BLASTX nr result
ID: Acanthopanax22_contig00000089
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax22_contig00000089
(611 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|WP_001307439.1| DUF1795 domain-containing protein [Shigella ... 384 e-134
gb|AHA67612.1| DcrB protein precursor [Shigella dysenteriae 1617... 384 e-134
gb|ABB67954.1| conserved hypothetical protein [Shigella boydii S... 383 e-134
gb|EGI19148.1| protein DcrB [Escherichia coli M718] 383 e-134
gb|ABE09417.1| hypothetical protein UTI89_C3988 [Escherichia col... 382 e-134
gb|AAN82701.1|AE016768_119 DcrB protein precursor [Escherichia c... 380 e-133
ref|WP_001322924.1| DUF1795 domain-containing protein [Escherich... 376 e-131
gb|ESD74604.1| protein DcrB [Escherichia coli 908555] 376 e-131
gb|ABJ02948.1| conserved hypothetical protein [Escherichia coli ... 374 e-131
gb|EEJ49963.1| protein DcrB [Escherichia coli 83972] >gi|3002979... 372 e-130
ref|WP_089695780.1| DUF1795 domain-containing protein [Escherich... 346 e-119
ref|WP_001245295.1| MULTISPECIES: protein DcrB [Proteobacteria] ... 346 e-119
ref|WP_001679728.1| MULTISPECIES: protein DcrB [Enterobacteriace... 346 e-119
ref|WP_039065249.1| DUF1795 domain-containing protein [Shigella ... 346 e-119
ref|WP_044806638.1| hypothetical protein [Escherichia coli] 345 e-119
ref|WP_032215610.1| protein DcrB [Escherichia coli] >gi|66011666... 345 e-119
ref|WP_032265821.1| protein DcrB [Escherichia coli] >gi|65012051... 345 e-119
gb|EFP72389.1| hypothetical protein SD1617_2271 [Shigella dysent... 345 e-119
ref|WP_100209778.1| DUF1795 domain-containing protein [Escherich... 345 e-119
ref|WP_097733733.1| DUF1795 domain-containing protein [Escherich... 345 e-119
>ref|WP_001307439.1| DUF1795 domain-containing protein [Shigella flexneri]
ref|NP_709242.3| hypothetical protein SF3490 [Shigella flexneri 2a str. 301]
gb|AAG58581.1|AE005570_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
gb|AAB18447.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
dbj|BAB37744.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
gb|AAN44949.1| conserved hypothetical protein [Shigella flexneri 2a str. 301]
gb|AAP19233.1| hypothetical protein S4273 [Shigella flexneri 2a str. 2457T]
gb|AAZ90256.1| conserved hypothetical protein [Shigella sonnei Ss046]
gb|ABB63593.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
gb|ACI76276.1| hypothetical protein ECs4321 [Escherichia coli]
gb|ACI76277.1| hypothetical protein ECs4321 [Escherichia coli]
gb|ACI76278.1| hypothetical protein ECs4321 [Escherichia coli]
gb|ACI76279.1| hypothetical protein ECs4321 [Escherichia coli]
gb|ACI76280.1| hypothetical protein ECs4321 [Escherichia coli]
gb|EFE61334.1| hypothetical protein ECCG_03867 [Escherichia coli B088]
gb|EFF04437.1| dcrB protein [Escherichia coli B185]
gb|EFF11033.1| conserved hypothetical protein [Escherichia coli B354]
gb|ADX48929.1| hypothetical protein EKO11_0269 [Escherichia coli KO11FL]
gb|EGI08692.1| protein DcrB [Escherichia coli H736]
gb|EGI39264.1| protein DcrB [Escherichia coli TA280]
gb|EGI44037.1| protein DcrB [Escherichia coli H591]
gb|EGJ07725.1| protein DcrB [Escherichia coli D9]
emb|CCK48777.1| hypothetical protein BN16_41051 [Escherichia coli chi7122]
emb|CCJ46090.1| hypothetical protein BN17_34091 [Escherichia coli]
emb|CQR82887.1| periplasmic protein, predicted lipoprotein [Escherichia coli K-12]
gb|AKK14752.2| putative lipoprotein [Escherichia coli K-12]
gb|AKK19192.2| putative lipoprotein [Escherichia coli K-12]
gb|OSK20255.1| protein DcrB [Escherichia coli M056]
gb|OSK90502.1| protein DcrB [Escherichia coli TA447]
gb|OSL03315.1| protein DcrB [Escherichia coli H386]
gb|OSL27217.1| protein DcrB [Escherichia coli H617]
gb|OSL52615.1| protein DcrB [Escherichia coli H454]
gb|OSL59024.1| protein DcrB [Escherichia coli H420]
Length = 203
Score = 384 bits (987), Expect = e-134
Identities = 194/195 (99%), Positives = 195/195 (100%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPADDQQKAQTTAEN
Sbjct: 181 LPADDQQKAQTTAEN 195
>gb|AHA67612.1| DcrB protein precursor [Shigella dysenteriae 1617]
gb|ESU79737.1| DcrB protein precursor [Shigella dysenteriae WRSd3]
gb|ESU85104.1| DcrB protein precursor [Shigella dysenteriae WRSd5]
Length = 203
Score = 384 bits (986), Expect = e-134
Identities = 193/195 (98%), Positives = 195/195 (100%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLL+MGLAACDDKDTNATAQGSVAESNATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLIMGLAACDDKDTNATAQGSVAESNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPADDQQKAQTTAEN
Sbjct: 181 LPADDQQKAQTTAEN 195
>gb|ABB67954.1| conserved hypothetical protein [Shigella boydii Sb227]
Length = 203
Score = 383 bits (984), Expect = e-134
Identities = 193/195 (98%), Positives = 195/195 (100%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAE+NATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAENNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPADDQQKAQTTAEN
Sbjct: 181 LPADDQQKAQTTAEN 195
>gb|EGI19148.1| protein DcrB [Escherichia coli M718]
Length = 203
Score = 383 bits (983), Expect = e-134
Identities = 193/195 (98%), Positives = 195/195 (100%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDD+DTNATAQGSVAESNATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDQDTNATAQGSVAESNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPADDQQKAQTTAEN
Sbjct: 181 LPADDQQKAQTTAEN 195
>gb|ABE09417.1| hypothetical protein UTI89_C3988 [Escherichia coli UTI89]
gb|EGI13921.1| protein DcrB [Escherichia coli M605]
emb|CDN84211.1| hypothetical protein EC958_3866 [Escherichia coli O25b:H4-ST131]
gb|ANK03964.1| dcrB [Escherichia coli O25b:H4]
gb|OSK08757.1| hypothetical protein EAOG_03696 [Escherichia coli R527]
gb|OSK48201.1| protein DcrB [Escherichia coli H588]
gb|OSL34230.1| protein DcrB [Escherichia coli TA464]
gb|OSL41743.1| protein DcrB [Escherichia coli H461]
Length = 203
Score = 382 bits (982), Expect = e-134
Identities = 193/195 (98%), Positives = 195/195 (100%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPAD+QQKAQTTAEN
Sbjct: 181 LPADNQQKAQTTAEN 195
>gb|AAN82701.1|AE016768_119 DcrB protein precursor [Escherichia coli CFT073]
Length = 203
Score = 380 bits (976), Expect = e-133
Identities = 192/195 (98%), Positives = 194/195 (99%)
Frame = +3
Query: 27 VIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP 206
+IRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNA AQGSVAESNATGNP
Sbjct: 1 MIRWMNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNAMAQGSVAESNATGNP 60
Query: 207 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 386
VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR
Sbjct: 61 VNLLDGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKR 120
Query: 387 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 566
LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT
Sbjct: 121 LEDQQRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQIT 180
Query: 567 LPADDQQKAQTTAEN 611
LPAD+QQKAQTTAEN
Sbjct: 181 LPADNQQKAQTTAEN 195
>ref|WP_001322924.1| DUF1795 domain-containing protein [Escherichia coli]
dbj|BAI27729.1| periplasmic protein DcrB [Escherichia coli O26:H11 str. 11368]
dbj|BAI32900.1| periplasmic protein DcrB [Escherichia coli O103:H2 str. 12009]
dbj|BAI38048.1| periplasmic protein DcrB [Escherichia coli O111:H- str. 11128]
gb|EFJ66176.1| protein DcrB [Escherichia coli MS 175-1]
gb|EFJ73420.1| protein DcrB [Escherichia coli MS 198-1]
gb|EFJ83216.1| protein DcrB [Escherichia coli MS 69-1]
gb|EFJ84424.1| protein DcrB [Escherichia coli MS 84-1]
gb|EFJ99252.1| protein DcrB [Escherichia coli MS 115-1]
gb|EFK00491.1| protein DcrB [Escherichia coli MS 182-1]
gb|EFK17192.1| protein DcrB [Escherichia coli MS 116-1]
gb|EFK21882.1| protein DcrB [Escherichia coli MS 21-1]
gb|EFK24658.1| protein DcrB [Escherichia coli MS 187-1]
gb|EFK45791.1| protein DcrB [Escherichia coli MS 119-7]
gb|EFK53277.1| protein DcrB [Escherichia coli MS 107-1]
gb|EFK66532.1| protein DcrB [Escherichia coli MS 124-1]
gb|EFK71906.1| protein DcrB [Escherichia coli MS 78-1]
gb|EFK90631.1| protein DcrB [Escherichia coli MS 146-1]
gb|EFO59064.1| protein DcrB [Escherichia coli MS 145-7]
gb|EFU36038.1| protein DcrB [Escherichia coli MS 85-1]
gb|EGB87829.1| protein DcrB [Escherichia coli MS 117-3]
gb|EGU98778.1| protein DcrB [Escherichia coli MS 79-10]
gb|ESA62183.1| protein DcrB [Escherichia coli 113303]
gb|ESA68492.1| protein DcrB [Escherichia coli 113290]
gb|ESA73461.1| protein DcrB [Escherichia coli 110957]
gb|ESA80545.1| protein DcrB [Escherichia coli 907357]
gb|ESA88249.1| protein DcrB [Escherichia coli 909945-2]
gb|ESA89944.1| protein DcrB [Escherichia coli 907713]
gb|ESC90366.1| protein DcrB [Escherichia coli 113302]
gb|ESD06162.1| protein DcrB [Escherichia coli 907672]
gb|ESD23839.1| protein DcrB [Escherichia coli 907710]
gb|ESD29557.1| protein DcrB [Escherichia coli 907889]
gb|ESD31457.1| protein DcrB [Escherichia coli 907715]
gb|ESD55521.1| protein DcrB [Escherichia coli 908521]
gb|ESD65971.1| protein DcrB [Escherichia coli 908525]
gb|ESD70864.1| protein DcrB [Escherichia coli 908541]
gb|ESD80590.1| protein DcrB [Escherichia coli 908573]
gb|ESD89088.1| protein DcrB [Escherichia coli 908616]
gb|ESD93512.1| protein DcrB [Escherichia coli 908585]
gb|ESE06631.1| protein DcrB [Escherichia coli 908658]
gb|ALY15014.1| hypothetical protein ACN002_3556 [Escherichia coli]
gb|KXH02844.1| protein DcrB [Escherichia coli]
gb|OXB29571.1| Protein dcrB [Shigella flexneri 2a str. 301]
Length = 199
Score = 376 bits (966), Expect = e-131
Identities = 191/191 (100%), Positives = 191/191 (100%)
Frame = +3
Query: 39 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 218
MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL
