [Escherichia coli] gb|OKT89342.1| hypothetical protein ACN75_13540 [Escherichia coli] gb|OKT89952.1| hypothetical protein ACN70_10095 [Escherichia coli] gb|OKU04976.1| hypothetical protein ACN80_09635 [Escherichia coli] gb|OKU07650.1| hypothetical protein ACN74_09580 [Escherichia coli] gb|OKU33605.1| hypothetical protein ACN79_22270 [Escherichia coli] gb|OKU64184.1| hypothetical protein ACN88_13105 [Escherichia coli] gb|OKU78377.1| hypothetical protein AWP48_09925 [Escherichia coli] gb|OKU80786.1| hypothetical protein AWP45_00575 [Escherichia coli] gb|OKU81189.1| hypothetical protein AWJ24_09295 [Escherichia coli] gb|OKU87029.1| hypothetical protein AWP50_08865 [Escherichia coli] gb|OKU89485.1| hypothetical protein AWP46_25680 [Escherichia coli] gb|OKV09255.1| hypothetical protein AWP51_27055 [Escherichia coli] gb|OKV12169.1| hypothetical protein AWP52_13000 [Escherichia coli] gb|OKV48664.1| hypothetical protein AWP58_12435 [Escherichia coli] gb|OKV65991.1| hypothetical protein AWP61_12010 [Escherichia coli] gb|OKV73232.1| hypothetical protein AWP57_06950 [Escherichia coli] gb|OKV76375.1| hypothetical protein AWP64_28785 [Escherichia coli] gb|OKV99879.1| hypothetical protein AWP65_13605 [Escherichia coli] gb|OKW05033.1| hypothetical protein AWP68_13195 [Escherichia coli] gb|OKW31871.1| hypothetical protein AWP77_25785 [Escherichia coli] gb|OKW50711.1| hypothetical protein AWP76_21800 [Escherichia coli] gb|OKW56185.1| hypothetical protein AWP83_26075 [Escherichia coli] gb|OKW57919.1| hypothetical protein AWP73_22980 [Escherichia coli] gb|OKW66607.1| hypothetical protein AWP82_18150 [Escherichia coli] gb|OKW78069.1| hypothetical protein AWP81_25595 [Escherichia coli] gb|OKW92289.1| hypothetical protein AWP88_10420 [Escherichia coli] gb|OKX01036.1| hypothetical protein AWP87_06390 [Escherichia coli] gb|OKX04121.1| hypothetical protein AWP89_21195 [Escherichia coli] gb|OKX08960.1| hypothetical protein AWP93_20690 [Escherichia coli] gb|OKX14285.1| hypothetical protein AWP86_19955 [Escherichia coli] gb|OKX24691.1| hypothetical protein AWP90_13970 [Escherichia coli] gb|OKX40079.1| hypothetical protein AWP91_10620 [Escherichia coli] gb|OKX58156.1| hypothetical protein AWP94_16345 [Escherichia coli] gb|APQ19924.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|APT01004.1| hypothetical protein BJJ90_02690 [Escherichia coli] gb|OLN76783.1| hypothetical protein UG47_20980 [Escherichia coli] gb|OLO95195.1| hypothetical protein BHG39_07005 [Escherichia coli] gb|APT60756.1| hypothetical protein BUE82_01595 [Escherichia coli] gb|OLR34742.1| hypothetical protein UG58_17085 [Escherichia coli O25b:H4-ST131] gb|OLR85527.1| hypothetical protein BUE81_19770 [Escherichia coli] gb|OLS73489.1| hypothetical protein BJG04_14350 [Escherichia coli] gb|OLY55511.1| hypothetical protein BM748_016910 [Escherichia coli] gb|OMG95246.1| hypothetical protein A8M31_18445 [Escherichia coli] gb|OMH06150.1| hypothetical protein BWX35_10625 [Escherichia coli] gb|OMI52109.1| hypothetical protein MP35_18920 [Escherichia coli N40513] gb|ONG24364.1| hypothetical protein BWX43_03180 [Escherichia coli] gb|ONG26609.1| hypothetical protein BW690_19440 [Escherichia coli] emb|SJK90121.1| hypothetical protein RCEC007_650086 [Escherichia coli] gb|ONK36659.1| hypothetical protein BZ158_15635 [Escherichia coli] gb|ONN30259.1| hypothetical protein AYC64_14925 [Escherichia coli] gb|OOD49128.1| hypothetical protein BWP18_18210 [Escherichia coli] gb|AQP93106.1| hypothetical protein BWL12_17790 [Escherichia coli] gb|OOH58823.1| hypothetical protein BMT64_19065 [Escherichia coli] gb|OOH65451.1| hypothetical protein BMT65_10850 [Escherichia coli] gb|OOI37461.1| hypothetical protein BMT61_11110 [Escherichia coli] gb|OOI37693.1| hypothetical protein BMT86_05715 [Escherichia coli] gb|OOI67771.1| hypothetical protein BMT66_15785 [Escherichia coli] gb|OOI77516.1| hypothetical protein BMT81_22820 [Escherichia coli] gb|OOI87294.1| hypothetical protein BMT56_18455 [Escherichia coli] gb|OOI96877.1| hypothetical protein BMT76_12390 [Escherichia coli] gb|OOJ01276.1| hypothetical protein BMT74_14770 [Escherichia coli] gb|OOJ11467.1| hypothetical protein BMT73_09770 [Escherichia coli] gb|OOJ20584.1| hypothetical protein BMT97_14060 [Escherichia coli] gb|OOJ26606.1| hypothetical protein BMT90_14645 [Escherichia coli] gb|OOJ31912.1| hypothetical protein BMT87_20235 [Escherichia coli] gb|OOJ49181.1| hypothetical protein BMT77_12385 [Escherichia coli] gb|OOJ55953.1| hypothetical protein BMT70_17460 [Escherichia coli] gb|OOJ65801.1| hypothetical protein BMT71_16340 [Escherichia coli] gb|OOJ74181.1| hypothetical protein BMT68_12290 [Escherichia coli] gb|OOJ79509.1| hypothetical protein BMT58_17230 [Escherichia coli] gb|OOK12424.1| hypothetical protein BMT92_14075 [Escherichia coli] gb|OOK13084.1| hypothetical protein BMT69_14665 [Escherichia coli] gb|OOK28255.1| hypothetical protein BMT91_11530 [Escherichia coli] gb|OOM86956.1| hypothetical protein BWR05_02650 [Escherichia coli] gb|OON78988.1| hypothetical protein B1R43_04885 [Escherichia coli] gb|AQU00969.1| hypothetical protein B0915_19385 [Escherichia coli] gb|AQU94295.1| hypothetical protein B1200_02570 [Escherichia coli] gb|OOO99161.1| hypothetical protein AJR21_002570 [Shigella dysenteriae] gb|OOP08398.1| hypothetical protein AJR23_003385 [Shigella flexneri] gb|OOP12301.1| hypothetical protein AJR24_002260 [Shigella flexneri] gb|OOP19206.1| hypothetical protein AJR25_007040 [Shigella flexneri] gb|OOP30276.1| hypothetical protein AJR28_007480 [Shigella flexneri] gb|AQV25182.1| hypothetical protein BE964_12320 [Escherichia coli] gb|AQV34603.1| hypothetical protein BE933_06150 [Escherichia coli] gb|AQV40712.1| hypothetical protein BE959_11370 [Escherichia coli] gb|AQV47131.1| hypothetical protein BE966_15910 [Escherichia coli] gb|AQV56513.1| hypothetical protein BE941_08625 [Escherichia coli] gb|AQV63482.1| hypothetical protein BE928_17185 [Escherichia coli] gb|AQV73659.1| hypothetical protein BE932_14950 [Escherichia coli] gb|AQV84758.1| hypothetical protein BE940_15985 [Escherichia coli] gb|AQW00473.1| hypothetical protein BE939_05065 [Escherichia coli] gb|AQW07613.1| hypothetical protein BE946_16735 [Escherichia coli] gb|AQW12326.1| hypothetical protein BE965_14290 [Escherichia coli] gb|AQW15670.1| hypothetical protein BE937_03055 [Escherichia coli] gb|OOV72574.1| hypothetical protein B1739_04215 [Escherichia coli] gb|OOW28336.1| hypothetical protein B1734_09560 [Escherichia coli] gb|AQZ28947.1| hypothetical protein USML2_07430 [Escherichia coli] gb|ARA30984.1| hypothetical protein AM448_07800 [Escherichia coli] gb|ARA37599.1| hypothetical protein AM440_18445 [Escherichia coli] gb|ARA62267.1| hypothetical protein AM483_01240 [Escherichia coli] gb|ARD78518.1| hypothetical protein AYL54_12735 [Escherichia coli] gb|ARD82388.1| hypothetical protein AYR48_12730 [Escherichia coli] dbj|BAX12669.1| hypothetical protein MRY16002_c33350 [Escherichia coli] gb|ORC96069.1| hypothetical protein A4T35_18295 [Escherichia coli] gb|ORC96974.1| hypothetical protein A4T34_24225 [Escherichia coli] gb|ORD88229.1| hypothetical protein A4T33_06550 [Escherichia coli] gb|ORE80164.1| hypothetical protein B6D27_00975 [Escherichia coli] gb|ORE82847.1| hypothetical protein B6D24_03365 [Escherichia coli] gb|ARH98831.1| Mg(2+)-starvation-stimulated protein [Escherichia coli] gb|ORJ74786.1| hypothetical protein BHS81_19280 [Escherichia coli] gb|ORR79987.1| hypothetical protein BGP69_18210 [Escherichia coli] gb|ORR80298.1| hypothetical protein BGP68_18185 [Escherichia coli] gb|ORR88282.1| hypothetical protein BIQ82_17360 [Escherichia coli] gb|ORR91884.1| hypothetical protein BGP67_17820 [Escherichia coli] gb|ORR92775.1| hypothetical protein BGP66_17105 [Escherichia coli] gb|ORS03249.1| hypothetical protein BGP65_17115 [Escherichia coli] gb|ORS04541.1| hypothetical protein BGP64_17265 [Escherichia coli] gb|ORS07468.1| hypothetical protein BGP63_17120 [Escherichia coli] gb|ORS15923.1| hypothetical protein BGP62_17115 [Escherichia coli] gb|ORS19216.1| hypothetical protein BGP61_17105 [Escherichia coli] gb|ORS20791.1| hypothetical protein BGP60_17080 [Escherichia coli] gb|ORS29853.1| hypothetical protein BGP59_17080 [Escherichia coli] gb|ORS32628.1| hypothetical protein BGP58_17220 [Escherichia coli] gb|ORS33515.1| hypothetical protein BGP57_17070 [Escherichia coli] gb|ORS51348.1| hypothetical protein BIQ91_16880 [Escherichia coli] gb|ORS52092.1| hypothetical protein BIQ90_01150 [Escherichia coli] gb|ORS60001.1| hypothetical protein BHS95_17750 [Escherichia coli] gb|ORS68362.1| hypothetical protein BHS94_18430 [Escherichia coli] gb|ORS73460.1| hypothetical protein BHS91_17790 [Escherichia coli] gb|ORS74112.1| hypothetical protein BHS93_18435 [Escherichia coli] gb|ORS82371.1| hypothetical protein BHS90_17785 [Escherichia coli] gb|ORS88821.1| hypothetical protein BHS88_17770 [Escherichia coli] gb|ORS89003.1| hypothetical protein BHS89_18785 [Escherichia coli] gb|ORS99501.1| hypothetical protein BHS85_17890 [Escherichia coli] gb|ORT00263.1| hypothetical protein BHS87_18050 [Escherichia coli] gb|ORT04234.1| hypothetical protein BHS84_17520 [Escherichia coli] gb|ORT13550.1| hypothetical protein BGP71_18705 [Escherichia coli] gb|ORT17342.1| hypothetical protein BGP70_18255 [Escherichia coli] gb|ORT17525.1| hypothetical protein BIQ83_17655 [Escherichia coli] gb|ORT32138.1| hypothetical protein BIQ80_17520 [Escherichia coli] gb|ORT37941.1| hypothetical protein BHT55_17555 [Escherichia coli] emb|SMB22738.1| Putative uncharacterized protein YrbL [Escherichia coli] emb|SMB22737.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|OSC09866.1| hypothetical protein B8A24_24400 [Escherichia coli] emb|SMH30889.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|OSK05319.1| hypothetical protein L082_03938 [Escherichia coli SHECO001] gb|OSK23570.1| hypothetical protein EALG_03767 [Escherichia coli TA144] gb|OSK36143.1| hypothetical protein EAJG_02737 [Escherichia coli E267] gb|OSK60844.1| hypothetical protein EACG_03188 [Escherichia coli E560] gb|OSK65554.1| hypothetical protein EADG_00724 [Escherichia coli E1114] gb|OSK75597.1| hypothetical protein EAAG_00596 [Escherichia coli H001] gb|OSK97045.1| hypothetical protein ECWG_01613 [Escherichia coli E1002] gb|OSL04153.1| hypothetical protein ECVG_02060 [Escherichia coli H386] gb|OSL17974.1| putative cytoplasmic protein [Escherichia coli B175] gb|OSL26951.1| hypothetical protein ECQG_03065 [Escherichia coli TA255] gb|OSL28149.1| hypothetical protein ECRG_02168 [Escherichia coli H617] gb|OSL53218.1| hypothetical protein EASG_04113 [Escherichia coli H383] gb|OSL53944.1| hypothetical protein EAUG_02743 [Escherichia coli H454] gb|OSL60497.1| hypothetical protein EAVG_02955 [Escherichia coli H420] gb|OSL69928.1| hypothetical protein EAWG_01734 [Escherichia coli TA008] gb|OSL89411.1| hypothetical protein EBBG_03208 [Escherichia coli E704] gb|OSM00572.1| hypothetical protein ERAG_02706 [Escherichia coli R424] gb|OSP31182.1| hypothetical protein B9P94_11355 [Escherichia coli] gb|ARM41394.1| hypothetical protein AWH44_12645 [Escherichia coli] gb|OSY85317.1| hypothetical protein AVR71_18240 [Escherichia coli] gb|ARQ24586.1| hypothetical protein BMI82_12835 [Escherichia coli] gb|OTA10246.1| hypothetical protein BCR79_03925 [Escherichia coli] gb|OTB28645.1| hypothetical protein B9G66_03105 [Escherichia coli] gb|OTB28791.1| hypothetical protein B9G68_09390 [Escherichia coli] gb|OTB49342.1| hypothetical protein AW058_15195 [Escherichia coli] gb|OTB62359.1| hypothetical protein AW061_02565 [Escherichia coli] gb|OTB72060.1| hypothetical protein AW063_07765 [Escherichia coli] gb|OTB78826.1| hypothetical protein AW064_03390 [Escherichia coli] gb|OTC03125.1| hypothetical protein AW069_10885 [Escherichia coli] gb|OTC07604.1| hypothetical protein AW072_07800 [Escherichia coli] gb|OTC37302.1| hypothetical protein AW076_02610 [Escherichia coli] gb|OTC43314.1| hypothetical protein AW079_10615 [Escherichia coli] gb|OTC51479.1| hypothetical protein AW078_10190 [Escherichia coli] gb|OTC56490.1| hypothetical protein AW080_02790 [Escherichia coli] gb|OTC60403.1| hypothetical protein AW081_04250 [Escherichia coli] gb|OTC64113.1| hypothetical protein AW082_14925 [Escherichia coli] gb|OTC71600.1| hypothetical protein AW083_10500 [Escherichia coli] gb|OTC76046.1| hypothetical protein AW084_09350 [Escherichia coli] gb|OTC86708.1| hypothetical protein AW086_16415 [Escherichia coli] gb|OTD07797.1| hypothetical protein AW090_14520 [Escherichia coli] gb|OTD19707.1| hypothetical protein AW092_09245 [Escherichia coli] gb|OTD24829.1| hypothetical protein AW091_07720 [Escherichia coli] gb|OTD42551.1| hypothetical protein AW097_03105 [Escherichia coli] gb|OTD60287.1| hypothetical protein AW099_09605 [Escherichia coli] gb|OTD64973.1| hypothetical protein AW101_11175 [Escherichia coli] gb|OTD74251.1| hypothetical protein AW103_14325 [Escherichia coli] gb|OTD82654.1| hypothetical protein AW104_12085 [Escherichia coli] gb|OTD97583.1| hypothetical protein AW108_05305 [Escherichia coli] gb|OTE00109.1| hypothetical protein AW106_13355 [Escherichia coli] gb|OTE09455.1| hypothetical protein AW109_10610 [Escherichia coli] gb|OTE19035.1| hypothetical protein AW112_05435 [Escherichia coli] gb|OTE31708.1| hypothetical protein AW116_15565 [Escherichia coli] gb|OTE45223.1| hypothetical protein AW117_05045 [Escherichia coli] gb|OTE69152.1| hypothetical protein AW121_05345 [Escherichia coli] gb|OTE81585.1| hypothetical protein AW123_04310 [Escherichia coli] gb|OTE87995.1| hypothetical protein B1K92_00980 [Escherichia coli] gb|OTE93876.1| hypothetical protein B1K96_05600 [Escherichia coli] gb|ARR33460.1| hypothetical protein CA593_10265 [Escherichia coli] gb|ARR65681.1| hypothetical protein CA270_12700 [Escherichia coli] gb|OTV30329.1| hypothetical protein BA737_11355 [Escherichia coli] gb|OTV30926.1| hypothetical protein BA738_12045 [Escherichia coli] gb|OUD18945.1| hypothetical protein BVA22_01290 [Escherichia coli M4] gb|OUF78666.1| yrbL [Escherichia coli] gb|OUF81188.1| yrbL [Escherichia coli] gb|OUF85576.1| yrbL [Escherichia coli] gb|OUF93778.1| yrbL [Escherichia coli] gb|OUG05154.1| yrbL [Escherichia coli] gb|OUG11694.1| yrbL [Escherichia coli] gb|OUG20279.1| yrbL [Escherichia coli] gb|OUG23408.1| yrbL [Escherichia coli] gb|OUJ54902.1| hypothetical protein BZK32_25160 [Escherichia coli] gb|OUJ62430.1| hypothetical protein BZK35_22855 [Escherichia coli] gb|OUJ81538.1| hypothetical protein BW725_02570 [Shigella flexneri] gb|OUJ89379.1| hypothetical protein BW735_14995 [Escherichia coli] gb|OUK53468.1| hypothetical protein BZL31_06005 [Escherichia coli] gb|OUK55439.1| hypothetical protein BZL33_06130 [Escherichia coli] gb|OUL14777.1| hypothetical protein B0698_08800 [Escherichia coli] gb|ART18563.1| hypothetical protein EC95JB1_02592 [Escherichia coli] gb|ART26342.1| hypothetical protein EC95NR1_02591 [Escherichia coli] gb|ART42427.1| yrbL [Escherichia coli] gb|OUP43257.1| hypothetical protein B5F26_05050 [Escherichia coli] gb|OUR43725.1| yrbL [Escherichia coli] gb|OUR48976.1| yrbL [Escherichia coli] gb|ARV34117.1| hypothetical protein BUQ71_05635 [Escherichia coli] gb|ARV55015.1| hypothetical protein BZY78_14070 [Escherichia coli] gb|OUZ50137.1| hypothetical protein CBL26_02855 [Shigella flexneri] gb|OUZ51223.1| hypothetical protein CBL24_03005 [Shigella flexneri] gb|OUZ54549.1| hypothetical protein CBL18_02345 [Shigella flexneri] gb|OUZ62095.1| hypothetical protein CBL27_02520 [Shigella sonnei] gb|OUZ64501.1| hypothetical protein CBL21_07320 [Shigella flexneri] gb|OUZ77826.1| hypothetical protein CBL25_02345 [Shigella flexneri] gb|OUZ89744.1| hypothetical protein CBL31_11215 [Shigella flexneri] gb|ARW89551.1| hypothetical protein AM396_23145 [Escherichia coli] gb|ARX12595.1| hypothetical protein AM408_02140 [Escherichia coli] gb|ARX23288.1| hypothetical protein AM437_02315 [Escherichia coli] gb|ARX28828.1| hypothetical protein AM398_05440 [Escherichia coli] gb|OVF99449.1| hypothetical protein B5L93_14880 [Escherichia coli] gb|OVG48962.1| hypothetical protein B5L80_10765 [Escherichia coli] gb|OVJ53221.1| hypothetical protein B8042_08430 [Escherichia coli] gb|OVY45342.1| hypothetical protein B4P02_17345 [Escherichia coli] gb|OWC54697.1| hypothetical protein A8F91_08040 [Escherichia coli] gb|OWC55686.1| hypothetical protein A8F90_07305 [Escherichia coli] gb|OWC60167.1| hypothetical protein A8F93_18145 [Escherichia coli] gb|OWC64603.1| hypothetical protein A8F89_12390 [Escherichia coli] gb|OWC80607.1| hypothetical protein A8F88_20825 [Escherichia coli] gb|OWC88317.1| hypothetical protein A8F86_06710 [Escherichia coli] gb|OWC90903.1| hypothetical protein A8F84_07870 [Escherichia coli] gb|OWD03500.1| hypothetical protein A8F81_10375 [Escherichia coli] gb|OWD06891.1| hypothetical protein A8F82_03665 [Escherichia coli] gb|OWD14596.1| hypothetical protein A8C76_19165 [Escherichia coli] gb|OWD20062.1| hypothetical protein A8C72_00175 [Escherichia coli] gb|OWD23144.1| hypothetical protein A8C63_15030 [Escherichia coli] gb|OWD26542.1| hypothetical protein A8C78_17180 [Escherichia coli] gb|OWD32031.1| hypothetical protein A8C67_15245 [Escherichia coli] gb|OWD46872.1| hypothetical protein A8C66_00440 [Escherichia coli] gb|OWD47114.1| hypothetical protein A8C64_07705 [Escherichia coli] gb|OWD51593.1| hypothetical protein A8C62_12280 [Escherichia coli] gb|OWD54754.1| hypothetical protein A8C60_04460 [Escherichia coli] gb|OWD65134.1| hypothetical protein A8C71_03735 [Escherichia coli] gb|OWD66400.1| hypothetical protein A8C70_06965 [Escherichia coli] gb|OWD80725.1| hypothetical protein A8C68_10300 [Escherichia coli] gb|OWD90754.1| hypothetical protein A8M39_15670 [Escherichia coli] gb|OWE15445.1| hypothetical protein A8M41_13975 [Escherichia coli] gb|OWE52289.1| hypothetical protein A8M64_19665 [Escherichia coli] gb|OWE71011.1| hypothetical protein A8M61_06065 [Escherichia coli] gb|OWE73906.1| hypothetical protein A8M68_09320 [Escherichia coli] gb|OWE79605.1| hypothetical protein A8M69_15145 [Escherichia coli] gb|OWE87019.1| hypothetical protein A8M72_06205 [Escherichia coli] gb|OWF02059.1| hypothetical protein A8M70_07350 [Escherichia coli] gb|OWF07507.1| hypothetical protein A8M62_05535 [Escherichia coli] gb|OWF13925.1| hypothetical protein A8M78_20560 [Escherichia coli] gb|OWF14887.1| hypothetical protein A8M74_13360 [Escherichia coli] gb|ARZ84460.1| hypothetical protein AM361_16590 [Escherichia coli] gb|ARZ87521.1| hypothetical protein AM397_06495 [Escherichia coli] gb|ASA41098.1| hypothetical protein CCL28_02745 [Escherichia coli] gb|OWG55659.1| hypothetical protein CCE17_06755 [Escherichia coli] gb|OWG66957.1| hypothetical protein CCE16_01985 [Escherichia coli] gb|OWG92541.1| hypothetical protein CCE23_01985 [Escherichia coli] gb|OWH01773.1| hypothetical protein CCE12_19845 [Escherichia coli] gb|OWH06662.1| hypothetical protein CCE13_05020 [Escherichia coli] gb|OWH10164.1| hypothetical protein CCE10_20085 [Escherichia coli] gb|ASB78701.1| hypothetical protein AM384_09420 [Escherichia coli] gb|ASC16392.1| hypothetical protein AM434_08480 [Escherichia coli] gb|OWR22744.1| hypothetical protein CD912_02340 [Shigella boydii] gb|OWR40431.1| hypothetical protein BSQ42_01110 [Escherichia coli] gb|OWS80207.1| hypothetical protein B7C52_12050 [Escherichia coli] gb|ASG48037.1| hypothetical protein CES94_03000 [Escherichia coli] gb|OWW47699.1| hypothetical protein CCS19_23295 [Escherichia coli] gb|OWX80483.1| hypothetical protein BIQ87_18120 [Escherichia coli] gb|OWX81399.1| hypothetical protein BIQ86_18885 [Escherichia coli] gb|OWX90055.1| hypothetical protein BHS80_17680 [Escherichia coli] gb|OWY54995.1| hypothetical protein CA947_09625 [Escherichia coli] gb|ASJ35576.1| hypothetical protein ACJ76_17800 [Escherichia coli] gb|ASJ45137.1| hypothetical protein A0U97_21360 [Escherichia coli] gb|OXB29331.1| hypothetical protein SF301_1503 [Shigella flexneri 2a str. 301] gb|ASL30128.1| hypothetical protein CEJ55_05365 [Escherichia coli] gb|OXJ49605.1| hypothetical protein CDL30_03410 [Escherichia coli] gb|OXJ49744.1| hypothetical protein CDL34_14060 [Escherichia coli] gb|OXJ58158.1| hypothetical protein CDL53_05130 [Escherichia coli] gb|OXJ60444.1| hypothetical protein CDL52_12505 [Escherichia coli] gb|OXJ68920.1| hypothetical protein CDL32_19115 [Escherichia coli] gb|OXJ82642.1| hypothetical protein CDL49_06860 [Escherichia coli] gb|OXJ87514.1| hypothetical protein CDL48_02600 [Escherichia coli] gb|OXK00970.1| hypothetical protein CDL46_06270 [Escherichia coli] gb|OXK01146.1| hypothetical protein CDL47_03290 [Escherichia coli] gb|OXK23463.1| hypothetical protein CDL42_03700 [Escherichia coli] gb|OXK29222.1| hypothetical protein CDL33_03620 [Escherichia coli] gb|OXK32733.1| hypothetical protein CDL41_04000 [Escherichia coli] gb|OXK48994.1| hypothetical protein CDL38_05840 [Escherichia coli] gb|OXK52256.1| hypothetical protein CDL37_12295 [Escherichia