Sbjct: 1 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 60
Query: 219 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 398
DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ
Sbjct: 61 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 120
Query: 399 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 578
QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD
Sbjct: 121 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 180
Query: 579 DQQKAQTTAEN 611
DQQKAQTTAEN
Sbjct: 181 DQQKAQTTAEN 191
>gb|ESD74604.1| protein DcrB [Escherichia coli 908555]
Length = 199
Score = 376 bits (966), Expect = e-131
Identities = 191/191 (100%), Positives = 191/191 (100%)
Frame = +3
Query: 39 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 218
MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL
Sbjct: 1 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 60
Query: 219 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 398
DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ
Sbjct: 61 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 120
Query: 399 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 578
QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD
Sbjct: 121 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 180
Query: 579 DQQKAQTTAEN 611
DQQKAQTTAEN
Sbjct: 181 DQQKAQTTAEN 191
>gb|ABJ02948.1| conserved hypothetical protein [Escherichia coli APEC O1]
emb|CAS11261.1| periplasmic protein [Escherichia coli O127:H6 str. E2348/69]
gb|EFJ60759.1| protein DcrB [Escherichia coli MS 200-1]
gb|EFU45555.1| protein DcrB [Escherichia coli MS 110-3]
gb|EFU55267.1| protein DcrB [Escherichia coli MS 16-3]
gb|EGB78579.1| protein DcrB [Escherichia coli MS 57-2]
gb|EGB83789.1| protein DcrB [Escherichia coli MS 60-1]
gb|ESA88481.1| protein DcrB [Escherichia coli 907779]
gb|ESC93970.1| protein DcrB [Escherichia coli 907446]
gb|ESD10934.1| protein DcrB [Escherichia coli 907700]
gb|ESD21352.1| protein DcrB [Escherichia coli 907701]
gb|ESD39227.1| protein DcrB [Escherichia coli 908519]
gb|ESD60441.1| protein DcrB [Escherichia coli 908524]
gb|ESE02930.1| protein DcrB [Escherichia coli 908624]
gb|ESE05114.1| protein DcrB [Escherichia coli 908632]
gb|ESE21696.1| protein DcrB [Escherichia coli 908691]
gb|ESE22844.1| protein DcrB [Escherichia coli 910096-2]
gb|ESE23790.1| protein DcrB [Escherichia coli 908675]
gb|ESE34862.1| protein DcrB [Escherichia coli A35218R]
gb|OSK50679.1| protein DcrB [Escherichia coli H413]
emb|SLM08558.1| hypothetical protein BQ9544_3713 [Escherichia coli O127:H6]
emb|SNU19635.1| hypothetical protein BQ9550_3713 [Escherichia coli O127:H6]
Length = 199
Score = 374 bits (961), Expect = e-131
Identities = 190/191 (99%), Positives = 191/191 (100%)
Frame = +3
Query: 39 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 218
MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL
Sbjct: 1 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 60
Query: 219 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 398
DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ
Sbjct: 61 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 120
Query: 399 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 578
QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD
Sbjct: 121 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 180
Query: 579 DQQKAQTTAEN 611
+QQKAQTTAEN
Sbjct: 181 NQQKAQTTAEN 191
>gb|EEJ49963.1| protein DcrB [Escherichia coli 83972]
gb|EFJ54317.1| protein DcrB [Escherichia coli MS 185-1]
gb|EFJ91645.1| protein DcrB [Escherichia coli MS 45-1]
gb|EFU51029.1| protein DcrB [Escherichia coli MS 153-1]
gb|AER86464.1| hypothetical protein i02_3935 [Escherichia coli str. 'clone D i2']
gb|AER91383.1| hypothetical protein i14_3935 [Escherichia coli str. 'clone D i14']
gb|ESC98268.1| protein DcrB [Escherichia coli 907391]
gb|ESD39930.1| protein DcrB [Escherichia coli 907892]
gb|ESE38231.1| protein DcrB [Escherichia coli A25922R]
gb|KXH00296.1| protein DcrB [Escherichia coli]
Length = 199
Score = 372 bits (955), Expect = e-130
Identities = 189/191 (98%), Positives = 190/191 (99%)
Frame = +3
Query: 39 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLL 218
MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNA AQGSVAESNATGNPVNLL
Sbjct: 1 MNEPLWPFIERKKSMRNLVKYVGIGLLVMGLAACDDKDTNAMAQGSVAESNATGNPVNLL 60
Query: 219 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 398
DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ
Sbjct: 61 DGKLSFSLPADMTDQSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQ 120
Query: 399 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 578
QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD
Sbjct: 121 QRSRDPQLQVVTNKAIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPAD 180
Query: 579 DQQKAQTTAEN 611
+QQKAQTTAEN
Sbjct: 181 NQQKAQTTAEN 191
>ref|WP_089695780.1| DUF1795 domain-containing protein [Escherichia coli]
Length = 185
Score = 346 bits (887), Expect = e-119
Identities = 177/177 (100%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_001245295.1| MULTISPECIES: protein DcrB [Proteobacteria]
ref|NP_417929.4| putative lipoprotein [Escherichia coli str. K-12 substr. MG1655]
ref|YP_405084.2| hypothetical protein SDY_3623 [Shigella dysenteriae Sd197]
ref|NP_312348.3| hypothetical protein ECs4321 [Escherichia coli O157:H7 str. Sakai]
ref|YP_002409846.1| hypothetical protein ECIAI39_3953 [Escherichia coli IAI39]
ref|YP_002414586.1| hypothetical protein ECUMN_3935 [Escherichia coli UMN026]
ref|YP_006777069.1| hypothetical protein O3K_01695 [Escherichia coli O104:H4 str.
2011C-3493]
sp|P0AEE1.1|DCRB_ECOLI RecName: Full=Protein DcrB; Flags: Precursor
sp|P0AEE2.1|DCRB_SHIFL RecName: Full=Protein DcrB; Flags: Precursor
dbj|BAE77821.1| periplasmic protein [Escherichia coli str. K-12 substr. W3110]
gb|AAC76497.2| putative lipoprotein [Escherichia coli str. K-12 substr. MG1655]
gb|ABF05514.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
gb|ABV07884.1| putative lipoprotein [Escherichia coli HS]
gb|ABV20960.1| putative lipoprotein [Escherichia coli O139:H28 str. E24377A]
gb|ACA75923.1| conserved hypothetical protein [Escherichia coli ATCC 8739]
gb|ACB04528.1| periplasmic protein [Escherichia coli str. K-12 substr. DH10B]
gb|ACB16700.1| putative lipoprotein [Escherichia coli SMS-3-5]
gb|ACD10451.1| putative lipoprotein [Shigella boydii CDC 3083-94]
gb|EDU35575.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4196]
gb|EDU56593.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4113]
gb|EDU64469.1| putative lipoprotein [Escherichia coli 53638]
gb|EDU71542.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4076]
gb|EDU77279.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4401]
gb|EDU83179.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4486]
gb|EDU87957.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4501]
gb|EDU92852.1| putative lipoprotein [Escherichia coli O157:H7 str. EC869]
gb|EDU98335.1| putative lipoprotein [Escherichia coli O157:H7 str. EC508]
gb|EDV60181.1| putative lipoprotein [Escherichia coli B7A]
gb|EDV85203.1| putative lipoprotein [Escherichia coli E22]
gb|EDV85670.1| putative lipoprotein [Escherichia coli E110019]
gb|EDV88392.1| putative lipoprotein [Escherichia coli E110019]
gb|EDX41426.1| putative lipoprotein [Escherichia coli 101-1]
gb|EDZ75449.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4206]
gb|EDZ83469.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4045]
gb|EDZ89133.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4042]
gb|ACI39277.1| putative lipoprotein [Escherichia coli O157:H7 str. EC4115]
dbj|BAG79264.1| conserved hypothetical protein [Escherichia coli SE11]
gb|EEC30221.1| putative lipoprotein [Escherichia coli O157:H7 str. TW14588]
emb|CAV00287.1| periplasmic protein [Escherichia coli 55989]
emb|CAR20065.1| periplasmic protein [Escherichia coli IAI39]
emb|CAR15081.1| periplasmic protein [Escherichia coli UMN026]
gb|ACR64004.1| periplasmic protein [Escherichia coli BW2952]
emb|CAQ33791.1| conserved protein involved in bacteriophage adsorption [Escherichia
coli BL21(DE3)]
gb|ACT27345.1| conserved hypothetical protein [Escherichia coli
'BL21-Gold(DE3)pLysS AG']
gb|ACT40968.1| periplasmic protein [Escherichia coli B str. REL606]
gb|ACT45123.1| putative lipoprotein [Escherichia coli BL21(DE3)]
gb|ACT74153.1| periplasmic protein; required for phage C1 adsorption [Escherichia
coli O157:H7 str. TW14359]
gb|ACX37934.1| conserved hypothetical protein [Escherichia coli DH1]
gb|ADA75804.1| hypothetical protein SFxv_3806 [Shigella flexneri 2002017]
emb|CBG36558.1| putative lipoprotein [Escherichia coli 042]
gb|ADD58646.1| hypothetical protein G2583_4175 [Escherichia coli O55:H7 str.
CB9615]
gb|EFE98899.1| hypothetical protein ECGG_03748 [Escherichia coli FVEC1412]
gb|EFI18154.1| hypothetical protein ECFG_03954 [Escherichia coli FVEC1302]
gb|EFI89629.1| protein DcrB [Escherichia coli MS 196-1]
gb|EFN38505.1| conserved hypothetical protein [Escherichia coli W]
emb|CBJ03219.1| putative lipoprotein [Escherichia coli ETEC H10407]
gb|EFQ00845.1| conserved hypothetical protein [Escherichia coli 1827-70]
gb|EFS11681.1| hypothetical protein SF2457T_4229 [Shigella flexneri 2a str. 2457T]
gb|ADT77078.1| periplasmic protein [Escherichia coli W]
dbj|BAJ45205.1| hypothetical protein ECDH1ME8569_3349 [Escherichia coli DH1]
gb|EFU95381.1| conserved hypothetical protein [Escherichia coli 3431]
gb|EFW56871.1| DcrB protein precursor [Shigella boydii ATCC 9905]
gb|EFW66162.1| DcrB protein precursor [Escherichia coli O157:H7 str. EC1212]
gb|EFW74239.1| DcrB protein precursor [Escherichia coli EC4100B]
gb|EFX09350.1| hypothetical protein ECO5101_02050 [Escherichia coli O157:H7 str.