coli] gb|OXK82022.1| hypothetical protein CD804_17315 [Escherichia coli] gb|OXK95716.1| hypothetical protein CD803_14015 [Escherichia coli] gb|OXK98358.1| hypothetical protein CD805_03080 [Escherichia coli] gb|OXL04533.1| hypothetical protein CD806_00390 [Escherichia coli] gb|OXL60573.1| hypothetical protein RO13_12715 [Escherichia coli] gb|OXL61173.1| hypothetical protein OA52_08690 [Escherichia coli] gb|OXL71599.1| hypothetical protein OA53_15525 [Escherichia coli] gb|ASO02270.1| hypothetical protein DS1UA2014_18065 [Escherichia coli] gb|ASO77384.1| hypothetical protein AKN40_0555 [Escherichia coli] gb|OXU82251.1| hypothetical protein CEB44_26470 [Escherichia coli] gb|OXU95652.1| hypothetical protein CEB47_05870 [Escherichia coli] gb|ASQ54697.1| hypothetical protein BS654_19260 [Shigella flexneri 4c] gb|ASQ58511.1| hypothetical protein BS653_14690 [Shigella flexneri 4c] gb|ASQ61954.1| hypothetical protein BS647_08595 [Shigella flexneri 1a] gb|ASQ80651.1| hypothetical protein B4376_05605 [Shigella flexneri 1a] gb|OXV39803.1| hypothetical protein CDL58_22400 [Escherichia coli] gb|OXW65774.1| hypothetical protein CG418_02350 [Shigella flexneri] gb|OXW74985.1| hypothetical protein CG425_02345 [Shigella flexneri] gb|OXW78931.1| hypothetical protein CG415_02540 [Shigella flexneri] gb|OXW96340.1| hypothetical protein CG412_02525 [Shigella flexneri] gb|OXX15213.1| hypothetical protein CG422_02115 [Shigella flexneri] gb|OXZ49261.1| hypothetical protein RW70_03008 [Escherichia coli] gb|OXZ53956.1| hypothetical protein RW69_03397 [Escherichia coli] gb|OXZ55288.1| hypothetical protein RW71_03127 [Escherichia coli] gb|OXZ75004.1| hypothetical protein RW74_00934 [Escherichia coli] gb|OXZ77187.1| hypothetical protein RW76_00938 [Escherichia coli] gb|OXZ85897.1| hypothetical protein RW72_03188 [Escherichia coli] gb|OXZ90395.1| hypothetical protein RW77_00928 [Escherichia coli] gb|OXZ97442.1| hypothetical protein RW73_02973 [Escherichia coli] gb|OXZ99041.1| hypothetical protein RW75_03240 [Escherichia coli] gb|OYA16462.1| hypothetical protein RW85_02043 [Escherichia coli] gb|OYA16933.1| hypothetical protein RW78_02183 [Escherichia coli] gb|OYA25901.1| hypothetical protein RW82_03390 [Escherichia coli] gb|OYA39589.1| hypothetical protein RW91_02335 [Escherichia coli] gb|OYA42706.1| hypothetical protein RW89_03333 [Escherichia coli] gb|OYA59396.1| hypothetical protein RW86_03351 [Escherichia coli] gb|OYA68565.1| hypothetical protein RW92_04435 [Escherichia coli] gb|OYA77518.1| hypothetical protein RW90_01312 [Escherichia coli] gb|OYB06733.1| hypothetical protein RX03_01887 [Escherichia coli] gb|OYB20302.1| hypothetical protein RX09_03553 [Escherichia coli] gb|OYB20806.1| hypothetical protein RX01_03259 [Escherichia coli] gb|OYB30433.1| hypothetical protein RX02_01711 [Escherichia coli] gb|OYB35032.1| hypothetical protein RX05_03386 [Escherichia coli] gb|OYB49651.1| hypothetical protein RX04_03234 [Escherichia coli] gb|OYB71783.1| hypothetical protein RX10_02091 [Escherichia coli] gb|OYB77883.1| hypothetical protein RX11_03335 [Escherichia coli] gb|OYC16103.1| hypothetical protein RX24_01663 [Escherichia coli] gb|OYC27356.1| hypothetical protein RX22_03327 [Escherichia coli] gb|OYC38021.1| hypothetical protein RX29_00353 [Escherichia coli] gb|OYC56968.1| hypothetical protein RX33_02604 [Escherichia coli] gb|OYC66756.1| hypothetical protein RX35_04295 [Escherichia coli] gb|OYC72707.1| hypothetical protein RX32_04564 [Escherichia coli] gb|OYD31235.1| hypothetical protein CA843_008290 [Escherichia coli] gb|OYE18899.1| hypothetical protein CI676_11035 [Shigella sonnei] gb|OYE21621.1| hypothetical protein CI675_09840 [Shigella sonnei] gb|OYE59518.1| hypothetical protein CI674_07380 [Shigella sonnei] gb|OYE74483.1| hypothetical protein CI631_19685 [Shigella sonnei] gb|OYF40016.1| hypothetical protein CI782_05295 [Shigella sonnei] gb|OYF63527.1| hypothetical protein CI642_14625 [Shigella sonnei] gb|OYF67353.1| hypothetical protein CI641_14955 [Shigella sonnei] gb|OYF90666.1| hypothetical protein CI640_12365 [Shigella sonnei] gb|OYG19246.1| hypothetical protein CI650_05410 [Shigella sonnei] gb|OYG63150.1| hypothetical protein CI733_08485 [Escherichia coli] gb|OYG71936.1| hypothetical protein CI732_21895 [Shigella boydii] gb|OYG77359.1| hypothetical protein CI728_09495 [Shigella sonnei] gb|OYG81400.1| hypothetical protein CI731_13890 [Shigella sonnei] gb|OYG94925.1| hypothetical protein CI729_01695 [Shigella sonnei] gb|OYG96382.1| hypothetical protein CI701_24385 [Shigella sonnei] gb|OYG99095.1| hypothetical protein CI727_03005 [Shigella sonnei] gb|OYI01483.1| hypothetical protein CI726_13930 [Shigella sonnei] gb|OYI12886.1| hypothetical protein CI724_14485 [Shigella sonnei] gb|OYI19193.1| hypothetical protein CI700_17770 [Shigella sonnei] gb|OYI43509.1| hypothetical protein CI696_07975 [Shigella sonnei] gb|OYI46700.1| hypothetical protein CI694_20755 [Shigella boydii] gb|OYI59277.1| hypothetical protein CI693_03755 [Shigella sonnei] gb|OYI66875.1| hypothetical protein CI691_11740 [Shigella sonnei] gb|OYI75036.1| hypothetical protein CI689_23610 [Shigella boydii] gb|OYI75108.1| hypothetical protein CI692_00115 [Shigella sonnei] gb|OYI85428.1| hypothetical protein CI686_12555 [Shigella sonnei] gb|OYI88445.1| hypothetical protein CI690_01120 [Shigella sonnei] gb|OYJ02530.1| hypothetical protein CI687_15235 [Shigella boydii] gb|OYJ24054.1| hypothetical protein CI734_18475 [Shigella sonnei] gb|OYJ24209.1| hypothetical protein CI738_13900 [Shigella sonnei] gb|OYJ32769.1| hypothetical protein CI737_26675 [Shigella boydii] gb|OYJ39678.1| hypothetical protein CI736_18880 [Shigella boydii] gb|OYJ39867.1| hypothetical protein CI673_25130 [Shigella sonnei] gb|OYJ61728.1| hypothetical protein CI669_05135 [Shigella sonnei] gb|OYJ65583.1| hypothetical protein CI668_25000 [Shigella sonnei] gb|OYJ66773.1| hypothetical protein CI735_00565 [Escherichia coli] gb|OYJ80639.1| hypothetical protein CI671_02935 [Shigella sonnei] gb|OYK16829.1| hypothetical protein CI722_25520 [Shigella sonnei] gb|OYK23766.1| hypothetical protein CI723_18590 [Shigella sonnei] gb|OYK35397.1| hypothetical protein CI720_21785 [Escherichia coli] gb|OYK42539.1| hypothetical protein CI716_20470 [Escherichia coli] gb|OYK45769.1| hypothetical protein CI718_03130 [Escherichia coli] gb|OYK54807.1| hypothetical protein CI721_20310 [Shigella sonnei] gb|OYK57453.1| hypothetical protein CI714_05865 [Shigella sonnei] gb|OYK63386.1| hypothetical protein CI713_02065 [Shigella sonnei] gb|OYL31196.1| hypothetical protein CI769_11180 [Shigella sonnei] gb|OYL40207.1| hypothetical protein CI771_04730 [Escherichia coli] gb|OYL68974.1| hypothetical protein CI764_24450 [Escherichia coli] gb|OYN28531.1| hypothetical protein CI772_11895 [Shigella boydii] gb|OYN40301.1| hypothetical protein B7D90_20225 [Escherichia coli] gb|OYN46332.1| hypothetical protein BTN40_13835 [Escherichia coli] gb|OYN70309.1| hypothetical protein CGZ73_10870 [Escherichia coli] gb|OYQ57021.1| hypothetical protein CI670_12980 [Shigella sonnei] gb|OZM87338.1| hypothetical protein CF005_09465 [Escherichia coli] gb|OZM98912.1| hypothetical protein CF016_02065 [Escherichia coli] gb|OZN03961.1| hypothetical protein CF018_02970 [Escherichia coli] gb|OZN06885.1| hypothetical protein CFY88_13220 [Escherichia coli] gb|OZO54148.1| hypothetical protein CG706_11385 [Escherichia coli] gb|OZO57966.1| hypothetical protein CG693_16365 [Escherichia coli] gb|OZO62722.1| hypothetical protein CG691_17140 [Escherichia coli] gb|OZO67929.1| hypothetical protein CG705_16280 [Escherichia coli] gb|OZO72694.1| hypothetical protein CG695_17205 [Escherichia coli] gb|OZO77725.1| hypothetical protein CG704_16855 [Escherichia coli] gb|OZO82835.1| hypothetical protein CG700_16965 [Escherichia coli] gb|OZO87818.1| hypothetical protein CG698_15935 [Escherichia coli] gb|OZO92580.1| hypothetical protein CG703_16110 [Escherichia coli] gb|OZO97312.1| hypothetical protein CG696_16150 [Escherichia coli] gb|OZP02112.1| hypothetical protein CG702_16430 [Escherichia coli] gb|OZP12085.1| hypothetical protein CG699_16160 [Escherichia coli] gb|OZP17292.1| hypothetical protein CG690_15055 [Escherichia coli] gb|OZP22070.1| hypothetical protein CG697_15965 [Escherichia coli] gb|OZP29651.1| hypothetical protein CG701_00085 [Escherichia coli] gb|OZP32747.1| hypothetical protein CG694_10410 [Escherichia coli] gb|OZR91864.1| hypothetical protein CIG50_16610 [Escherichia coli] gb|OZS01828.1| hypothetical protein CIG24_16255 [Escherichia coli] gb|OZS06998.1| hypothetical protein CIG45_15965 [Escherichia coli] gb|OZS12175.1| hypothetical protein CIG47_15095 [Escherichia coli] gb|OZX63744.1| hypothetical protein CIJ97_11155 [Escherichia coli] gb|OZX75709.1| hypothetical protein CIJ93_01650 [Escherichia coli] gb|OZX84490.1| hypothetical protein CIJ88_07995 [Escherichia coli] gb|OZX89672.1| hypothetical protein CIJ95_04900 [Escherichia coli] gb|OZY00465.1| hypothetical protein CIJ92_03420 [Escherichia coli] gb|OZY13170.1| hypothetical protein CIJ87_15940 [Escherichia coli] gb|OZY23138.1| hypothetical protein CIJ86_05010 [Escherichia coli] gb|OZY24179.1| hypothetical protein CIG20_05705 [Escherichia coli] gb|PAB67560.1| hypothetical protein CDH55_11855 [Escherichia coli] gb|PAB79590.1| hypothetical protein CDH53_07495 [Escherichia coli] gb|PAB83581.1| hypothetical protein CDH59_16810 [Escherichia coli] gb|PAB83845.1| hypothetical protein CDH54_14685 [Escherichia coli] gb|PAB96195.1| hypothetical protein CDH60_20895 [Escherichia coli] gb|PAB98524.1| hypothetical protein CDH56_01980 [Escherichia coli] gb|PAC02778.1| hypothetical protein CDH57_08895 [Escherichia coli] gb|PAL37220.1| hypothetical protein CEJ54_04870 [Escherichia coli] gb|PAL37960.1| hypothetical protein CEJ52_08335 [Escherichia coli] gb|PAL42473.1| hypothetical protein CEJ51_08980 [Escherichia coli] gb|PAQ19338.1| hypothetical protein B7979_12885 [Escherichia coli] gb|PAQ25587.1| hypothetical protein B7952_12635 [Escherichia coli] gb|PAQ28177.1| hypothetical protein B7958_06735 [Escherichia coli] gb|PAQ35339.1| hypothetical protein B7956_09775 [Escherichia coli] gb|PAQ35924.1| hypothetical protein B7950_15510 [Escherichia coli] gb|PAQ43449.1| hypothetical protein B7973_12335 [Escherichia coli] gb|PAQ47562.1| hypothetical protein B7962_09950 [Escherichia coli] gb|PAQ50892.1| hypothetical protein B7968_15485 [Escherichia coli] gb|PAQ56778.1| hypothetical protein B7961_10685 [Escherichia coli] gb|PAQ73420.1| hypothetical protein BIU77_15705 [Escherichia coli] gb|PAQ83533.1| hypothetical protein BIU75_18455 [Escherichia coli] gb|PAQ91833.1| hypothetical protein BIU74_14370 [Escherichia coli] gb|PAQ95849.1| hypothetical protein BIU73_09595 [Escherichia coli] gb|PAS48509.1| hypothetical protein CDN95_20345 [Escherichia coli] gb|PAS51225.1| hypothetical protein CDN93_20245 [Escherichia coli] gb|PAS55635.1| hypothetical protein CDN90_20195 [Escherichia coli] gb|PAS61344.1| hypothetical protein CDN91_19920 [Escherichia coli] gb|PAS67388.1| hypothetical protein CDN87_19205 [Escherichia coli] gb|PAS73358.1| hypothetical protein CDN94_19830 [Escherichia coli] gb|PAS79057.1| hypothetical protein CDN88_18625 [Escherichia coli] gb|PAS80588.1| hypothetical protein CDN92_20465 [Escherichia coli] gb|PAS85336.1| hypothetical protein CDN89_18525 [Escherichia coli] emb|CTP95933.