G5101]
gb|EFX14271.1| hypothetical protein ECO9389_01799 [Escherichia coli O157:H- str.
493-89]
gb|EFX19032.1| hypothetical protein ECO2687_04689 [Escherichia coli O157:H- str. H
2687]
gb|EFX23682.1| hypothetical protein ECO7815_03070 [Escherichia coli O55:H7 str.
3256-97]
gb|EFX28957.1| hypothetical protein ECO5905_02067 [Escherichia coli O55:H7 str.
USDA 5905]
gb|EFX33548.1| hypothetical protein ECOSU61_16155 [Escherichia coli O157:H7 str.
LSU-61]
gb|EFZ40514.1| hypothetical protein ECEPECA14_4002 [Escherichia coli EPECa14]
gb|EFZ48551.1| hypothetical protein ECE128010_1118 [Escherichia coli E128010]
gb|EFZ50596.1| hypothetical protein SS53G_4924 [Shigella sonnei 53G]
gb|EFZ59739.1| hypothetical protein ECLT68_1324 [Escherichia coli LT-68]
gb|EFZ64575.1| hypothetical protein ECOK1180_2076 [Escherichia coli OK1180]
gb|EFZ68338.1| hypothetical protein ECOK1357_3825 [Escherichia coli OK1357]
gb|EGB30942.1| DCRB protein dcrB [Escherichia coli E1520]
gb|EGB35521.1| dcrB protein [Escherichia coli E482]
gb|EGB40379.1| DCRB protein dcrB [Escherichia coli H120]
gb|EGB55327.1| dcrB protein [Escherichia coli H489]
gb|EGB61574.1| dcrB protein [Escherichia coli M863]
gb|EGB65346.1| dcrB protein [Escherichia coli TA007]
gb|EGB69997.1| dcrB protein [Escherichia coli TW10509]
gb|EGC10441.1| dcrB protein [Escherichia coli E1167]
gb|EGD61395.1| DcrB protein precursor [Escherichia coli O157:H7 str. 1044]
gb|EGD68438.1| DcrB protein precursor [Escherichia coli O157:H7 str. 1125]
gb|EGE62802.1| hypothetical protein ECSTEC7V_4096 [Escherichia coli STEC_7v]
gb|EGI29577.1| protein DcrB [Escherichia coli TA143]
gb|EGI34280.1| protein DcrB [Escherichia coli TA271]
gb|EGI90505.1| hypothetical protein SB521682_4067 [Shigella boydii 5216-82]
gb|AEE58761.1| hypothetical protein UMNK88_4242 [Escherichia coli UMNK88]
gb|EGJ79845.1| hypothetical protein SFK671_4774 [Shigella flexneri K-671]
gb|EGJ80686.1| hypothetical protein SF434370_4338 [Shigella flexneri 4343-70]
gb|EGJ81559.1| hypothetical protein SF274771_4795 [Shigella flexneri 2747-71]
gb|EGJ93784.1| hypothetical protein SF293071_4677 [Shigella flexneri 2930-71]
gb|EGK15886.1| hypothetical protein SFVA6_4921 [Shigella flexneri VA-6]
gb|EGK16204.1| hypothetical protein SFK272_4881 [Shigella flexneri K-272]
gb|EGK16773.1| hypothetical protein SFK218_5234 [Shigella flexneri K-218]
gb|EGK31961.1| hypothetical protein SFK304_5023 [Shigella flexneri K-304]
gb|EGK32363.1| hypothetical protein SFK227_4852 [Shigella flexneri K-227]
gb|EGM59459.1| hypothetical protein SFJ1713_4508 [Shigella flexneri SFJ17B]
gb|AEJ58870.1| hypothetical protein UMNF18_4389 [Escherichia coli UMNF18]
gb|EGR62127.1| hypothetical protein HUSEC41_19198 [Escherichia coli O104:H4 str.
01-09591]
gb|EGR72814.1| hypothetical protein HUSEC_19577 [Escherichia coli O104:H4 str.
LB226692]
gb|EGT69473.1| hypothetical protein C22711_3503 [Escherichia coli O104:H4 str.
C227-11]
gb|EGU25392.1| hypothetical protein IAE_18367 [Escherichia coli XH140A]
gb|EGV45902.1| hypothetical protein IAM_19609 [Escherichia coli XH001]
gb|EGW65094.1| hypothetical protein ECSTECC16502_4236 [Escherichia coli
STEC_C165-02]
gb|EGW65907.1| hypothetical protein EC253486_4494 [Escherichia coli 2534-86]
gb|EGW67294.1| hypothetical protein ECSTECB2F1_3773 [Escherichia coli STEC_B2F1]
gb|EGW80015.1| hypothetical protein ECSTEC94C_4173 [Escherichia coli STEC_94C]
gb|EGW81740.1| hypothetical protein EC30301_4020 [Escherichia coli 3030-1]
gb|EGW87359.1| hypothetical protein ECSTECDG1313_4537 [Escherichia coli
STEC_DG131-3]
gb|EGW91640.1| hypothetical protein ECSTECEH250_4167 [Escherichia coli STEC_EH250]
gb|EGX02121.1| hypothetical protein ECSTECMHI813_3814 [Escherichia coli
STEC_MHI813]
gb|EGX03149.1| hypothetical protein ECG581_3915 [Escherichia coli G58-1]
gb|EGX05570.1| hypothetical protein ECSTECH18_4325 [Escherichia coli STEC_H.1.8]
gb|EGX15299.1| hypothetical protein ECSTECS1191_4525 [Escherichia coli STEC_S1191]
gb|EGX20760.1| hypothetical protein ECTX1999_4104 [Escherichia coli TX1999]
gb|AEQ14705.1| periplasmic protein, predicted lipoprotein [Escherichia coli O7:K1
str. CE10]
gb|EHF19235.1| protein dcrB [Escherichia coli O104:H4 str. C236-11]
gb|EHF23674.1| protein dcrB [Escherichia coli O104:H4 str. C227-11]
gb|EHF24560.1| protein dcrB [Escherichia coli O104:H4 str. 04-8351]
gb|EHF31673.1| protein dcrB [Escherichia coli O104:H4 str. 09-7901]
gb|EHF38171.1| protein dcrB [Escherichia coli O104:H4 str. 11-3677]
gb|EHF46996.1| protein dcrB [Escherichia coli O104:H4 str. 11-4404]
gb|EHF50846.1| protein dcrB [Escherichia coli O104:H4 str. 11-4522]
gb|EHF55117.1| protein dcrB [Escherichia coli O104:H4 str. 11-4623]
gb|EHF66806.1| protein dcrB [Escherichia coli O104:H4 str. 11-4632 C1]
gb|EHF69408.1| protein dcrB [Escherichia coli O104:H4 str. 11-4632 C2]
gb|EHF71365.1| protein dcrB [Escherichia coli O104:H4 str. 11-4632 C3]
gb|EHF74118.1| protein dcrB [Escherichia coli O104:H4 str. 11-4632 C4]
gb|EHF81732.1| protein dcrB [Escherichia coli O104:H4 str. 11-4632 C5]
dbj|BAL40077.1| periplasmic protein [Escherichia coli str. K-12 substr. MDS42]
gb|EHN82413.1| protein dcrB [Escherichia coli H494]
gb|EHN84943.1| protein dcrB [Escherichia coli TA124]
gb|EHN93036.1| dcrB [Escherichia coli E101]
gb|EHN97739.1| dcrB [Escherichia coli B093]
gb|EHP64719.1| protein dcrB [Escherichia coli 4_1_47FAA]
gb|AEZ42545.1| hypothetical protein ECO55CA74_19955 [Escherichia coli O55:H7 str.