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|PAT77005.1| hypothetical protein BTP99_23070 [Escherichia coli] gb|PAT84177.1| hypothetical protein BTP98_15515 [Escherichia coli] gb|PAT88794.1| hypothetical protein BTQ00_06245 [Escherichia coli] gb|PAT96549.1| hypothetical protein BTQ01_13915 [Escherichia coli] gb|PAU05142.1| hypothetical protein BTQ02_02785 [Escherichia coli] gb|PAU06901.1| hypothetical protein BTQ03_09540 [Escherichia coli] gb|PAU21581.1| hypothetical protein BTQ05_01260 [Escherichia coli] gb|PAU33013.1| hypothetical protein BTQ08_12435 [Escherichia coli] gb|ASZ47672.1| hypothetical protein CLD29_17125 [Escherichia coli] gb|PAY67883.1| hypothetical protein CEH00_22450 [Shigella boydii] gb|PAY72284.1| hypothetical protein CEG96_13925 [Shigella flexneri] gb|PAY97866.1| hypothetical protein CEG99_10610 [Shigella boydii] gb|PAZ70402.1| hypothetical protein APX88_13525 [Escherichia coli] gb|PBK14854.1| hypothetical protein CMR94_08225 [Escherichia coli] gb|PBK19509.1| hypothetical protein CMR93_08755 [Escherichia coli] gb|PBK25167.1| hypothetical protein CMR92_07280 [Escherichia coli] gb|PBK31152.1| hypothetical protein CMR91_02455 [Escherichia coli] gb|PBK36723.1| hypothetical protein CMR90_06570 [Escherichia coli] gb|PBK47055.1| hypothetical protein CMR85_01520 [Escherichia coli] gb|ATB81443.1| hypothetical protein CNQ54_02965 [Escherichia coli] gb|ATB96472.1| hypothetical protein CNQ51_02880 [Escherichia coli] gb|ATC01179.1| hypothetical protein CNQ50_03030 [Escherichia coli] gb|ATC09342.1| hypothetical protein CNQ49_21420 [Escherichia coli] gb|ATC10870.1| hypothetical protein CNQ48_03005 [Escherichia coli] gb|PBN55625.1| hypothetical protein ABE95_020160 [Escherichia coli] gb|PBN56356.1| hypothetical protein ABE94_010370 [Escherichia coli] gb|PBN74530.1| hypothetical protein ABE92_004470 [Escherichia coli] gb|PBN75353.1| hypothetical protein ABE91_009640 [Escherichia coli] gb|PBN86673.1| hypothetical protein ABE90_003175 [Escherichia coli] gb|PBO11455.1| hypothetical protein CI709_12515 [Shigella sonnei] gb|PBO88626.1| hypothetical protein CI711_22065 [Shigella boydii] gb|PBP01025.1| hypothetical protein CI702_04950 [Escherichia coli] gb|PBP06927.1| hypothetical protein CI708_08450 [Shigella sonnei] gb|PBP08643.1| hypothetical protein CI707_05305 [Shigella sonnei] gb|PBQ38707.1| hypothetical protein COD27_06780 [Escherichia coli] gb|PBQ42764.1| hypothetical protein COD56_11220 [Escherichia coli] gb|PBQ53660.1| hypothetical protein COD52_06630 [Escherichia coli] gb|PBQ59149.1| hypothetical protein COD51_04145 [Escherichia coli] gb|PBQ67318.1| hypothetical protein COD48_15410 [Escherichia coli] gb|PBQ73061.1| hypothetical protein COD43_11630 [Escherichia coli] gb|PBQ94218.1| hypothetical protein COD37_09365 [Escherichia coli] gb|PBR00585.1| hypothetical protein COD34_08355 [Escherichia coli] gb|PBR10073.1| hypothetical protein COD30_12995 [Escherichia coli] gb|PBR15389.1| hypothetical protein COD28_17685 [Escherichia coli] gb|PBR19048.1| hypothetical protein COD29_07815 [Escherichia coli] gb|PBR36829.1| hypothetical protein COD54_07280 [Escherichia coli] gb|PBR47635.1| hypothetical protein COD49_06165 [Escherichia coli] gb|PBR74041.1| hypothetical protein COD38_01535 [Escherichia coli] gb|PBR98800.1| hypothetical protein COD35_16440 [Escherichia coli] gb|PBR99334.1| hypothetical protein COD33_19805 [Escherichia coli] gb|PBS99799.1| hypothetical protein A9821_17600 [Escherichia coli] gb|PBT05107.1| hypothetical protein A9818_15150 [Escherichia coli] gb|PBT09532.1| hypothetical protein A9816_17410 [Escherichia coli] gb|PBT15930.1| hypothetical protein A9812_08095 [Escherichia coli] gb|PBT21614.1| hypothetical protein A9810_06840 [Escherichia coli] gb|PBT26022.1| hypothetical protein A9811_05705 [Escherichia coli] gb|PBT32773.1| hypothetical protein A9814_21390 [Escherichia coli] gb|PBT41370.1| hypothetical protein BBJ10_17245 [Escherichia coli] gb|PBT49036.1| hypothetical protein BBJ11_11810 [Escherichia coli] gb|PBT51545.1| hypothetical protein BBJ12_23955 [Escherichia coli] gb|PBT56469.1| hypothetical protein BBJ13_17075 [Escherichia coli] gb|PBT61867.1| hypothetical protein BBJ14_17380 [Escherichia coli] gb|PBT66807.1| hypothetical protein BBJ15_15540 [Escherichia coli] gb|PBT74095.1| hypothetical protein BBJ16_02560 [Escherichia coli] gb|PBT77144.1| hypothetical protein BBJ17_09710 [Escherichia coli] gb|PBT81995.1| hypothetical protein BBJ18_08530 [Escherichia coli] gb|PBT87201.1| hypothetical protein BBJ19_05460 [Escherichia coli] gb|PBT89937.1| hypothetical protein BBJ20_16915 [Escherichia coli] gb|PBT98005.1| hypothetical protein BB538_02375 [Escherichia coli] gb|PBU27703.1| hypothetical protein BB546_17970 [Escherichia coli] gb|PBU32679.1| hypothetical protein BB544_17270 [Escherichia coli] gb|PBU37914.1| hypothetical protein BB547_17585 [Escherichia coli] gb|PBU44609.1| hypothetical protein BB545_09700 [Escherichia coli] gb|PBU57038.1| hypothetical protein BB543_17605 [Escherichia coli] gb|PBU62348.1| hypothetical protein BB553_18765 [Escherichia coli] gb|PBU70239.1| hypothetical protein BB540_06820 [Escherichia coli] gb|PBU74304.1| hypothetical protein BB552_13015 [Escherichia coli] gb|PBU81003.1| hypothetical protein BB549_06600 [Escherichia coli] gb|PBU85215.1| hypothetical protein BB551_13015 [Escherichia coli] gb|PBU90234.1| hypothetical protein BB548_15455 [Escherichia coli] gb|PCD54756.1| hypothetical protein A6V15_10330 [Escherichia coli] gb|PCD75031.1| hypothetical protein CNN69_02440 [Escherichia coli] gb|ATG63767.1| hypothetical protein AWA97_22435 [Escherichia coli O104:H21 str. CFSAN002236] gb|PCM06544.1| hypothetical protein BH692_18550 [Escherichia coli] gb|PCM14800.1| hypothetical protein BH693_08065 [Escherichia coli] gb|PCM21322.1| hypothetical protein BH694_18335 [Escherichia coli] gb|PCO23602.1| protein YrbL [Escherichia coli] gb|PCO32378.1| protein YrbL [Escherichia coli] gb|PCO57734.1| protein YrbL [Escherichia coli] gb|PCO61137.1| protein YrbL [Escherichia coli] gb|PCO87456.1| protein YrbL [Escherichia coli] gb|PCO99046.1| protein YrbL [Escherichia coli] gb|PCQ91265.1| protein YrbL [Escherichia coli] gb|PCQ93789.1| protein YrbL [Escherichia coli] gb|PCR56259.1| protein YrbL [Escherichia coli] gb|PCR61370.1| protein YrbL [Escherichia coli] gb|PCR65768.1| protein YrbL [Escherichia coli] gb|PCR68962.1| protein YrbL [Escherichia coli] gb|PCR75231.1| protein YrbL [Escherichia coli] gb|PCS45721.1| protein YrbL [Escherichia coli] gb|PCS51077.1| protein YrbL [Escherichia coli] gb|PCS73262.1| protein YrbL [Escherichia coli] gb|PCS79894.1| protein YrbL [Escherichia coli] gb|PCS84933.1| protein YrbL [Escherichia coli] gb|PCS95573.1| protein YrbL [Escherichia coli] gb|PCT18431.1| protein YrbL [Escherichia coli] gb|PCT24112.1| protein YrbL [Escherichia coli] gb|PCT32009.1| protein YrbL [Escherichia coli] gb|ATH69408.1| hypothetical protein B7485_18130 [Shigella flexneri 1c] gb|PDM30058.1| protein YrbL [Escherichia coli] gb|PDM87022.1| protein YrbL [Escherichia coli] gb|PDM91948.1| protein YrbL [Escherichia coli] gb|PDM97351.1| protein YrbL [Escherichia coli] gb|PDN95015.1| hypothetical protein CJU66_18335 [Escherichia coli] gb|PDO05921.1| hypothetical protein CJU65_17345 [Escherichia coli] gb|PDO30263.1| protein YrbL [Escherichia coli] gb|PDO49243.1| protein YrbL [Escherichia coli] gb|PDO53554.1| protein YrbL [Escherichia coli] gb|PDO70166.1| protein YrbL [Escherichia coli] gb|PDS12440.1| hypothetical protein CMR86_23140 [Escherichia coli] gb|PDT94949.1| hypothetical protein A6V21_15665 [Escherichia coli] gb|PDU02456.1| hypothetical protein A6V20_02405 [Escherichia coli] gb|PDU06036.1| hypothetical protein A6V19_14140 [Escherichia coli] gb|PDU11531.1| hypothetical protein A6V18_13845 [Escherichia coli] gb|PDU17865.1| hypothetical protein A6V17_04430 [Escherichia coli] gb|PDU20557.1| hypothetical protein A6V16_19555 [Escherichia coli] gb|PDU27189.1| hypothetical protein A6V14_14050 [Escherichia coli] gb|PDU32409.1| hypothetical protein A6V13_15840 [Escherichia coli] gb|PDU38052.1| hypothetical protein A6V12_14995 [Escherichia coli] gb|PDU46946.1| hypothetical protein A6V11_00705 [Escherichia coli] gb|PDU52549.1| hypothetical protein A6V10_03235 [Escherichia coli] gb|PDU58850.1| hypothetical protein A6V09_01880 [Escherichia coli] gb|PDU61944.1| hypothetical protein A6V08_13315 [Escherichia coli] gb|PDU67057.1| hypothetical protein A6V07_14360 [Escherichia coli] gb|PDU72489.1| hypothetical protein A6V06_14220 [Escherichia coli] gb|PDU77989.1| hypothetical protein A6V05_14985 [Escherichia coli] gb|PDU83495.1| hypothetical protein A6V04_14970 [Escherichia coli] gb|PDU89504.1| hypothetical protein A6V03_12215 [Escherichia coli] gb|PDU97869.1| hypothetical protein A6V02_00705 [Escherichia coli] gb|PDV02387.1| hypothetical protein A6V00_04960 [Escherichia coli] gb|PDV24302.1| hypothetical protein BER05_05995 [Escherichia coli] gb|PDV29707.1| hypothetical protein BER19_06850 [Escherichia coli] gb|PDV50438.1| hypothetical protein BER13_10905 [Escherichia coli] gb|PDV82459.1| hypothetical protein BER06_10320 [Escherichia coli] gb|PDV96308.1| hypothetical protein A6V01_00705 [Escherichia coli] gb|PGF66736.1| protein YrbL [Escherichia coli] gb|PGF73762.1| hypothetical protein BMR20_05445 [Escherichia coli] gb|PGF89773.1| hypothetical protein BMR24_13550 [Escherichia coli] gb|PGF96960.1| hypothetical protein BMR26_15395 [Escherichia coli] gb|PGG06659.1| hypothetical protein BMR25_00165 [Escherichia coli] gb|PGG10157.1| hypothetical protein BMR30_14265 [Escherichia coli] gb|PGG16285.1| hypothetical