RM12579]
gb|EHU54634.1| hypothetical protein ECDEC3A_4441 [Escherichia coli DEC3A]
gb|EHU56533.1| hypothetical protein ECDEC3B_4554 [Escherichia coli DEC3B]
gb|EHU67412.1| hypothetical protein ECDEC3C_4793 [Escherichia coli DEC3C]
gb|EHU71467.1| hypothetical protein ECDEC3D_4561 [Escherichia coli DEC3D]
gb|EHU72948.1| hypothetical protein ECDEC3E_4765 [Escherichia coli DEC3E]
gb|EHU82349.1| hypothetical protein ECDEC3F_4650 [Escherichia coli DEC3F]
gb|EHU88058.1| hypothetical protein ECDEC4A_4300 [Escherichia coli DEC4A]
gb|EHU91516.1| hypothetical protein ECDEC4B_4493 [Escherichia coli DEC4B]
gb|EHV02188.1| hypothetical protein ECDEC4D_4351 [Escherichia coli DEC4D]
gb|EHV03156.1| hypothetical protein ECDEC4C_4385 [Escherichia coli DEC4C]
gb|EHV08814.1| hypothetical protein ECDEC4E_4423 [Escherichia coli DEC4E]
gb|EHV18044.1| hypothetical protein ECDEC4F_4303 [Escherichia coli DEC4F]
gb|EHV21584.1| hypothetical protein ECDEC5A_4202 [Escherichia coli DEC5A]
gb|EHV26240.1| hypothetical protein ECDEC5B_4564 [Escherichia coli DEC5B]
gb|EHV34148.1| hypothetical protein ECDEC5C_4229 [Escherichia coli DEC5C]
gb|EHV35643.1| hypothetical protein ECDEC5D_4350 [Escherichia coli DEC5D]
gb|EHV44111.1| protein dcrB [Escherichia coli DEC5E]
gb|EHV52827.1| hypothetical protein ECDEC6B_4472 [Escherichia coli DEC6B]
gb|EHV53960.1| protein dcrB [Escherichia coli DEC6A]
gb|EHV56759.1| protein dcrB [Escherichia coli DEC6C]
gb|EHV67631.1| protein dcrB [Escherichia coli DEC6D]
gb|EHV70052.1| hypothetical protein ECDEC6E_4106 [Escherichia coli DEC6E]
gb|EHV75976.1| protein dcrB [Escherichia coli DEC7A]
gb|EHV84348.1| hypothetical protein ECDEC7C_4050 [Escherichia coli DEC7C]
gb|EHV87835.1| hypothetical protein ECDEC7D_4258 [Escherichia coli DEC7D]
gb|EHV98556.1| protein dcrB [Escherichia coli DEC7E]
gb|EHW06552.1| protein dcrB [Escherichia coli DEC8A]
gb|EHW06786.1| hypothetical protein ECDEC8B_4491 [Escherichia coli DEC8B]
gb|EHW12055.1| hypothetical protein ECDEC8C_5172 [Escherichia coli DEC8C]
gb|EHW20919.1| hypothetical protein ECDEC8D_4666 [Escherichia coli DEC8D]
gb|EHW24235.1| hypothetical protein ECDEC8E_4444 [Escherichia coli DEC8E]
gb|EHW31653.1| hypothetical protein ECDEC9A_4534 [Escherichia coli DEC9A]
gb|EHW36399.1| hypothetical protein ECDEC9B_4157 [Escherichia coli DEC9B]
gb|EHW42399.1| hypothetical protein ECDEC9C_4234 [Escherichia coli DEC9C]
gb|EHW49379.1| hypothetical protein ECDEC9D_4150 [Escherichia coli DEC9D]
gb|EHW52611.1| hypothetical protein ECDEC9E_4645 [Escherichia coli DEC9E]
gb|EHW59394.1| hypothetical protein ECDEC10A_4624 [Escherichia coli DEC10A]
gb|EHW64568.1| hypothetical protein ECDEC10B_4941 [Escherichia coli DEC10B]
gb|EHW69340.1| hypothetical protein ECDEC10C_5021 [Escherichia coli DEC10C]
gb|EHW74866.1| hypothetical protein ECDEC10D_4481 [Escherichia coli DEC10D]
gb|EHW86421.1| hypothetical protein ECDEC10E_4099 [Escherichia coli DEC10E]
gb|EHW87436.1| hypothetical protein ECDEC11A_4046 [Escherichia coli DEC11A]
gb|EHW87741.1| hypothetical protein ECDEC10F_5074 [Escherichia coli DEC10F]
gb|EHX00026.1| hypothetical protein ECDEC11B_4049 [Escherichia coli DEC11B]
gb|EHX06093.1| protein dcrB [Escherichia coli DEC11D]
gb|EHX08181.1| protein dcrB [Escherichia coli DEC11C]
gb|EHX16476.1| protein dcrB [Escherichia coli DEC11E]
gb|EHX26743.1| protein dcrB [Escherichia coli DEC12A]
gb|EHX27671.1| protein dcrB [Escherichia coli DEC12C]
gb|EHX43993.1| hypothetical protein ECDEC13A_3809 [Escherichia coli DEC13A]
gb|EHX44267.1| hypothetical protein ECDEC12E_4170 [Escherichia coli DEC12E]
gb|EHX57123.1| hypothetical protein ECDEC13C_4217 [Escherichia coli DEC13C]
gb|EHX57204.1| hypothetical protein ECDEC13B_3655 [Escherichia coli DEC13B]
gb|EHX59795.1| hypothetical protein ECDEC13D_3935 [Escherichia coli DEC13D]
gb|EHX70218.1| hypothetical protein ECDEC13E_3989 [Escherichia coli DEC13E]
gb|EHX73985.1| protein dcrB [Escherichia coli DEC14A]
gb|EHX76535.1| hypothetical protein ECDEC14B_4146 [Escherichia coli DEC14B]
gb|EHX85014.1| hypothetical protein ECDEC14C_4054 [Escherichia coli DEC14C]
gb|EHX88877.1| hypothetical protein ECDEC14D_4010 [Escherichia coli DEC14D]
gb|EHX95350.1| hypothetical protein ECDEC15A_4247 [Escherichia coli DEC15A]
gb|EHY00588.1| hypothetical protein ECDEC15B_4051 [Escherichia coli DEC15B]
gb|EHY04242.1| hypothetical protein ECDEC15C_3955 [Escherichia coli DEC15C]
gb|EHY12496.1| hypothetical protein ECDEC15D_3899 [Escherichia coli DEC15D]
gb|EHY16577.1| hypothetical protein ECDEC15E_4240 [Escherichia coli DEC15E]
gb|AFG42389.1| hypothetical protein P12B_c3569 [Escherichia coli P12b]
gb|AFH16068.1| hypothetical protein KO11_05410 [Escherichia coli KO11FL]
gb|AFH13289.1| hypothetical protein WFL_18235 [Escherichia coli W]
gb|EID63755.1| hypothetical protein SF5M90T_3397 [Shigella flexneri 5a str. M90T]
gb|EID68312.1| hypothetical protein ECW26_11170 [Escherichia coli W26]
gb|EIE38760.1| hypothetical protein OQE_03010 [Escherichia coli J53]
gb|EIE56565.1| hypothetical protein ECAI27_12370 [Escherichia coli AI27]
gb|EIF17397.1| hypothetical protein UWO_13976 [Escherichia coli O32:H37 str. P4]
gb|EIF84902.1| protein dcrB [Escherichia coli M919]
gb|EIG46380.1| protein dcrB [Escherichia coli B799]
gb|EIG46702.1| protein dcrB [Escherichia coli H730]
gb|EIG68502.1| protein dcrB [Escherichia sp. 4_1_40B]
gb|EIG81210.1| protein DcrB [Escherichia coli 1.2741]
gb|EIG91063.1| protein DcrB [Escherichia coli 97.0246]
gb|EIH01308.1| protein DcrB [Escherichia coli 5.0588]
gb|EIH12172.1| protein DcrB [Escherichia coli 97.0259]
gb|EIH24571.1| protein DcrB [Escherichia coli 1.2264]
gb|EIH32406.1| protein DcrB [Escherichia coli 96.0497]
gb|EIH44364.1| protein DcrB [Escherichia coli 99.0741]
gb|EIH54027.1| protein DcrB [Escherichia coli 3.2608]
gb|EIH66385.1| protein DcrB [Escherichia coli 93.0624]
gb|EIH78550.1| protein DcrB [Escherichia coli 4.0522]
gb|EIH89796.1| protein DcrB [Escherichia coli JB1-95]
gb|EII01936.1| protein DcrB [Escherichia coli 96.154]
gb|EII12530.1| protein DcrB [Escherichia coli 5.0959]
gb|EII23080.1| protein DcrB [Escherichia coli 9.0111]
gb|EII36029.1| protein DcrB [Escherichia coli 4.0967]
gb|EII44803.1| protein DcrB [Escherichia coli 2.3916]
gb|EII57248.1| protein DcrB [Escherichia coli 3.3884]
gb|EII66837.1| protein DcrB [Escherichia coli 2.4168]
gb|EII77998.1| protein DcrB [Escherichia coli 3.2303]
gb|EIJ04061.1| protein DcrB [Escherichia coli B41]
gb|EIJ15521.1| protein DcrB [Escherichia coli 900105 (10e)]
gb|AFJ31114.1| hypothetical protein CDCO157_4058 [Escherichia coli Xuzhou21]
gb|EIL01189.1| hypothetical protein ECO9534_13202 [Escherichia coli O111:H11 str.
CVM9534]
gb|EIL04030.1| hypothetical protein ECO9450_15352 [Escherichia coli O103:H2 str.
CVM9450]
gb|EIL11512.1| hypothetical protein ECO9340_19403 [Escherichia coli O103:H25 str.
CVM9340]
gb|EIL21997.1| hypothetical protein ECO9574_09725 [Escherichia coli O111:H8 str.
CVM9574]
gb|EIL25138.1| hypothetical protein ECO9570_24470 [Escherichia coli O111:H8 str.
CVM9570]
gb|EIL28835.1| hypothetical protein ECO9545_25368 [Escherichia coli O111:H11 str.
CVM9545]
gb|EIL51361.1| hypothetical protein ECKD2_11323 [Escherichia coli KD2]
gb|EIL58811.1| hypothetical protein EC54115_01058 [Escherichia coli 541-15]
gb|EIL64089.1| hypothetical protein EC75_13645 [Escherichia coli 75]
gb|EIL69205.1| hypothetical protein EC5411_01548 [Escherichia coli 541-1]
gb|EIL70102.1| hypothetical protein EC5761_09710 [Escherichia coli 576-1]
gb|EIL78856.1| hypothetical protein ECMT8_08593 [Escherichia coli CUMT8]
gb|EIN18008.1| protein dcrB [Escherichia coli FRIK1996]
gb|EIN19314.1| protein dcrB [Escherichia coli FDA517]
gb|EIN19418.1| protein dcrB [Escherichia coli FDA505]
gb|EIN35266.1| protein dcrB [Escherichia coli FRIK1985]
gb|EIN35480.1| protein dcrB [Escherichia coli 93-001]
gb|EIN38644.1| protein dcrB [Escherichia coli FRIK1990]
gb|EIN51264.1| protein dcrB [Escherichia coli PA3]
gb|EIN54309.1| protein dcrB [Escherichia coli PA5]
gb|EIN57702.1| protein dcrB [Escherichia coli PA9]
gb|EIN67928.1| protein dcrB [Escherichia coli PA10]
gb|EIN72047.1| protein dcrB [Escherichia coli PA14]
gb|EIN72974.1| protein dcrB [Escherichia coli PA15]
gb|EIN85367.1| protein dcrB [Escherichia coli PA22]
gb|EIN91756.1| protein dcrB [Escherichia coli PA25]
gb|EIN93284.1| protein dcrB [Escherichia coli PA24]
gb|EIN97759.1| protein dcrB [Escherichia coli PA28]
gb|EIO09783.1| protein dcrB [Escherichia coli PA31]
gb|EIO10437.1| protein dcrB [Escherichia coli PA32]
gb|EIO13464.1| protein dcrB [Escherichia coli PA33]
gb|EIO25885.1| protein dcrB [Escherichia coli PA40]
gb|EIO31489.1| protein dcrB [Escherichia coli PA39]
gb|EIO33476.1| protein dcrB [Escherichia coli PA41]
gb|EIO35285.1| protein dcrB [Escherichia coli PA42]
gb|EIO47329.1| protein dcrB [Escherichia coli TW06591]
gb|EIO54441.1| protein dcrB [Escherichia coli TW07945]
gb|EIO55209.1| protein dcrB [Escherichia coli TW10246]
gb|EIO61265.1| protein dcrB [Escherichia coli TW11039]
gb|EIO68692.1| protein dcrB [Escherichia coli TW09098]
gb|EIO71782.1| protein dcrB [Escherichia coli TW09109]
gb|EIO80623.1| protein dcrB [Escherichia coli TW10119]
gb|EIO89556.1| protein dcrB [Escherichia coli EC4203]
gb|EIO90998.1| protein dcrB [Escherichia coli TW09195]
gb|EIO93927.1| protein dcrB [Escherichia coli EC4196]
gb|EIP06359.1| protein dcrB [Escherichia coli O157:H7 str. TW14313]
gb|EIP07557.1| protein dcrB [Escherichia coli TW14301]
gb|EIP11976.1| protein dcrB [Escherichia coli EC4421]
gb|EIP21321.1| protein dcrB [Escherichia coli EC4422]
gb|EIP25475.1| protein dcrB [Escherichia coli EC4013]
gb|EIP29425.1| protein dcrB [Escherichia coli EC4402]
gb|EIP36824.1| protein dcrB [Escherichia coli EC4439]
gb|EIP41959.1| protein dcrB [Escherichia coli EC4436]
gb|EIP50738.1| protein dcrB [Escherichia coli EC4437]
gb|EIP52732.1| protein dcrB [Escherichia coli EC4448]
gb|EIP57771.1| protein dcrB [Escherichia coli EC1738]
gb|EIP65493.1| protein dcrB [Escherichia coli EC1734]
gb|EIP75083.1| protein dcrB [Escherichia coli EC1863]
gb|EIP75749.1| protein dcrB [Escherichia coli EC1845]
gb|EIQ02765.1| protein dcrB [Shigella flexneri K-1770]
gb|EIQ03336.1| protein dcrB [Shigella flexneri 2850-71]
gb|EIQ16633.1| protein dcrB [Shigella flexneri K-315]
gb|EIQ20215.1| protein dcrB [Shigella flexneri K-404]
gb|EIQ25125.1| protein dcrB [Shigella boydii 965-58]
gb|EIQ36816.1| protein dcrB [Shigella sonnei 3226-85]
gb|EIQ40427.1| protein dcrB [Shigella sonnei 3233-85]
gb|EIQ50450.1| hypothetical protein SS482266_4019 [Shigella sonnei 4822-66]
gb|EIQ55175.1| protein dcrB [Shigella flexneri 1235-66]
gb|EIQ60473.1| protein dcrB [Escherichia coli EPECa12]
gb|EIQ68072.1| hypothetical protein ECEPECC34262_4440 [Escherichia coli EPEC
C342-62]
gb|EJE63498.1| hypothetical protein ECO9602_15274 [Escherichia coli O111:H8 str.
CVM9602]
gb|EJE65761.1| hypothetical protein ECO9634_18706 [Escherichia coli O111:H8 str.
CVM9634]
gb|EJE70433.1| hypothetical protein ECO10224_06417 [Escherichia coli O26:H11 str.
CVM10224]
gb|EJE80234.1| hypothetical protein ECO10021_10093 [Escherichia coli O26:H11 str.
CVM10021]
gb|EJE83333.1| hypothetical protein ECO9553_19827 [Escherichia coli O111:H11 str.
CVM9553]
gb|EJE92223.1| hypothetical protein ECO9455_28327 [Escherichia coli O111:H11 str.
CVM9455]
gb|EJE98834.1| hypothetical protein ECO10030_18295 [Escherichia coli O26:H11 str.
CVM10030]
gb|EJF02631.1| hypothetical protein ECO9952_19245 [Escherichia coli O26:H11 str.
CVM9952]
gb|EJK94337.1| hypothetical protein ECSTECO31_3792 [Escherichia coli STEC_O31]
gb|EJL10092.1| hypothetical protein SF660363_4625 [Shigella flexneri 6603-63]
gb|EJL12390.1| hypothetical protein SSMOSELEY_4498 [Shigella sonnei str. Moseley]
gb|EEH71169.2| protein dcrB [Escherichia sp. 1_1_43]
gb|AFS55067.1| hypothetical protein O3M_01740 [Escherichia coli O104:H4 str.
2009EL-2050]
gb|AFS72268.1| hypothetical protein O3K_01695 [Escherichia coli O104:H4 str.
2011C-3493]
gb|AFS88505.1| hypothetical protein O3O_23950 [Escherichia coli O104:H4 str.
2009EL-2071]
gb|EKG96814.1| protein dcrB [Escherichia coli PA7]
gb|EKG99167.1| protein dcrB [Escherichia coli FRIK920]
gb|EKH01863.1| protein dcrB [Escherichia coli PA34]
gb|EKH11141.1| protein dcrB [Escherichia coli FDA506]
gb|EKH14923.1| protein dcrB [Escherichia coli FDA507]
gb|EKH22458.1| protein dcrB [Escherichia coli FDA504]
gb|EKH28223.1| protein dcrB [Escherichia coli FRIK1999]
gb|EKH34075.1| protein dcrB [Escherichia coli FRIK1997]
gb|EKH38532.1| protein dcrB [Escherichia coli NE1487]
gb|EKH44632.1| protein dcrB [Escherichia coli NE037]
gb|EKH50466.1| protein dcrB [Escherichia coli FRIK2001]
gb|EKH56197.1| protein dcrB [Escherichia coli PA4]
gb|EKH65165.1| protein dcrB [Escherichia coli PA23]
gb|EKH67734.1| protein dcrB [Escherichia coli PA49]
gb|EKH73873.1| protein dcrB [Escherichia coli PA45]
gb|EKH81364.1| protein dcrB [Escherichia coli TT12B]
gb|EKH86117.1| protein dcrB [Escherichia coli MA6]
gb|EKH89872.1| protein dcrB [Escherichia coli 5905]
gb|EKH98297.1| protein dcrB [Escherichia coli CB7326]
gb|EKI04629.1| protein dcrB [Escherichia coli EC96038]
gb|EKI07761.1| protein dcrB [Escherichia coli 5412]
gb|EKI16506.1| protein dcrB [Escherichia coli TW15901]
gb|EKI24836.1| protein dcrB [Escherichia coli TW00353]
gb|EKI34729.1| protein dcrB [Escherichia coli 3006]
gb|EKI38863.1| protein dcrB [Escherichia coli PA38]
gb|EKI48246.1| protein dcrB [Escherichia coli EC1735]
gb|EKI49825.1| protein dcrB [Escherichia coli N1]
gb|EKI58815.1| protein dcrB [Escherichia coli EC1736]
gb|EKI62370.1| protein dcrB [Escherichia coli EC1737]
gb|EKI66706.1| protein dcrB [Escherichia coli EC1846]
gb|EKI74596.1| protein dcrB [Escherichia coli EC1847]
gb|EKI78369.1| protein dcrB [Escherichia coli EC1848]
gb|EKI84351.1| protein dcrB [Escherichia coli EC1849]
gb|EKI92256.1| protein dcrB [Escherichia coli EC1850]
gb|EKI94850.1| protein dcrB [Escherichia coli EC1856]
gb|EKJ02532.1| protein dcrB [Escherichia coli EC1862]
gb|EKJ08041.1| protein dcrB [Escherichia coli EC1864]
gb|EKJ12665.1| protein dcrB [Escherichia coli EC1865]
gb|EKJ22395.1| protein dcrB [Escherichia coli EC1868]
gb|EKJ23248.1| protein dcrB [Escherichia coli EC1866]
gb|EKJ32975.1| protein dcrB [Escherichia coli EC1869]
gb|EKJ38167.1| protein dcrB [Escherichia coli EC1870]
gb|EKJ40337.1| protein dcrB [Escherichia coli NE098]
gb|EKJ49676.1| protein dcrB [Escherichia coli FRIK523]
gb|EKJ55936.1| protein dcrB [Escherichia coli 0.1288]
gb|EKJ58292.1| protein dcrB [Escherichia coli 0.1304]
gb|EKJ82032.1| hypothetical protein ECAD30_26680 [Escherichia coli AD30]
gb|EKK23546.1| protein dcrB [Escherichia coli 5.2239]
gb|EKK24004.1| protein dcrB [Escherichia coli 3.4870]
gb|EKK24854.1| protein dcrB [Escherichia coli 6.0172]
gb|EKK40770.1| protein dcrB [Escherichia coli 8.0566]
gb|EKK41096.1| protein dcrB [Escherichia coli 8.0586]
gb|EKK41884.1| protein dcrB [Escherichia coli 8.0569]
gb|EKK52134.1| protein dcrB [Escherichia coli 10.0833]
gb|EKK54773.1| protein dcrB [Escherichia coli 8.2524]
gb|EKK63748.1| protein dcrB [Escherichia coli 10.0869]
gb|EKK68647.1| protein dcrB [Escherichia coli 88.0221]
gb|EKK73506.1| protein dcrB [Escherichia coli 8.0416]
gb|EKK83662.1| protein dcrB [Escherichia coli 10.0821]
gb|EKT91152.1| hypothetical protein CFSAN001630_29438 [Escherichia coli O111:H11
str. CFSAN001630]
gb|EKU00571.1| hypothetical protein CFSAN001632_08805 [Escherichia coli O111:H8
str. CFSAN001632]
gb|EKU01592.1| hypothetical protein CFSAN001629_09093 [Escherichia coli O26:H11
str. CFSAN001629]
gb|EKV72526.1| protein dcrB [Escherichia coli 88.1042]
gb|EKV73426.1| protein dcrB [Escherichia coli 89.0511]
gb|EKV76195.1| protein dcrB [Escherichia coli 88.1467]
gb|EKV87648.1| protein dcrB [Escherichia coli 90.0091]
gb|EKV90791.1| protein dcrB [Escherichia coli 90.2281]
gb|EKV93944.1| protein dcrB [Escherichia coli 90.0039]
gb|EKW06757.1| protein dcrB [Escherichia coli 93.0056]
gb|EKW07025.1| protein dcrB [Escherichia coli 93.0055]
gb|EKW11078.1| protein dcrB [Escherichia coli 94.0618]
gb|EKW24039.1| protein dcrB [Escherichia coli 95.0183]
gb|EKW25112.1| protein dcrB [Escherichia coli 95.0943]
gb|EKW27116.1| protein dcrB [Escherichia coli 95.1288]
gb|EKW38967.1| protein dcrB [Escherichia coli 96.0428]
gb|EKW41244.1| protein dcrB [Escherichia coli 96.0427]
gb|EKW45674.1| protein dcrB [Escherichia coli 96.0939]
gb|EKW53119.1| protein dcrB [Escherichia coli 96.0932]
gb|EKW59603.1| protein dcrB [Escherichia coli 96.0107]
gb|EKW61590.1| protein dcrB [Escherichia coli 97.0003]
gb|EKW74204.1| protein dcrB [Escherichia coli 97.0007]
gb|EKW78713.1| protein dcrB [Escherichia coli 99.0672]
gb|EKW87203.1| protein dcrB [Escherichia coli 99.0678]
gb|EKW88629.1| protein dcrB [Escherichia coli 99.0713]
gb|EKY36139.1| protein dcrB [Escherichia coli 96.0109]
gb|EKY37367.1| protein dcrB [Escherichia coli 97.0010]
gb|EKY83637.1| protein dcrB [Escherichia coli O104:H4 str. 11-02092]
gb|EKY93512.1| protein dcrB [Escherichia coli O104:H4 str. 11-02033-1]
gb|EKY94385.1| protein dcrB [Escherichia coli O104:H4 str. 11-02030]
gb|EKZ09553.1| protein dcrB [Escherichia coli O104:H4 str. 11-02093]
gb|EKZ11484.1| protein dcrB [Escherichia coli O104:H4 str. 11-02281]
gb|EKZ14096.1| protein dcrB [Escherichia coli O104:H4 str. 11-02318]
gb|EKZ25232.1| protein dcrB [Escherichia coli O104:H4 str. 11-02913]
gb|EKZ27980.1| protein dcrB [Escherichia coli O104:H4 str. 11-03439]
gb|EKZ28986.1| protein dcrB [Escherichia coli O104:H4 str. 11-03943]
gb|EKZ38399.1| protein dcrB [Escherichia coli O104:H4 str. 11-04080]
gb|EKZ39444.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-9990]
gb|EKZ43041.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-9450]
gb|EKZ51001.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-4984]
gb|EKZ54443.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-4986]
gb|EKZ60690.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-4987]
gb|EKZ64468.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-4988]
gb|EKZ69482.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-5603]