protein BMR29_05595 [Escherichia coli] gb|PGG38338.1| hypothetical protein BMT48_03105 [Escherichia coli] gb|PGG41840.1| hypothetical protein BMR12_02155 [Escherichia coli] gb|PGG70625.1| hypothetical protein BMR15_01325 [Escherichia coli] gb|PHG92613.1| protein YrbL [Escherichia coli] gb|PHH31886.1| protein YrbL [Escherichia coli] gb|ATM10053.1| protein YrbL [Escherichia coli] gb|ATM26970.1| protein YrbL [Escherichia coli] gb|PHK62266.1| protein YrbL [Escherichia coli] gb|PHK73595.1| protein YrbL [Escherichia coli] gb|PHL42573.1| protein YrbL [Escherichia coli] gb|PHL50397.1| protein YrbL [Escherichia coli] gb|PHL59495.1| protein YrbL [Escherichia coli] gb|PHL63181.1| protein YrbL [Escherichia coli] gb|PHL73347.1| protein YrbL [Escherichia coli] gb|PHL94921.1| protein YrbL [Escherichia coli] gb|PHM01997.1| protein YrbL [Escherichia coli] gb|PHN13175.1| protein YrbL [Escherichia coli] gb|PHU45745.1| protein YrbL [Shigella flexneri] gb|PHU54728.1| protein YrbL [Shigella flexneri] gb|PHU59211.1| protein YrbL [Shigella flexneri] gb|ATP24789.1| protein YrbL [Escherichia coli] gb|PIA87385.1| hypothetical protein A1J83_05410 [Escherichia coli] gb|PIM56487.1| protein YrbL [Escherichia coli] gb|PIM65618.1| protein YrbL [Escherichia coli] gb|ATV49292.1| protein YrbL [Escherichia coli] gb|ATV73707.1| protein YrbL [Escherichia coli] gb|ATW96182.1| protein YrbL [Escherichia coli] gb|ATX17793.1| protein YrbL [Escherichia coli] gb|ATX48042.1| protein YrbL [Escherichia coli] gb|ATX53172.1| protein YrbL [Escherichia coli] gb|PJF89127.1| protein YrbL [Escherichia coli] gb|PJF94828.1| protein YrbL [Escherichia coli] gb|PJF97719.1| protein YrbL [Escherichia coli] gb|PJG01484.1| protein YrbL [Escherichia coli] gb|ATY26537.1| protein YrbL [Escherichia coli] gb|PJN77295.1| protein YrbL [Escherichia coli] gb|ATX34098.1| protein YrbL [Escherichia coli] gb|PJW36017.1| protein YrbL [Escherichia coli] gb|PJW41133.1| protein YrbL [Escherichia coli] gb|PJW65976.1| protein YrbL [Escherichia coli] gb|PJW76808.1| protein YrbL [Escherichia coli] gb|PJW91222.1| protein YrbL [Escherichia coli] gb|ATZ33194.1| hypothetical protein CV83915_02891 [Escherichia coli] gb|PJX77943.1| protein YrbL [Escherichia coli] gb|PJX83049.1| protein YrbL [Escherichia coli] gb|PJX92340.1| protein YrbL [Escherichia coli] gb|PJY03729.1| protein YrbL [Escherichia coli] gb|PJY08616.1| protein YrbL [Escherichia coli] gb|PJY14074.1| protein YrbL [Escherichia coli] gb|PJY18468.1| protein YrbL [Escherichia coli] gb|PJY22951.1| protein YrbL [Escherichia coli] gb|PJY27535.1| protein YrbL [Escherichia coli] gb|PJY38768.1| protein YrbL [Escherichia coli] gb|PJY42427.1| protein YrbL [Escherichia coli] gb|PJY57818.1| protein YrbL [Escherichia coli] gb|PJY59463.1| protein YrbL [Escherichia coli] emb|SMZ43534.1| Putative uncharacterized protein YrbL [Escherichia coli] gb|AUA41032.1| protein YrbL [Escherichia coli] gb|PKD60816.1| protein YrbL [Escherichia coli] gb|PKD66348.1| protein YrbL [Escherichia coli] gb|PKD70105.1| protein YrbL [Escherichia coli] gb|PKD76799.1| protein YrbL [Escherichia coli] gb|PKD80529.1| protein YrbL [Escherichia coli] gb|PKD90622.1| protein YrbL [Escherichia coli] gb|PKD92624.1| protein YrbL [Escherichia coli] gb|PKE02820.1| protein YrbL [Escherichia coli] gb|PKE15683.1| protein YrbL [Escherichia coli] gb|PKE76855.1| protein YrbL [Escherichia coli] gb|PKE84808.1| protein YrbL [Escherichia coli] gb|PKE93636.1| protein YrbL [Escherichia coli] gb|PKE99389.1| protein YrbL [Escherichia coli] gb|PKF10403.1| protein YrbL [Escherichia coli] gb|PKF12856.1| protein YrbL [Escherichia coli] gb|PKF53240.1| protein YrbL [Escherichia coli] gb|PKI86931.1| protein YrbL [Escherichia coli] gb|PKI95861.1| protein YrbL [Escherichia coli] gb|PKJ00952.1| protein YrbL [Escherichia coli] gb|PKJ04575.1| protein YrbL [Escherichia coli] gb|PKJ11348.1| protein YrbL [Escherichia coli] gb|PKJ21660.1| protein YrbL [Escherichia coli] gb|PKJ26419.1| protein YrbL [Escherichia coli] gb|PKJ28686.1| protein YrbL [Escherichia coli] gb|PKJ38195.1| protein YrbL [Escherichia coli] gb|PKJ42172.1| protein YrbL [Escherichia coli] gb|PKJ46600.1| protein YrbL [Escherichia coli] gb|AUF78473.1| protein YrbL [Escherichia coli O121:H19] gb|AUG17914.1| protein YrbL [Escherichia coli str. K-12 substr. MG1655] gb|PKQ96641.1| protein YrbL [Escherichia coli] gb|PKR62480.1| hypothetical protein CGZ52_16525 [Escherichia coli] gb|PKR68489.1| protein YrbL [Escherichia coli] gb|PKR72061.1| protein YrbL [Escherichia coli] gb|PLA88662.1| protein YrbL [Escherichia coli] gb|PLB57240.1| protein YrbL [Escherichia coli] gb|PLB61368.1| protein YrbL [Escherichia coli] gb|AUJ99461.1| protein YrbL [Escherichia coli] gb|AUK04935.1| protein YrbL [Escherichia coli] gb|AUK09836.1| protein YrbL [Escherichia coli] gb|AUK15094.1| protein YrbL [Escherichia coli] gb|AUK20227.1| protein YrbL [Escherichia coli] gb|PLJ79447.1| hypothetical protein B7L61_24995 [Escherichia coli] gb|PLJ87955.1| hypothetical protein B7L64_11500 [Escherichia coli] gb|PLJ91135.1| hypothetical protein B7L57_08795 [Escherichia coli] gb|PLJ96024.1| hypothetical protein B7L59_21175 [Escherichia coli] gb|PLJ98049.1| hypothetical protein B7L58_18740 [Escherichia coli] gb|PLR16192.1| protein YrbL [Escherichia coli] gb|AUL61937.1| hypothetical protein BVL38_02800 [Escherichia coli] gb|AUL68467.1| hypothetical protein BVL39_10050 [Escherichia coli] gb|AUL83300.1| protein YrbL [Escherichia coli] gb|AUL92066.1| protein YrbL [Escherichia coli] gb|AUM20829.1| protein YrbL [Escherichia coli] gb|AUN46033.1| protein YrbL [Escherichia coli] gb|PMB61389.1| protein YrbL [Escherichia coli] gb|PMD87063.1| hypothetical protein A8A04_11210 [Escherichia coli] gb|PMD89568.1| hypothetical protein A8A05_03800 [Escherichia coli] gb|PME06163.1| hypothetical protein A8A06_22570 [Escherichia coli] emb|SOQ97318.1| hypothetical protein NC86S2_260159 [Escherichia coli] emb|SOQ92903.1| hypothetical protein NC86S1_580032 [Escherichia coli] emb|SOR03811.1| hypothetical protein NC86S3_900032 [Escherichia coli] emb|SOQ85772.1| hypothetical protein NCTC86R_1380064 [Escherichia coli] emb|SOQ63878.1| hypothetical protein A4157S2_610160 [Escherichia coli] emb|SOQ66764.1| hypothetical protein A4157S1_210034 [Escherichia coli] emb|SOQ76477.1| hypothetical protein AT4157R_1950077 [Escherichia coli] emb|SOQ81896.1| hypothetical protein DSM301R_260078 [Escherichia coli] emb|SOQ73201.1| hypothetical protein A4157S3_430033 [Escherichia coli] emb|SOR07791.1| hypothetical protein CIP61R_490069 [Escherichia coli] gb|AUO55732.1| protein YrbL [Escherichia coli] gb|PNC14520.1| hypothetical protein CK476_05110 [Escherichia coli] gb|PND44283.1| hypothetical protein B7440_14245 [Escherichia coli] gb|PND73532.1| protein YrbL [Escherichia coli] gb|PND78664.1| protein YrbL [Escherichia coli] gb|PND85111.1| protein YrbL [Escherichia coli] gb|AUR80564.1| Putative uncharacterized protein YrbL (plasmid) [Escherichia coli] gb|PNN26637.1| protein YrbL [Escherichia coli] gb|PNO96776.1| protein YrbL [Escherichia coli] gb|AUP45091.1| hypothetical protein CV83906_2502 [Escherichia coli] gb|AUS36659.1| protein YrbL [Escherichia coli] gb|PNS28443.1| protein YrbL [Escherichia coli] gb|AUV22356.1| protein YrbL [Escherichia coli] gb|AUV32346.1| protein YrbL [Escherichia coli] gb|POF78308.1| protein YrbL [Escherichia coli] gb|POF81716.1| protein YrbL [Escherichia coli] gb|AUU30380.1| protein YrbL [Shigella flexneri] gb|POH99464.1| protein YrbL [Escherichia coli] gb|POI06615.1| protein YrbL [Escherichia coli] gb|AUX00771.1| hypothetical protein FORC42_0497 [Escherichia coli] gb|POO38509.1| protein YrbL [Escherichia coli] gb|POO47764.1| protein YrbL [Escherichia coli] gb|AUY03896.1| protein YrbL [Escherichia coli] gb|AUY27761.1| PhoP regulatory network YrbL family protein [Escherichia coli] gb|POR90629.1| protein YrbL [Shigella flexneri] gb|POR95871.1| protein YrbL [Shigella flexneri] gb|POS13680.1| hypothetical protein BJN40_16380 [Escherichia coli] gb|POS38146.1| hypothetical protein BJP16_13045 [Escherichia coli] gb|POS46552.1| hypothetical protein BJP18_13135 [Escherichia coli] gb|POT06938.1| protein YrbL [Escherichia coli] gb|POT09017.1| protein YrbL [Escherichia coli] gb|POT09347.1| protein YrbL [Escherichia coli] gb|POT18778.1| protein YrbL [Escherichia coli] gb|POT21928.1| protein YrbL [Escherichia coli] gb|POT23142.1| protein YrbL [Escherichia coli] gb|POU26187.1| protein YrbL [Escherichia coli] gb|POV26804.1| protein YrbL [Escherichia coli] gb|POZ12274.1| protein YrbL [Escherichia coli] gb|AVB44026.1| protein YrbL [Escherichia coli] gb|AVD30439.1| protein YrbL [Escherichia coli] gb|PPE11155.1| protein YrbL [Escherichia coli] gb|PPE24570.1| protein YrbL [Escherichia coli] gb|PPE34844.1| protein YrbL [Escherichia coli] gb|AVG00852.1| protein YrbL [Escherichia coli] gb|PPI90872.1| protein YrbL [Escherichia coli] gb|PPO15237.1| protein YrbL [Escherichia coli] gb|PPO90624.1| protein YrbL [Escherichia coli] gb|PPV46016.1| protein YrbL [Escherichia coli] gb|PPV48453.1| protein YrbL [Escherichia coli] gb|PPV60200.1| protein YrbL [Escherichia coli] gb|PPV61813.1| protein YrbL [Escherichia coli] gb|PPV72176.1| protein YrbL [Escherichia coli] gb|PPV76979.1| protein YrbL [Escherichia coli] gb|PPV87747.1| protein YrbL [Escherichia coli] gb|PPV97373.1| protein YrbL [Escherichia coli] gb|PPW07650.1| protein YrbL [Escherichia coli] gb|PPW10039.1| protein YrbL [Escherichia coli] gb|PPW20301.1| protein YrbL [Escherichia coli] gb|PPW20973.1| protein YrbL [Escherichia coli] gb|PPW30778.1| protein YrbL [Escherichia coli] gb|PPW41270.1| protein YrbL [Escherichia coli] gb|PPW61678.1| protein YrbL [Escherichia coli] gb|PPW80961.1| protein YrbL [Escherichia coli] gb|PPW85232.1| protein YrbL [Escherichia coli] gb|PPX02013.1| protein YrbL [Escherichia coli] gb|PPX04014.1| protein YrbL [Escherichia coli] gb|PPX11216.1| protein YrbL [Escherichia coli] gb|PPX17209.1| protein YrbL [Escherichia coli] gb|PPX20746.1| protein YrbL [Escherichia coli] gb|PPX26593.1| protein YrbL [Escherichia coli] gb|PPX29483.1| protein YrbL [Escherichia coli] gb|PPX32111.1| protein YrbL [Escherichia coli] gb|PPX46572.1| protein YrbL [Escherichia coli] gb|PPX60738.1| protein YrbL [Escherichia coli] gb|PPY65768.1| protein YrbL [Escherichia coli] gb|PPY70004.1| protein YrbL [Escherichia coli] gb|PPY75886.1| protein YrbL [Escherichia coli] gb|PPY85776.1| protein YrbL [Escherichia coli] gb|PPY87225.1| protein YrbL [Escherichia