gb|EKZ76387.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-5604]
gb|EKZ81249.1| protein dcrB [Escherichia coli O104:H4 str. Ec12-0465]
gb|EKZ85150.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-6006]
gb|EKZ90757.1| protein dcrB [Escherichia coli O104:H4 str. Ec12-0466]
gb|EKZ94828.1| protein dcrB [Escherichia coli O104:H4 str. Ec11-9941]
gb|ELB96502.1| protein dcrB [Escherichia coli KTE2]
gb|ELC14249.1| protein dcrB [Escherichia coli KTE10]
gb|ELC18515.1| protein dcrB [Escherichia coli KTE12]
gb|ELC36018.1| protein dcrB [Escherichia coli KTE21]
gb|ELC43976.1| protein dcrB [Escherichia coli KTE26]
gb|ELC57036.1| protein dcrB [Escherichia coli KTE44]
gb|ELC71136.1| protein dcrB [Escherichia coli KTE181]
gb|ELC94940.1| protein dcrB [Escherichia coli KTE193]
gb|ELD02637.1| protein dcrB [Escherichia coli KTE204]
gb|ELD17905.1| protein dcrB [Escherichia coli KTE208]
gb|ELD19619.1| protein dcrB [Escherichia coli KTE210]
gb|ELD27666.1| protein dcrB [Escherichia coli KTE212]
gb|ELD31816.1| protein dcrB [Escherichia coli KTE213]
gb|ELD57882.1| protein dcrB [Escherichia coli KTE228]
gb|ELD67490.1| protein dcrB [Escherichia coli KTE234]
gb|ELD69713.1| protein dcrB [Escherichia coli KTE233]
gb|ELD75828.1| protein dcrB [Escherichia coli KTE235]
gb|ELD79773.1| protein dcrB [Escherichia coli KTE236]
gb|ELD84824.1| protein dcrB [Escherichia coli KTE237]
gb|ELD96200.1| protein dcrB [Escherichia coli KTE51]
gb|ELE16474.1| protein dcrB [Escherichia coli KTE56]
gb|ELE39516.1| protein dcrB [Escherichia coli KTE66]
gb|ELE57408.1| protein dcrB [Escherichia coli KTE76]
gb|ELE61468.1| protein dcrB [Escherichia coli KTE77]
gb|ELE67771.1| protein dcrB [Escherichia coli KTE80]
gb|ELE69227.1| protein dcrB [Escherichia coli KTE81]
gb|ELE77696.1| protein dcrB [Escherichia coli KTE83]
gb|ELE96124.1| protein dcrB [Escherichia coli KTE111]
gb|ELE96668.1| protein dcrB [Escherichia coli KTE116]
gb|ELF06565.1| protein dcrB [Escherichia coli KTE119]
gb|ELF09528.1| protein dcrB [Escherichia coli KTE142]
gb|ELF15300.1| protein dcrB [Escherichia coli KTE143]
gb|ELF17114.1| protein dcrB [Escherichia coli KTE156]
gb|ELF31255.1| protein dcrB [Escherichia coli KTE161]
gb|ELF35330.1| protein dcrB [Escherichia coli KTE171]
gb|ELF52729.1| protein dcrB [Escherichia coli KTE9]
gb|ELF70940.1| protein dcrB [Escherichia coli KTE42]
gb|ELF84144.1| protein dcrB [Escherichia coli KTE29]
gb|ELF95743.1| protein dcrB [Escherichia coli KTE48]
gb|ELG09831.1| protein dcrB [Escherichia coli KTE50]
gb|ELG11651.1| protein dcrB [Escherichia coli KTE54]
gb|ELG24249.1| protein dcrB [Escherichia coli KTE78]
gb|ELG36249.1| protein dcrB [Escherichia coli KTE79]
gb|ELG39903.1| protein dcrB [Escherichia coli KTE91]
gb|ELG46956.1| protein dcrB [Escherichia coli KTE101]
gb|ELG48203.1| protein dcrB [Escherichia coli KTE115]
gb|ELG66850.1| protein dcrB [Escherichia coli KTE136]
gb|ELG67301.1| protein dcrB [Escherichia coli KTE135]
gb|ELG70447.1| protein dcrB [Escherichia coli KTE140]
gb|ELG81392.1| protein dcrB [Escherichia coli KTE144]
gb|ELG85573.1| protein dcrB [Escherichia coli KTE146]
gb|ELG92119.1| protein dcrB [Escherichia coli KTE147]
gb|ELG96891.1| protein dcrB [Escherichia coli KTE158]
gb|ELH00651.1| protein dcrB [Escherichia coli KTE154]
gb|ELH17703.1| protein dcrB [Escherichia coli KTE190]
gb|ELH34573.1| protein dcrB [Escherichia coli KTE196]
gb|ELH41162.1| protein dcrB [Escherichia coli KTE184]
gb|ELH45007.1| protein dcrB [Escherichia coli KTE197]
gb|ELH50430.1| protein dcrB [Escherichia coli KTE202]
gb|ELH57117.1| protein dcrB [Escherichia coli KTE203]
gb|ELI04316.1| protein dcrB [Escherichia coli KTE105]
gb|ELI21772.1| protein dcrB [Escherichia coli KTE112]
gb|ELI27654.1| protein dcrB [Escherichia coli KTE117]
gb|ELI35682.1| protein dcrB [Escherichia coli KTE120]
gb|ELI39885.1| protein dcrB [Escherichia coli KTE122]
gb|ELI51100.1| protein dcrB [Escherichia coli KTE125]
gb|ELI52473.1| protein dcrB [Escherichia coli KTE128]
gb|ELI77131.1| protein dcrB [Escherichia coli KTE138]
gb|ELJ11485.1| protein dcrB [Escherichia coli KTE163]
gb|ELJ20929.1| protein dcrB [Escherichia coli KTE166]
gb|ELJ40769.1| protein dcrB [Escherichia coli KTE177]
gb|ELJ54980.1| protein dcrB [Escherichia coli KTE232]
gb|ELJ63225.1| protein dcrB [Escherichia coli KTE82]
gb|ELJ77574.1| protein dcrB [Escherichia coli KTE90]
gb|ELJ80921.1| protein dcrB [Escherichia coli KTE95]
emb|CCP97068.1| DcrB protein precursor [Escherichia coli O10:K5(L):H4 str. ATCC
23506]
emb|CCQ00511.1| DcrB protein precursor [Escherichia coli O5:K4(L):H4 str. ATCC
23502]
gb|AGC88947.1| hypothetical protein APECO78_21150 [Escherichia coli APEC O78]
gb|ELV15840.1| protein dcrB [Escherichia coli 99.0814]
gb|ELV17346.1| protein dcrB [Escherichia coli 09BKT078844]
gb|ELV24772.1| protein dcrB [Escherichia coli 99.0815]
gb|ELV32715.1| protein dcrB [Escherichia coli 99.0839]
gb|ELV33075.1| protein dcrB [Escherichia coli 99.0816]
gb|ELV37604.1| protein dcrB [Escherichia coli 99.0848]
gb|ELV46454.1| protein dcrB [Escherichia coli 99.1753]
gb|ELV50216.1| protein dcrB [Escherichia coli 99.1775]
gb|ELV53163.1| protein dcrB [Escherichia coli 99.1793]
gb|ELV65549.1| protein dcrB [Escherichia coli PA11]
gb|ELV65821.1| protein dcrB [Escherichia coli ATCC 700728]
gb|ELV66254.1| protein dcrB [Escherichia coli 99.1805]
gb|ELV78927.1| protein dcrB [Escherichia coli PA13]
gb|ELV79495.1| protein dcrB [Escherichia coli PA19]
gb|ELV87511.1| protein dcrB [Escherichia coli PA2]
gb|ELV94528.1| protein dcrB [Escherichia coli PA47]
gb|ELV95162.1| protein dcrB [Escherichia coli PA48]
gb|ELW01421.1| protein dcrB [Escherichia coli PA8]
gb|ELW09367.1| protein dcrB [Escherichia coli 7.1982]
gb|ELW11849.1| protein dcrB [Escherichia coli 99.1781]
gb|ELW16244.1| protein dcrB [Escherichia coli 99.1762]
gb|ELW25232.1| protein dcrB [Escherichia coli PA35]
gb|ELW30163.1| protein dcrB [Escherichia coli 3.4880]
gb|ELW33109.1| protein dcrB [Escherichia coli 95.0083]
gb|ELW39998.1| protein dcrB [Escherichia coli 99.0670]
gb|EMD04454.1| hypothetical protein C202_17011 [Escherichia coli O08]
gb|EMD05403.1| hypothetical protein C201_16410 [Escherichia coli S17]
gb|EMR93117.1| periplasmic protein [Escherichia coli ONT:H33 str. C48/93]
gb|EMR97071.1| periplasmic protein [Escherichia coli O104:H4 str. E92/11]
gb|EMR99336.1| periplasmic protein [Escherichia coli O104:H4 str. E112/10]
gb|EMS06111.1| periplasmic protein [Escherichia coli O127:H27 str. C43/90]
gb|EMU74357.1| protein dcrB [Escherichia coli MP021017.9]
gb|EMU76474.1| protein dcrB [Escherichia coli MP021017.6]
gb|EMU78814.1| protein dcrB [Escherichia coli MP021017.5]
gb|EMU89500.1| protein dcrB [Escherichia coli MP021017.4]
gb|EMU91107.1| protein dcrB [Escherichia coli MP021017.3]
gb|EMU93222.1| protein dcrB [Escherichia coli MP021017.2]
gb|EMV04446.1| protein dcrB [Escherichia coli MP021017.10]
gb|EMV15038.1| protein dcrB [Escherichia coli MP021017.12]
gb|EMV18679.1| protein dcrB [Escherichia coli BCE034_MS-14]
gb|EMV30590.1| protein dcrB [Escherichia coli BCE002_MS12]
gb|EMV35548.1| protein dcrB [Escherichia coli 2875000]
gb|EMV37072.1| protein dcrB [Escherichia coli BCE019_MS-13]
gb|EMV43848.1| protein dcrB [Escherichia coli 2872800]
gb|EMV52844.1| protein dcrB [Escherichia coli 2872000]
gb|EMV53507.1| protein dcrB [Escherichia coli 2871950]
gb|EMV55172.1| protein dcrB [Escherichia coli 2867750]
gb|EMV67785.1| protein dcrB [Escherichia coli 2866550]
gb|EMV68742.1| protein dcrB [Escherichia coli 2866450]
gb|EMV71582.1| protein dcrB [Escherichia coli 2866750]
gb|EMV87153.1| protein dcrB [Escherichia coli 2865200]
gb|EMV90102.1| protein dcrB [Escherichia coli 2860050]
gb|EMV99116.1| protein dcrB [Escherichia coli 2851500]
gb|EMV99332.1| protein dcrB [Escherichia coli 2853500]
gb|EMW04247.1| protein dcrB [Escherichia coli 2850750]
gb|EMW15372.1| protein dcrB [Escherichia coli 2850400]
gb|EMW19370.1| protein dcrB [Escherichia coli 2848050]
gb|EMW29014.1| protein dcrB [Escherichia coli 2845350]
gb|EMW32936.1| protein dcrB [Escherichia coli 2785200]
gb|EMW39967.1| protein dcrB [Escherichia coli 2788150]
gb|EMW46269.1| protein dcrB [Escherichia coli 2780750]
gb|EMW48512.1| protein dcrB [Escherichia coli 2770900]
gb|EMW54266.1| protein dcrB [Escherichia coli 2762100]
gb|EMW57880.1| protein dcrB [Escherichia coli 2756500]
gb|EMW76876.1| protein dcrB [Escherichia coli 180600]
gb|EMW85216.1| protein dcrB [Escherichia coli 180050]
gb|EMW92850.1| protein dcrB [Escherichia coli 174750]
gb|EMW93617.1| protein dcrB [Escherichia coli ThroopD]
gb|EMW96998.1| protein dcrB [Escherichia coli P0304777.1]
gb|EMX05649.1| protein dcrB [Escherichia coli P0302308.1]
gb|EMX12353.1| protein dcrB [Escherichia coli P0302293.2]
gb|EMX17833.1| protein dcrB [Escherichia coli P0301867.1]
gb|EMX21573.1| protein dcrB [Escherichia coli MP021566.1]
gb|EMX29122.1| protein dcrB [Escherichia coli MP021561.2]
gb|EMX35928.1| protein dcrB [Escherichia coli MP021017.1]
gb|EMX45820.1| protein dcrB [Escherichia coli MP020980.2]
gb|EMX47813.1| protein dcrB [Escherichia coli Jurua 20/10]
gb|EMX51356.1| protein dcrB [Escherichia coli MP020940.1]
gb|EMX60952.1| protein dcrB [Escherichia coli Jurua 18/11]
gb|EMX66655.1| protein dcrB [Escherichia coli Envira 10/1]
gb|EMX67271.1| protein dcrB [Escherichia coli Envira 8/11]
gb|EMX74042.1| protein dcrB [Escherichia coli 2726800]
gb|EMX82954.1| protein dcrB [Escherichia coli 2719100]
gb|EMX85230.1| protein dcrB [Escherichia coli BCE001_MS16]
gb|EMX89155.1| protein dcrB [Escherichia coli 2720900]
gb|EMZ61259.1| protein dcrB [Escherichia coli 174900]
gb|EMZ64296.1| protein dcrB [Escherichia coli 2846750]
gb|EMZ64672.1| protein dcrB [Escherichia coli 2735000]
gb|EMZ75974.1| protein dcrB [Escherichia coli 199900.1]
gb|EMZ77027.1| protein dcrB [Escherichia coli 2722950]
gb|EMZ81341.1| protein dcrB [Escherichia coli p0305293.1]
gb|EMZ90726.1| protein dcrB [Escherichia coli P0305260.1]
gb|EMZ93931.1| protein dcrB [Escherichia coli P0304816.1]
gb|ENA01880.1| protein dcrB [Escherichia coli P0299438.2]
gb|ENA02291.1| protein dcrB [Escherichia coli P0299917.1]
gb|ENA11679.1| protein dcrB [Escherichia coli P0298942.1]
gb|ENA13244.1| protein dcrB [Escherichia coli BCE008_MS-13]
gb|ENA18447.1| protein dcrB [Escherichia coli 201600.1]
gb|ENA28201.1| protein dcrB [Escherichia coli BCE007_MS-11]
gb|ENA37811.1| protein dcrB [Escherichia coli P0301867.4]
gb|ENA49268.1| protein dcrB [Escherichia coli 2729250]
gb|ENA49758.1| protein dcrB [Escherichia coli 2726950]
gb|ENA58716.1| protein dcrB [Escherichia coli 178900]
gb|ENA64033.1| protein dcrB [Escherichia coli 180200]
gb|ENA75363.1| protein dcrB [Escherichia coli 2730450]
gb|ENA76792.1| protein dcrB [Escherichia coli 2741950]
gb|ENA77770.1| protein dcrB [Escherichia coli 2730350]
gb|ENA90425.1| protein dcrB [Escherichia coli 2860650]
gb|ENA92397.1| protein dcrB [Escherichia coli 2864350]
gb|ENA92872.1| protein dcrB [Escherichia coli 2862600]
gb|ENB05149.1| protein dcrB [Escherichia coli 2866350]
gb|ENB07511.1| protein dcrB [Escherichia coli 2875150]
gb|ENB11285.1| protein dcrB [Escherichia coli BCE008_MS-01]
gb|ENB19212.1| protein dcrB [Escherichia coli BCE011_MS-01]
gb|ENB25654.1| protein dcrB [Escherichia coli BCE030_MS-09]
gb|ENB31090.1| protein dcrB [Escherichia coli BCE032_MS-12]
gb|ENB33655.1| protein dcrB [Escherichia coli MP021561.3]
gb|ENB37110.1| protein dcrB [Escherichia coli P0298942.10]
gb|ENB45871.1| protein dcrB [Escherichia coli P0298942.11]
gb|ENB52110.1| protein dcrB [Escherichia coli P0298942.14]
gb|ENB55060.1| protein dcrB [Escherichia coli P0298942.12]
gb|ENB58373.1| protein dcrB [Escherichia coli P0298942.15]
gb|ENB58943.1| protein dcrB [Escherichia coli P0298942.6]
gb|ENB59888.1| protein dcrB [Escherichia coli P0298942.2]
gb|ENB73229.1| protein dcrB [Escherichia coli P0298942.8]
gb|ENB74972.1| protein dcrB [Escherichia coli P0298942.9]
gb|ENB75604.1| protein dcrB [Escherichia coli P0298942.7]
gb|ENB85986.1| protein dcrB [Escherichia coli P0299438.10]
gb|ENB92860.1| protein dcrB [Escherichia coli P0299438.11]
gb|ENB96403.1| protein dcrB [Escherichia coli P0299438.3]
gb|ENC01276.1| protein dcrB [Escherichia coli P0299438.4]
gb|ENC07983.1| protein dcrB [Escherichia coli P0299438.5]
gb|ENC12569.1| protein dcrB [Escherichia coli P0299438.6]
gb|ENC13800.1| protein dcrB [Escherichia coli P0299438.7]
gb|ENC22125.1| protein dcrB [Escherichia coli P0299438.8]
gb|ENC30045.1| protein dcrB [Escherichia coli P02997067.6]
gb|ENC37800.1| protein dcrB [Escherichia coli P0299917.10]
gb|ENC44642.1| protein dcrB [Escherichia coli P0299917.2]
gb|ENC51169.1| protein dcrB [Escherichia coli P0299917.3]
gb|ENC53342.1| protein dcrB [Escherichia coli P0299917.4]
gb|ENC58392.1| protein dcrB [Escherichia coli P0299917.5]
gb|ENC68252.1| protein dcrB [Escherichia coli P0299917.6]
gb|ENC68478.1| protein dcrB [Escherichia coli P0299917.8]
gb|ENC75912.1| protein dcrB [Escherichia coli P0299917.7]
gb|ENC81181.1| protein dcrB [Escherichia coli P0299917.9]
gb|ENC89328.1| protein dcrB [Escherichia coli P0301867.11]
gb|ENC90480.1| protein dcrB [Escherichia coli P0301867.8]
gb|ENC96643.1| protein dcrB [Escherichia coli P0302308.10]
gb|END00172.1| protein dcrB [Escherichia coli P0302308.11]
gb|END08561.1| protein dcrB [Escherichia coli P0302308.3]
gb|END11714.1| protein dcrB [Escherichia coli P0302308.2]
gb|END20168.1| protein dcrB [Escherichia coli P0302308.5]
gb|END21777.1| protein dcrB [Escherichia coli P0302308.4]
gb|END30712.1| protein dcrB [Escherichia coli 179100]
gb|END36296.1| protein dcrB [Escherichia coli p0305293.13]
gb|END38542.1| protein dcrB [Escherichia coli 2854350]
gb|END39403.1| protein dcrB [Escherichia coli 2733950]
gb|END50160.1| protein dcrB [Escherichia coli MP020980.1]
gb|END54682.1| protein dcrB [Escherichia coli BCE006_MS-23]
gb|END63344.1| protein dcrB [Escherichia coli P0298942.4]
gb|END65729.1| protein dcrB [Escherichia coli P0299483.1]
gb|END77082.1| protein dcrB [Escherichia coli P0299483.2]
gb|END79935.1| protein dcrB [Escherichia coli P0299483.3]
gb|END88533.1| protein dcrB [Escherichia coli P0301867.13]
gb|END89553.1| protein dcrB [Escherichia coli P0301904.3]
gb|END96168.1| protein dcrB [Escherichia coli P0302293.7]
gb|ENE03208.1| protein dcrB [Escherichia coli P0304799.3]
gb|ENE05301.1| protein dcrB [Escherichia coli P0305260.2]
gb|ENE07271.1| protein dcrB [Escherichia coli p0305293.14]
gb|ENE20544.1| protein dcrB [Escherichia coli P0302293.3]
gb|ENE27847.1| protein dcrB [Escherichia coli P0302293.4]