coli] gb|PPY98418.1| protein YrbL [Escherichia coli] gb|PPZ04460.1| protein YrbL [Escherichia coli] gb|PPZ12962.1| protein YrbL [Escherichia coli] gb|PPZ15880.1| protein YrbL [Escherichia coli] gb|PPZ22060.1| protein YrbL [Escherichia coli] gb|PPZ29380.1| protein YrbL [Escherichia coli] gb|PPZ31761.1| protein YrbL [Escherichia coli] gb|PPZ43354.1| protein YrbL [Escherichia coli] gb|PPZ99527.1| protein YrbL [Escherichia coli] gb|PQA12971.1| protein YrbL [Escherichia coli] gb|PQA48804.1| protein YrbL [Escherichia coli] gb|PQK22618.1| protein YrbL [Escherichia coli] gb|PQK25474.1| protein YrbL [Escherichia coli] gb|PQK30609.1| protein YrbL [Escherichia coli] gb|PQK35308.1| protein YrbL [Escherichia coli] gb|PQK40399.1| protein YrbL [Escherichia coli] gb|PQK48918.1| protein YrbL [Escherichia coli] gb|PQK52272.1| protein YrbL [Escherichia coli] gb|PQK59954.1| protein YrbL [Escherichia coli] gb|PQK67198.1| protein YrbL [Escherichia coli] gb|AVI53368.1| protein YrbL [Escherichia coli str. K-12 substr. MG1655] gb|PQM86896.1| protein YrbL [Shigella flexneri] gb|PQM96806.1| protein YrbL [Shigella flexneri] gb|PQN01532.1| protein YrbL [Shigella flexneri] gb|PQN07942.1| protein YrbL [Shigella flexneri] gb|PQN13067.1| protein YrbL [Shigella flexneri] gb|PQN24957.1| protein YrbL [Shigella flexneri] gb|PQN27987.1| protein YrbL [Shigella flexneri] gb|PQN43904.1| protein YrbL [Shigella flexneri] gb|PQN51599.1| protein YrbL [Shigella dysenteriae] gb|PQN59346.1| protein YrbL [Shigella flexneri] gb|PQN71592.1| protein YrbL [Shigella flexneri] gb|PQN79605.1| protein YrbL [Shigella flexneri] gb|PQN84409.1| protein YrbL [Shigella flexneri] gb|PQN86576.1| protein YrbL [Shigella flexneri] gb|PQN92732.1| protein YrbL [Shigella flexneri] gb|PQN93457.1| protein YrbL [Shigella flexneri] gb|PQO03824.1| protein YrbL [Shigella flexneri] gb|PQO06979.1| protein YrbL [Shigella flexneri] gb|PQO15999.1| protein YrbL [Shigella flexneri] gb|PQO21174.1| protein YrbL [Shigella flexneri] gb|PQO65763.1| protein YrbL [Escherichia coli] gb|PQO69105.1| protein YrbL [Escherichia coli] gb|PQO73306.1| protein YrbL [Escherichia coli] gb|PQO80405.1| protein YrbL [Escherichia coli] gb|PQO86259.1| protein YrbL [Escherichia coli] gb|PQP08544.1| protein YrbL [Escherichia coli] gb|AVJ77484.1| phoP regulatory network YrbL family protein [Escherichia coli] gb|PRB35316.1| protein YrbL [Escherichia coli] gb|PRC23256.1| protein YrbL [Escherichia coli] gb|AVM04938.1| protein YrbL [Escherichia coli] gb|PRP06985.1| protein YrbL [Escherichia coli] gb|PRP20012.1| protein YrbL [Escherichia coli] gb|PRP20815.1| protein YrbL [Escherichia coli] gb|PRP32122.1| protein YrbL [Escherichia coli] gb|PRP36272.1| protein YrbL [Escherichia coli] gb|PRP40756.1| protein YrbL [Escherichia coli] gb|AVM99658.1| protein YrbL [Escherichia coli] gb|AVN12470.1| phoP regulatory network YrbL family protein [Escherichia coli] gb|AVN38040.1| protein YrbL [Escherichia coli] gb|PRT60066.1| protein YrbL [Escherichia coli] gb|PRW54330.1| phoP regulatory network YrbL family protein [Escherichia coli] gb|PSB94302.1| protein YrbL [Escherichia coli] gb|PSF41072.1| protein YrbL [Escherichia coli] gb|PSF72737.1| protein YrbL [Escherichia coli] gb|PSF78985.1| protein YrbL [Escherichia coli] gb|PSF86783.1| protein YrbL [Escherichia coli] gb|PSF93924.1| protein YrbL [Escherichia coli] gb|PSG01461.1| protein YrbL [Escherichia coli] gb|PSG05492.1| protein YrbL [Escherichia coli] gb|PSG10267.1| protein YrbL [Escherichia coli] gb|PSG15019.1| protein YrbL [Escherichia coli] gb|PSG20701.1| protein YrbL [Escherichia coli] gb|PSG24271.1| protein YrbL [Escherichia coli] gb|PSG29707.1| protein YrbL [Escherichia coli] gb|PSG34216.1| protein YrbL [Escherichia coli] gb|PSG38744.1| protein YrbL [Escherichia coli] gb|PSG44368.1| protein YrbL [Escherichia coli] gb|PSG48122.1| protein YrbL [Escherichia coli] gb|PSG54628.1| protein YrbL [Escherichia coli] gb|PSG70196.1| protein YrbL [Escherichia coli] gb|PSG75485.1| protein YrbL [Escherichia coli] gb|PSG81302.1| protein YrbL [Escherichia coli] gb|AVP31385.1| protein YrbL [Escherichia coli] gb|PSK08692.1| protein YrbL [Escherichia coli] gb|PSK22449.1| protein YrbL [Escherichia coli] gb|PSL63769.1| protein YrbL [Escherichia coli] gb|PSL68552.1| protein YrbL [Escherichia coli] gb|PSL69108.1| protein YrbL [Escherichia coli] gb|PSL78219.1| protein YrbL [Escherichia coli] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_059341328.1| protein YrbL [Escherichia coli] gb|KUU09487.1| hypothetical protein AWF13_07200 [Escherichia coli] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKKLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_054628191.1| protein YrbL [Escherichia coli] gb|KPO18321.1| hypothetical protein ACU58_21100 [Escherichia coli] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKSY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_032222339.1| protein YrbL [Escherichia coli] emb|CDP66030.1| Putative uncharacterized protein yrbL [Escherichia coli D6-113.11] emb|CDU33504.1| Putative uncharacterized protein yrbL [Escherichia coli D6-113.11] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKHLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_000620398.1| MULTISPECIES: protein YrbL [Escherichia] ref|YP_002409605.1| hypothetical protein ECIAI39_3702 [Escherichia coli IAI39] ref|YP_002414346.1| hypothetical protein ECUMN_3687 [Escherichia coli UMN026] emb|CAR19818.1| conserved hypothetical protein [Escherichia coli IAI39] emb|CAR14841.1| conserved hypothetical protein [Escherichia coli UMN026] gb|EFE99854.1| yrbL protein [Escherichia coli FVEC1412] gb|EFI19213.1| yrbL protein [Escherichia coli FVEC1302] gb|EFJ74193.1| hypothetical protein HMPREF9552_02168 [Escherichia coli MS 198-1] gb|AEQ14455.1| hypothetical protein CE10_3737 [Escherichia coli O7:K1 str. CE10] gb|EHO01565.1| hypothetical protein ESNG_00068 [Escherichia coli B093] gb|EIL65898.1| hypothetical protein EC5761_15286 [Escherichia coli 576-1] gb|ELB97015.1| hypothetical protein WCA_04208 [Escherichia coli KTE2] gb|ELC44707.1| hypothetical protein WEK_03794 [Escherichia coli KTE26] gb|ELC71574.1| hypothetical protein A139_03247 [Escherichia coli KTE181] gb|ELD03054.1| hypothetical protein A15I_03428 [Escherichia coli KTE204] gb|ELD18281.1| hypothetical protein A15Q_03748 [Escherichia coli KTE208] gb|ELD58622.1| hypothetical protein A17U_02385 [Escherichia coli KTE228] gb|ELD76029.1| hypothetical protein A195_03197 [Escherichia coli KTE235] gb|ELE68468.1| hypothetical protein A1UW_03475 [Escherichia coli KTE80] gb|ELE78421.1| hypothetical protein A1W1_03654 [Escherichia coli KTE83] gb|ELE97278.1| hypothetical protein A1Y3_04390 [Escherichia coli KTE116] gb|ELG04267.1| hypothetical protein A1SG_04384 [Escherichia coli KTE54] gb|ELG97519.1| hypothetical protein A31C_04008 [Escherichia coli KTE158] gb|ELH18382.1| hypothetical protein A13Q_03755 [Escherichia coli KTE190] gb|ELI05383.1| hypothetical protein WI7_03338 [Escherichia coli KTE105] gb|ELI40716.1| hypothetical protein WIK_03652 [Escherichia coli KTE122] gb|ELI53142.1| hypothetical protein WIQ_03413 [Escherichia coli KTE128] gb|ELJ41249.1| hypothetical protein WKU_03403 [Escherichia coli KTE177] gb|ELJ63613.1| hypothetical protein WGM_03686 [Escherichia coli KTE82] gb|EOU49338.1| hypothetical protein WC9_03442 [Escherichia coli KTE231] gb|EOV17491.1| hypothetical protein A15A_04947 [Escherichia coli KTE200] gb|EOV57862.1| hypothetical protein A1U9_03714 [Escherichia coli KTE68] gb|EOW32595.1| hypothetical protein A1YE_04364 [Escherichia coli KTE127] gb|EOW57075.1| hypothetical protein A1YK_01274 [Escherichia coli KTE134] gb|EOW65679.1| hypothetical protein A31O_04131 [Escherichia coli KTE170] gb|EOW73657.1| hypothetical protein G434_02450 [Escherichia sp. KTE172] gb|EOW89381.1| hypothetical protein WAS_04220 [Escherichia coli KTE1] gb|EOX03286.1| hypothetical protein A17O_04780 [Escherichia coli KTE225] gb|EQN44810.1| hypothetical protein G689_00062 [Escherichia coli HVH 10 (4-6832164)] gb|EQN78190.1| hypothetical protein G698_03454 [Escherichia coli HVH 22 (4-2258986)] gb|EQO04249.1| hypothetical protein G705_03549 [Escherichia coli HVH 29 (4-3418073)] gb|EQO75374.1| hypothetical protein G720_03777 [Escherichia coli HVH 45 (4-3129918)] gb|EQP02887.1| hypothetical protein G725_00759 [Escherichia coli HVH 53 (4-0631051)] gb|EQP22636.1| hypothetical protein G732_03551 [Escherichia coli HVH 63 (4-2542528)] gb|EQP33489.1| hypothetical protein G735_03610 [Escherichia coli HVH 69 (4-2837072)] gb|EQP89097.1| hypothetical protein G747_03277 [Escherichia coli HVH 85 (4-0792144)] gb|EQQ00379.1| hypothetical protein G750_03451 [Escherichia coli HVH 88 (4-5854636)] gb|EQQ56252.1| hypothetical protein G767_03607 [Escherichia coli HVH 106 (4-6881831)] gb|EQQ63277.1| hypothetical protein G771_03657 [Escherichia coli HVH 110 (4-6978754)] gb|EQQ85819.1| hypothetical protein G774_03591 [Escherichia coli HVH 113 (4-7535473)] gb|EQR18114.1| hypothetical protein G781_03624 [Escherichia coli HVH 119 (4-6879578)] gb|EQR31329.1| hypothetical protein G784_03596 [Escherichia coli HVH 122 (4-6851606)] gb|EQR59953.1| hypothetical protein G789_03508 [Escherichia coli HVH 130 (4-7036876)] gb|EQR79568.1| hypothetical protein G793_03503 [Escherichia coli HVH 135 (4-4449320)] gb|EQR81905.1| hypothetical protein G792_00681 [Escherichia coli HVH 134 (4-6073441)] gb|EQR82964.1| hypothetical protein G791_02204 [Escherichia coli HVH 133 (4-4466519)] gb|EQR99119.1| hypothetical protein G798_03586 [Escherichia coli HVH 140 (4-5894387)] gb|EQS27753.1| hypothetical protein G803_00800 [Escherichia coli HVH 145 (4-5672112)] gb|EQS45747.1| hypothetical protein G809_03567 [Escherichia coli HVH 151 (4-5755573)] gb|EQS80494.1| hypothetical protein G821_00800 [Escherichia coli HVH 163 (4-4697553)] gb|EQS85385.1| hypothetical protein G823_03558 [Escherichia coli HVH 167 (4-6073565)] gb|EQT10438.1| hypothetical protein G828_01109 [Escherichia coli HVH 173 (3-9175482)] gb|EQT33841.1| hypothetical protein G835_03688 [Escherichia coli HVH 183 (4-3205932)] gb|EQT67268.1| hypothetical protein G839_00209 [Escherichia coli HVH 187 (4-4471660)] gb|EQT72782.1| hypothetical protein G841_03568 [Escherichia coli HVH 189 (4-3220125)] gb|EQU48231.1| hypothetical protein G858_03588 [Escherichia coli HVH 206 (4-3128229)] gb|EQU59998.1| hypothetical protein G860_03684 [Escherichia coli HVH 208 (4-3112292)] gb|EQU85212.1| hypothetical protein G867_03623 [Escherichia coli HVH 215 (4-3008371)] gb|EQV18485.1| hypothetical protein G874_03591 [Escherichia coli HVH 223 (4-2976528)] gb|EQV77242.1| hypothetical protein G891_03417 [Escherichia coli KOEGE 68 (182a)] gb|EQV80354.1| hypothetical protein G890_03746 [Escherichia coli KOEGE 62 (175a)] gb|EQV97825.1| hypothetical protein G894_03219 [Escherichia coli KOEGE 73 (195a)] gb|ERA47826.1| hypothetical protein H000_00115 [Escherichia coli UMEA 3899-1] gb|ERA67644.1| hypothetical protein G813_03560 [Escherichia coli HVH 155 (4-4509048)] gb|ESA93222.1| hypothetical protein HMPREF1599_01012 [Escherichia coli 907713] gb|ESD24361.1| hypothetical protein HMPREF1600_03466 [Escherichia coli 907715] gb|ESD54510.1| hypothetical protein HMPREF1605_02383 [Escherichia coli 908521] gb|ESD60070.1| hypothetical protein HMPREF1606_01255 [Escherichia coli 908522] gb|ESD87216.1| hypothetical protein HMPREF1613_03224 [Escherichia coli 908616] gb|ESD91306.1| hypothetical protein HMPREF1612_02103 [Escherichia coli 908585] gb|EYB41971.1| hypothetical protein BU70_15245 [Escherichia coli] gb|KDA72077.1| phoP regulatory network YrbL family protein [Escherichia coli 2-005-03_S3_C2] gb|KEJ22445.1| phoP regulatory network YrbL family protein [Escherichia coli 2-316-03_S1_C1] gb|KEJ23929.1| phoP regulatory network YrbL family protein [Escherichia coli 2-316-03_S1_C2] gb|KEP19271.1| hypothetical protein EH61_04010 [Escherichia coli] gb|KFH82145.1| hypothetical protein GR03_16680 [Escherichia coli] gb|AKK50049.1| hypothetical protein PPECC33_03534 [Escherichia coli PCN033] gb|KMV61629.1| hypothetical protein ACM20_17790 [Escherichia coli] gb|KQJ23058.1| hypothetical protein AM267_01450 [Escherichia coli] gb|KUR37723.1| hypothetical protein AWF56_04300 [Escherichia coli] gb|KUS19127.1| hypothetical protein AWE67_11880 [Escherichia coli] gb|KUS99361.1| hypothetical protein AWE81_04740 [Escherichia coli] gb|KUT59042.1| hypothetical protein AWF02_01285 [Escherichia coli] gb|KUU15642.1| hypothetical protein AWF16_12970 [Escherichia coli] gb|KUU53368.1| hypothetical protein AWF26_25870 [Escherichia coli] gb|KUX08845.1| hypothetical protein AWF78_04425 [Escherichia coli] gb|KWV19020.1| hypothetical protein AWH70_17810 [Escherichia coli] gb|KXH03043.1| hypothetical protein HMPREF3040_00367 [Escherichia coli] gb|KZH52848.1| hypothetical protein AWG43_17475 [Escherichia coli] gb|KZI15356.1| hypothetical protein AWG50_26110 [Escherichia coli] gb|KZI21479.1| hypothetical protein AWG64_22000 [Escherichia coli] gb|KZI64764.1| hypothetical protein AWG71_15340 [Escherichia coli] gb|KZI71720.1| hypothetical protein AWG74_12605 [Escherichia coli] gb|KZJ56841.1| hypothetical protein AWG98_15910 [Escherichia coli] gb|KZJ62406.1| hypothetical protein AWG90_24410 [Escherichia coli] gb|KZJ76766.1| hypothetical protein AWG95_20185 [Escherichia coli] gb|OAF29632.1| hypothetical protein AXK31_07010 [Escherichia coli] gb|OAF33144.1| hypothetical protein AXK34_16655 [Escherichia coli] gb|OAF40393.1| hypothetical protein AXK33_15265 [Escherichia coli] gb|OAF49454.1| hypothetical protein AXK35_20205 [Escherichia coli] gb|OAS85415.1| hypothetical protein A6I92_17320 [Escherichia coli] gb|OEM75821.1| hypothetical protein BHF33_12900 [Escherichia coli] gb|OEO09934.1| hypothetical protein BHF60_02465 [Escherichia coli] gb|OJK73190.1| hypothetical protein BK248_22110 [Escherichia coli] gb|OJR62737.1| hypothetical protein BK386_21490 [Escherichia coli] gb|OKP59913.1| hypothetical protein A8A03_16785 [Escherichia coli] gb|OLL68935.1| hypothetical protein BSK24_05285 [Escherichia coli] gb|OOH74231.1| hypothetical protein BMU01_03705 [Escherichia coli] gb|OOI19897.1| hypothetical protein BMT98_12150 [Escherichia coli] gb|OOI61874.1| hypothetical protein BMT59_15510 [Escherichia coli] gb|OOI68795.1| hypothetical protein BMU02_16555 [Escherichia coli] gb|OOJ16668.1| hypothetical protein BMU00_15475 [Escherichia coli] gb|OOJ83888.1| hypothetical protein BMU04_18335 [Escherichia coli] gb|OOK33701.1| hypothetical protein BMT99_15565 [Escherichia coli] dbj|BAX17767.1| hypothetical protein MRY15117_c33570 [Escherichia coli] dbj|BAX22640.1| hypothetical protein MRY15131_c32980 [Escherichia coli] gb|ORD38333.1| hypothetical protein A4T41_18770 [Escherichia coli] gb|OSB94037.1| hypothetical protein B7483_04075 [Escherichia coli] gb|OSK13550.1| hypothetical protein EANG_02275 [Escherichia coli FVEC1465] gb|OUF67587.1| hypothetical protein AZZ93_002286 [Escherichia coli] gb|OWC12359.1| hypothetical protein A8G20_12860 [Escherichia coli] gb|OWD95673.1| hypothetical protein A8M44_08120 [Escherichia coli] gb|OWE22719.1| hypothetical protein A8M46_13820 [Escherichia coli] gb|OWE34372.1| hypothetical protein A8M45_04550 [Escherichia coli] gb|OWE34556.1| hypothetical protein A8M42_09095 [Escherichia coli] gb|OWH22218.1| hypothetical protein CCE14_07550 [Escherichia coli] gb|OYC32803.1| hypothetical protein RX23_03369 [Escherichia coli] gb|OYC49932.1| hypothetical protein RX25_01829 [Escherichia coli] gb|OYC66014.1| hypothetical protein RX31_02215 [Escherichia coli] gb|OYC84918.1| hypothetical protein RX38_02165 [Escherichia coli] gb|OZX69421.1| hypothetical protein CIJ96_08675 [Escherichia coli] gb|OZX79454.1| hypothetical protein CIJ90_09140 [Escherichia coli] gb|OZX94285.1| hypothetical protein CIJ94_14360 [Escherichia coli] gb|OZY05700.1| hypothetical protein CIJ91_02895 [Escherichia coli] gb|OZY09858.1| hypothetical protein CIJ89_08210 [Escherichia coli] gb|ASX04241.1| hypothetical protein CA696_002945 [Escherichia coli] gb|PBU22973.1| hypothetical protein BB539_17115 [Escherichia coli] gb|PCS80552.1| protein YrbL [Escherichia coli] gb|ATI06555.1| hypothetical protein CO715_13060 [Escherichia coli M12] gb|PHL44364.1| protein YrbL [Escherichia coli] gb|PIM19309.1| protein YrbL [Escherichia coli] gb|ATX16525.1| protein YrbL [Escherichia coli] gb|PJW70465.1| protein YrbL [Escherichia coli] gb|PKG07243.1| protein YrbL [Escherichia coli] gb|PQN66436.1| protein YrbL [Shigella flexneri] gb|PQV26393.1| protein YrbL [Escherichia coli] gb|PQV32864.1| protein YrbL [Escherichia coli] Length = 210 Score = 404 bits (1039), Expect = e-142 Identities = 197/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQILKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_032207200.1| protein YrbL [Escherichia coli] gb|KDY23953.1| phoP regulatory network YrbL family protein [Escherichia coli 2-316-03_S4_C2] Length = 210 Score = 404 bits (1038), Expect = e-142 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPV+CDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVICDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_023308377.1| MULTISPECIES: protein YrbL [Enterobacteriaceae] gb|ESM34374.1| hypothetical protein L403_03445 [Escherichia coli BWH 32] gb|KFD77936.1| hypothetical protein JD73_02000 [Escherichia coli] gb|KHI36717.1| hypothetical protein PU33_04870 [Escherichia coli] gb|KUS84191.1| hypothetical protein AWE77_13590 [Escherichia coli] gb|OOO84248.1| hypothetical protein AJR17_003095 [Shigella boydii] gb|OZR99118.1| hypothetical protein CIG25_04760 [Escherichia coli] gb|PPW35939.1| protein YrbL [Escherichia coli] Length = 210 Score = 404 bits (1038), Expect = e-142 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEED+A Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDVAQLRQLLKHLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_021564851.1| protein YrbL [Escherichia coli] gb|EQY04167.1| hypothetical protein G939_00061 [Escherichia coli UMEA 3201-1] gb|OAR91971.1| hypothetical protein AYO02_16265 [Escherichia coli] gb|OIZ73963.1| hypothetical protein BM756_08245 [Escherichia coli] gb|APJ78611.1| hypothetical protein RG28_21155 [Escherichia coli] gb|OKV33530.1| hypothetical protein AWP56_24630 [Escherichia coli] gb|OKV71319.1| hypothetical protein AWP60_25375 [Escherichia coli] gb|OKV90322.1| hypothetical protein AWP67_11600 [Escherichia coli] Length = 210 Score = 404 bits (1038), Expect = e-142 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGY+YDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYIYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_000620410.1| MULTISPECIES: protein YrbL [Enterobacteriaceae] gb|ACA76170.1| conserved hypothetical protein [Escherichia coli ATCC 8739] gb|EFF04975.1| hypothetical protein ECDG_03396 [Escherichia coli B185] gb|EHV93405.1| hypothetical protein ECDEC7B_3494 [Escherichia coli DEC7B] gb|AFG42150.1| hypothetical protein P12B_c3324 [Escherichia coli P12b] gb|ELC94704.1| hypothetical protein A13W_02414 [Escherichia coli KTE193] gb|ELF06747.1| hypothetical protein A1Y7_03865 [Escherichia coli KTE119] gb|ELI22134.1| hypothetical protein WIC_03668 [Escherichia coli KTE112] gb|EOV09706.1| hypothetical protein WGA_03235 [Escherichia coli KTE40] gb|EOV75689.1| hypothetical protein A1UI_03491 [Escherichia coli KTE73] gb|EOW92873.1| hypothetical protein WGC_03900 [Escherichia coli KTE41] gb|EQY57611.1| hypothetical protein G952_03346 [Escherichia coli UMEA 3240-1] gb|EQY85463.1| hypothetical protein G963_03332 [Escherichia coli UMEA 3314-1] gb|EQZ63148.1| hypothetical protein G986_03307 [Escherichia coli UMEA 3682-1] gb|EQZ63761.1| hypothetical protein G985_03343 [Escherichia coli UMEA 3671-1] gb|ETJ70444.1| hypothetical protein O199_0204305 [Escherichia coli ATCC 35150] gb|AHG16595.1| Putative uncharacterized protein YrbL [Escherichia coli O145:H28 str. RM13516] gb|AHG10822.1| Putative uncharacterized protein YrbL [Escherichia coli O145:H28 str. RM13514] gb|AHM29705.1| hypothetical protein BU34_12240 [Escherichia coli] gb|AHM32958.1| hypothetical protein CF57_03455 [Escherichia coli] gb|AHM37561.1| hypothetical protein CF61_04230 [Escherichia coli] gb|EYV14794.1| hypothetical protein BX51_11900 [Escherichia coli O145:NM str. 2010C-3526] gb|EYV15889.1| hypothetical protein BX49_07650 [Escherichia coli O145:NM str. 2010C-3518] gb|EYV21529.1| hypothetical protein BX50_00315 [Escherichia coli O145:NM str. 2010C-3521] gb|EYV25157.1| hypothetical protein BX47_25830 [Escherichia coli O145:NM str. 2010C-3516] gb|EYV27383.1| hypothetical protein BX48_21505 [Escherichia coli O145:NM str. 2010C-3517] gb|EYV42584.1| hypothetical protein BX45_07600 [Escherichia coli O145:NM str. 2010C-3510] gb|EYV50913.1| hypothetical protein BX46_16380 [Escherichia coli O145:NM str. 2010C-3511] gb|EYV51368.1| hypothetical protein BX44_00270 [Escherichia coli O145:NM str. 2010C-3509] gb|EYV58733.1| hypothetical protein BX42_20070 [Escherichia coli O145:NM str. 2010C-3507] gb|EYW96324.1| hypothetical protein BX02_17045 [Escherichia coli O145:NM str. 08-4270] gb|EYZ19085.1| hypothetical protein BX67_08835 [Escherichia coli O145:NM str. 2010C-4557C2] gb|EYZ73397.1| hypothetical protein BW87_09035 [Escherichia coli O145:NM str. 06-3484] gb|EZE96360.1| hypothetical protein BX43_00800 [Escherichia coli O145:NM str. 2010C-3508] gb|EZJ83174.1| phoP regulatory network YrbL family protein [Escherichia coli 1-250-04_S3_C1] gb|AHY66918.1| Putative uncharacterized protein YrbL [Escherichia coli O145:H28 str. RM12761] gb|AHY72643.1| Putative uncharacterized protein YrbL [Escherichia coli O145:H28 str. RM12581] gb|KDM79975.1| hypothetical protein DC24_13250 [Escherichia coli] gb|KDM83204.1| hypothetical protein DC23_09095 [Escherichia coli O145:H28 str. 4865/96] gb|KDT03652.1| phoP regulatory network YrbL family protein [Escherichia coli 2-011-08_S4_C1] gb|KDT16448.1| phoP regulatory network YrbL family protein [Escherichia coli 2-011-08_S4_C3] gb|KDT90994.1| phoP regulatory network YrbL family protein [Escherichia coli 3-475-03_S1_C1] gb|KDX39241.1| phoP regulatory network YrbL family protein [Escherichia coli 2-156-04_S4_C3] gb|KDX61278.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S4_C2] gb|KDX69408.1| phoP regulatory network YrbL family protein [Escherichia coli 2-210-07_S4_C3] gb|KEM87998.1| phoP regulatory network YrbL family protein [Escherichia coli 2-222-05_S4_C1] gb|KEO29355.1| phoP regulatory network YrbL family protein [Escherichia coli 1-250-04_S3_C2] gb|KHH83487.1| hypothetical protein PU51_06275 [Escherichia coli] gb|KHI40461.1| hypothetical protein PU31_22415 [Escherichia coli] gb|KJW48588.1| hypothetical protein UN91_15695 [Escherichia coli] gb|KJW51140.1| hypothetical protein UN90_07540 [Escherichia coli] gb|KNF18129.1| hypothetical protein WQ85_13810 [Escherichia coli] gb|KNF47565.1| hypothetical protein WR02_16265 [Escherichia coli] gb|KNG41057.1| hypothetical protein WR20_05960 [Escherichia coli] gb|KNZ17116.1| hypothetical protein AGA30_03465 [Escherichia coli] gb|KPP04503.1| hypothetical protein ACU98_09745 [Escherichia coli] gb|KPP15386.1| hypothetical protein ACU67_04675 [Escherichia coli] gb|KUH19798.1| hypothetical protein ARC89_14510 [Escherichia coli] gb|KUH24954.1| hypothetical protein ARC98_16550 [Escherichia coli] gb|KXP28430.1| hypothetical protein AUP75_00330 [Escherichia coli] gb|KXP70142.1| hypothetical protein AUQ08_15310 [Escherichia coli] gb|KXQ00758.1| hypothetical protein AUP85_03570 [Escherichia coli] gb|KXQ31487.1| hypothetical protein AUQ03_10580 [Escherichia coli] gb|KXR39323.1| hypothetical protein AUQ24_02955 [Escherichia coli] gb|KXR60199.1| hypothetical protein AUQ32_01575 [Escherichia coli] gb|KXR67441.1| hypothetical protein AUQ11_00685 [Escherichia coli] gb|KYR30086.1| hypothetical protein AML02_09080 [Escherichia coli] gb|KYS43551.1| hypothetical protein AML25_11025 [Escherichia coli] gb|KYS92266.1| hypothetical protein AML35_13805 [Escherichia coli] gb|KZP44378.1| hypothetical protein XF28_16715 [Escherichia coli] gb|OEL54733.1| hypothetical protein BHF04_03225 [Escherichia coli] gb|OEM46441.1| hypothetical protein BHF27_15215 [Escherichia coli] gb|OEN36859.1| hypothetical protein BHF46_07395 [Escherichia coli] gb|OEO04385.1| hypothetical protein BHF57_04775 [Escherichia coli] gb|OJP04546.1| hypothetical protein BK333_13095 [Escherichia coli] gb|APK60588.1| hypothetical protein RG47_03180 [Escherichia coli] gb|APK65205.1| hypothetical protein RG48_03550 [Escherichia coli] gb|APL41178.1| hypothetical protein RG64_00330 [Escherichia coli] gb|APL75708.1| hypothetical protein RG71_11870 [Escherichia coli] gb|OKT13345.1| hypothetical protein ACN61_16985 [Escherichia coli] gb|OKT48688.1| hypothetical protein ACN65_10795 [Escherichia coli] gb|OKU93163.1| hypothetical protein ACN87_11075 [Escherichia coli] gb|OKV27263.1| hypothetical protein AWP49_19320 [Escherichia coli] gb|OKV84725.1| hypothetical protein AWP66_11850 [Escherichia coli] gb|OKW98555.1| hypothetical protein AWP80_13725 [Escherichia coli] gb|OKX62256.1| hypothetical protein AWP95_27300 [Escherichia coli] gb|OMH02785.1| hypothetical protein BW691_13290 [Escherichia coli] gb|OMI42415.1| hypothetical protein MP33_21005 [Escherichia coli N37058PS] gb|OMI53168.1| hypothetical protein MP34_09010 [Escherichia coli N37122PS] gb|OMI60793.1| hypothetical protein Q676_01615 [Escherichia coli N40607] gb|OMI63750.1| hypothetical protein EP55_22430 [Escherichia coli N37139PS] gb|OMI63971.1| hypothetical protein MP32_22005 [Escherichia coli N36410PS] gb|OOC67434.1| hypothetical protein BWP13_15160 [Escherichia coli] gb|OOH69853.1| hypothetical protein BMT63_22360 [Escherichia coli] gb|OON57558.1| hypothetical protein BV389_01115 [Escherichia coli] gb|AQV81670.1| hypothetical protein BE962_27250 [Escherichia coli] gb|AQZ75601.1| PhoP regulatory network protein YrbL [Escherichia coli] gb|OSK64576.1| putative cytoplasmic protein [Escherichia coli B921] gb|OSL69437.1| hypothetical protein EAXG_04096 [Escherichia coli TA054] gb|OTC13742.1| hypothetical protein AW074_13830 [Escherichia coli] gb|OTD35656.1| hypothetical protein AW095_11545 [Escherichia coli] gb|OTE54014.1| hypothetical protein AW119_03105 [Escherichia coli] gb|OUK71887.1| hypothetical protein BZL34_05310 [Escherichia coli] gb|OWC76023.1| hypothetical protein A8F85_17070 [Escherichia coli] gb|OWD01323.1| hypothetical protein A8F80_01225 [Escherichia coli] gb|OWD09629.1| hypothetical protein A8C74_14870 [Escherichia coli] gb|OWD64506.1| hypothetical protein A8C65_02090 [Escherichia coli] gb|OWG46133.1| hypothetical protein CCE24_08100 [Escherichia coli] gb|OWG62555.1| hypothetical protein CCE08_02430 [Escherichia coli] gb|OWG99578.1| hypothetical protein CCE15_08095 [Escherichia coli] gb|OWH18028.1| hypothetical protein CCE22_08100 [Escherichia coli] gb|OWH27606.1| hypothetical protein CCE09_07280 [Escherichia coli] gb|OYI56649.1| hypothetical protein CI688_11725 [Shigella sonnei] gb|OYI67080.1| hypothetical protein CI685_20260 [Shigella sonnei] gb|OYJ23404.1| hypothetical protein CI684_03015 [Shigella sonnei] gb|OZP08825.1| hypothetical protein CG692_07380 [Escherichia coli] gb|PAC23425.1| hypothetical protein CDH62_08650 [Escherichia coli] gb|PAY81978.1| hypothetical protein CEG94_22130 [Shigella boydii] gb|PBK07742.1| hypothetical protein CMR95_17150 [Escherichia coli] gb|PBO96924.1| hypothetical protein CI703_01565 [Shigella sonnei] gb|PBS22525.1| hypothetical protein A7H83_18525 [Escherichia coli] gb|PBT40076.1| hypothetical protein A9819_18390 [Escherichia coli] gb|PCS37332.1| protein YrbL [Escherichia coli] gb|PDS21046.1| hypothetical protein CMR87_02185 [Escherichia coli] gb|PDV60472.1| hypothetical protein BER10_01870 [Escherichia coli] gb|PDV78608.1| hypothetical protein BER07_00520 [Escherichia coli] gb|PHL27565.1| protein YrbL [Escherichia coli] gb|PJF57687.1| protein YrbL [Escherichia coli] gb|PJF62055.1| protein YrbL [Escherichia coli] gb|PJF67516.1| protein YrbL [Escherichia coli] gb|PJF72299.1| protein YrbL [Escherichia coli] gb|PJG07752.1| protein YrbL [Escherichia coli] gb|PKJ19232.1| protein YrbL [Escherichia coli] gb|AUJ97650.1| protein YrbL [Escherichia coli] gb|PMD82980.1| hypothetical protein A8A11_01875 [Escherichia coli] gb|POH48117.1| protein YrbL [Escherichia coli] gb|PPV58186.1| protein YrbL [Escherichia coli] gb|PPW03534.1| protein YrbL [Escherichia coli] gb|PPW23485.1| protein YrbL [Escherichia coli] gb|PPW42304.1| protein YrbL [Escherichia coli] gb|PPW98228.1| protein YrbL [Escherichia coli] gb|PPX54284.1| protein YrbL [Escherichia coli] gb|PRP45986.1| protein YrbL [Escherichia coli] Length = 210 Score = 404 bits (1038), Expect = e-142 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEED+A Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDVAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_032230224.1| protein YrbL [Escherichia coli] gb|EYE11226.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S3_C3] gb|EYE18805.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S3_C2] gb|EYE21036.1| phoP regulatory network YrbL family protein [Escherichia coli 1-110-08_S3_C1] Length = 210 Score = 404 bits (1037), Expect = e-141 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKE+RRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKELRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_105484645.1| protein YrbL [Escherichia coli] Length = 210 Score = 403 bits (1036), Expect = e-141 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTG+HRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGKHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_097309321.1| protein YrbL [Escherichia coli] Length = 210 Score = 403 bits (1036), Expect = e-141 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGE+TLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGENTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_078279574.1| protein YrbL [Escherichia coli] Length = 210 Score = 403 bits (1036), Expect = e-141 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIP+VCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPLVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSREA Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSREA 210 >ref|WP_044863660.1| protein YrbL [Escherichia coli] gb|KQJ06953.1| hypothetical protein AM264_05420 [Escherichia coli] gb|ARD52997.1| hypothetical protein BHT24_17670 [Escherichia coli] gb|ARJ94610.1| hypothetical protein BCD20_03110 [Escherichia coli] gb|OWC70895.1| hypothetical protein A8F87_01105 [Escherichia coli] gb|PDM45773.1| protein YrbL [Escherichia coli] gb|AUO39915.1| protein YrbL [Escherichia coli] Length = 210 Score = 403 bits (1036), Expect = e-141 Identities = 196/210 (93%), Positives = 197/210 (93%) Frame = -3 Query: 686 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 507 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW Sbjct: 1 MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW 60 Query: 506 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAXXXXXXXXXXXX 327 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIA Sbjct: 61 SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY 120 Query: 326 XQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 147 QDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR Sbjct: 121 LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR 180 Query: 146 FIAQPALAIALQKDLQPRESKTLALTSREA 57 FIAQPALAIALQKDLQPRESKTLALTSR+A Sbjct: 181 FIAQPALAIALQKDLQPRESKTLALTSRQA 210