gb|ENE34197.1| protein dcrB [Escherichia coli P0302293.6]
gb|ENE39370.1| protein dcrB [Escherichia coli P0302293.8]
gb|ENE43632.1| protein dcrB [Escherichia coli P0304777.10]
gb|ENE48772.1| protein dcrB [Escherichia coli P0302293.9]
gb|ENE54406.1| protein dcrB [Escherichia coli P0304777.11]
gb|ENE61589.1| protein dcrB [Escherichia coli P0304777.12]
gb|ENE63087.1| protein dcrB [Escherichia coli P0304777.13]
gb|ENE68591.1| protein dcrB [Escherichia coli P0304777.14]
gb|ENE74501.1| protein dcrB [Escherichia coli P0304777.15]
gb|ENE78750.1| protein dcrB [Escherichia coli P0304777.2]
gb|ENE84908.1| protein dcrB [Escherichia coli P0304777.3]
gb|ENE91849.1| protein dcrB [Escherichia coli P0304777.4]
gb|ENE96792.1| protein dcrB [Escherichia coli P0304777.5]
gb|ENE98471.1| protein dcrB [Escherichia coli P0304777.7]
gb|ENF06634.1| protein dcrB [Escherichia coli P0304777.8]
gb|ENF09942.1| protein dcrB [Escherichia coli P0304777.9]
gb|ENF17603.1| protein dcrB [Escherichia coli P0304816.11]
gb|ENF21636.1| protein dcrB [Escherichia coli P0304816.10]
gb|ENF28540.1| protein dcrB [Escherichia coli P0304816.12]
gb|ENF32184.1| protein dcrB [Escherichia coli P0304816.14]
gb|ENF38087.1| protein dcrB [Escherichia coli P0304816.13]
gb|ENF44215.1| protein dcrB [Escherichia coli P0304816.15]
gb|ENF48384.1| protein dcrB [Escherichia coli P0304816.2]
gb|ENF49202.1| protein dcrB [Escherichia coli P0304816.6]
gb|ENF60286.1| protein dcrB [Escherichia coli P0304816.7]
gb|ENF66103.1| protein dcrB [Escherichia coli P0304816.8]
gb|ENF68911.1| protein dcrB [Escherichia coli P0304816.9]
gb|ENF73176.1| protein dcrB [Escherichia coli P0305260.10]
gb|ENF80871.1| protein dcrB [Escherichia coli P0305260.11]
gb|ENF82950.1| protein dcrB [Escherichia coli P0305260.12]
gb|ENF87974.1| protein dcrB [Escherichia coli P0305260.13]
gb|ENF95025.1| protein dcrB [Escherichia coli P0305260.15]
gb|ENG00254.1| protein dcrB [Escherichia coli P0305260.3]
gb|ENG01749.1| protein dcrB [Escherichia coli P0305260.4]
gb|ENG10070.1| protein dcrB [Escherichia coli P0305260.5]
gb|ENG14361.1| protein dcrB [Escherichia coli P0305260.7]
gb|ENG23892.1| protein dcrB [Escherichia coli P0305260.8]
gb|ENG27720.1| protein dcrB [Escherichia coli p0305293.10]
gb|ENG31370.1| protein dcrB [Escherichia coli P0305260.9]
gb|ENG38908.1| protein dcrB [Escherichia coli p0305293.11]
gb|ENG40707.1| protein dcrB [Escherichia coli p0305293.12]
gb|ENG49397.1| protein dcrB [Escherichia coli p0305293.15]
gb|ENG62134.1| protein dcrB [Escherichia coli p0305293.4]
gb|ENG69219.1| protein dcrB [Escherichia coli p0305293.8]
gb|ENG75559.1| protein dcrB [Escherichia coli p0305293.9]
gb|ENG80985.1| protein dcrB [Escherichia coli 178200]
gb|ENG94745.1| protein dcrB [Escherichia coli P0301867.3]
gb|ENG99962.1| protein dcrB [Escherichia coli P0301867.5]
gb|ENH06815.1| protein dcrB [Escherichia coli P0301867.7]
gb|ENH13202.1| protein dcrB [Escherichia coli P0302308.13]
gb|ENH15122.1| protein dcrB [Escherichia coli P0302308.12]
gb|ENH17141.1| protein dcrB [Escherichia coli P0302308.14]
gb|ENH29750.1| protein dcrB [Escherichia coli P0304816.3]
gb|ENH30037.1| protein dcrB [Escherichia coli P0304816.4]
gb|ENH37012.1| protein dcrB [Escherichia coli P0304816.5]
gb|ENH43242.1| protein dcrB [Escherichia coli p0305293.5]
gb|ENH49784.1| protein dcrB [Escherichia coli p0305293.7]
gb|ENH54232.1| protein dcrB [Escherichia coli p0305293.6]
gb|ENO10105.1| periplasmic protein [Escherichia coli O157:H43 str. T22]
gb|EOU29016.1| protein dcrB [Escherichia coli KTE13]
gb|EOU42320.1| protein dcrB [Escherichia coli KTE35]
gb|EOU48664.1| protein dcrB [Escherichia coli KTE231]
gb|EOU55957.1| protein dcrB [Escherichia coli KTE14]
gb|EOU63644.1| protein dcrB [Escherichia coli KTE20]
gb|EOU69549.1| protein dcrB [Escherichia coli KTE24]
gb|EOU87442.1| protein dcrB [Escherichia coli KTE36]
gb|EOU87566.1| protein dcrB [Escherichia coli KTE34]
gb|EOU87980.1| protein dcrB [Escherichia coli KTE37]
gb|EOV02288.1| protein dcrB [Escherichia coli KTE38]
gb|EOV09313.1| protein dcrB [Escherichia coli KTE40]
gb|EOV15992.1| protein dcrB [Escherichia coli KTE198]
gb|EOV20485.1| protein dcrB [Escherichia coli KTE200]
gb|EOV23891.1| protein dcrB [Escherichia coli KTE199]
gb|EOV34401.1| protein dcrB [Escherichia coli KTE221]
gb|EOV41978.1| protein dcrB [Escherichia coli KTE222]
gb|EOV48062.1| protein dcrB [Escherichia coli KTE61]
gb|EOV54477.1| protein dcrB [Escherichia coli KTE64]
gb|EOV57523.1| protein dcrB [Escherichia coli KTE68]
gb|EOV61975.1| protein dcrB [Escherichia coli KTE69]
gb|EOV70228.1| protein dcrB [Escherichia coli KTE70]
gb|EOV72300.1| protein dcrB [Escherichia coli KTE71]
gb|EOV74995.1| protein dcrB [Escherichia coli KTE73]
gb|EOV86031.1| protein dcrB [Escherichia coli KTE74]
gb|EOW01734.1| protein dcrB [Escherichia coli KTE98]
gb|EOW03172.1| protein dcrB [Escherichia coli KTE100]
gb|EOW11012.1| protein dcrB [Escherichia coli KTE103]
gb|EOW14963.1| protein dcrB [Escherichia coli KTE102]
gb|EOW18982.1| protein dcrB [Escherichia coli KTE107]
gb|EOW28457.1| protein dcrB [Escherichia coli KTE121]
gb|EOW29290.1| protein dcrB [Escherichia coli KTE108]
gb|EOW32097.1| protein dcrB [Escherichia coli KTE127]
gb|EOW42271.1| protein dcrB [Escherichia coli KTE130]
gb|EOW44277.1| protein dcrB [Escherichia coli KTE132]
gb|EOW56620.1| protein dcrB [Escherichia coli KTE155]
gb|EOW57715.1| protein dcrB [Escherichia coli KTE134]
gb|EOW64915.1| protein dcrB [Escherichia coli KTE170]
gb|EOW73119.1| protein dcrB [Escherichia sp. KTE172]
gb|EOW88842.1| protein dcrB [Escherichia coli KTE1]
gb|EOW90638.1| protein dcrB [Escherichia coli KTE41]
gb|EOX15553.1| protein dcrB [Escherichia coli KTE225]
gb|EPH51712.1| DcrB protein precursor [Escherichia coli E2265]
gb|EQN23481.1| protein dcrB [Escherichia coli HVH 6 (3-8296502)]
gb|EQN38074.1| protein dcrB [Escherichia coli HVH 10 (4-6832164)]
gb|EQN62133.1| protein dcrB [Escherichia coli HVH 18 (4-8589585)]
gb|EQN78427.1| protein dcrB [Escherichia coli HVH 22 (4-2258986)]
gb|EQN90545.1| protein dcrB [Escherichia coli HVH 25 (4-5851939)]
gb|EQO04489.1| protein dcrB [Escherichia coli HVH 29 (4-3418073)]
gb|EQO26460.1| protein dcrB [Escherichia coli HVH 33 (4-2174936)]
gb|EQO57959.1| protein dcrB [Escherichia coli HVH 41 (4-2677849)]
gb|EQO68951.1| protein dcrB [Escherichia coli HVH 44 (4-2298570)]
gb|EQO70075.1| protein dcrB [Escherichia coli HVH 43 (4-2173468)]
gb|EQO75611.1| protein dcrB [Escherichia coli HVH 45 (4-3129918)]
gb|EQP03643.1| protein dcrB [Escherichia coli HVH 53 (4-0631051)]
gb|EQP21996.1| protein dcrB [Escherichia coli HVH 63 (4-2542528)]
gb|EQP31909.1| protein dcrB [Escherichia coli HVH 69 (4-2837072)]
gb|EQP32841.1| protein dcrB [Escherichia coli HVH 65 (4-2262045)]
gb|EQP89334.1| protein dcrB [Escherichia coli HVH 85 (4-0792144)]
gb|EQP90192.1| protein dcrB [Escherichia coli HVH 82 (4-2209276)]
gb|EQQ00616.1| protein dcrB [Escherichia coli HVH 88 (4-5854636)]
gb|EQQ01640.1| protein dcrB [Escherichia coli HVH 87 (4-5977630)]
gb|EQQ17965.1| protein dcrB [Escherichia coli HVH 91 (4-4638751)]
gb|EQQ56489.1| protein dcrB [Escherichia coli HVH 106 (4-6881831)]
gb|EQQ63519.1| protein dcrB [Escherichia coli HVH 110 (4-6978754)]
gb|EQQ85011.1| protein dcrB [Escherichia coli HVH 113 (4-7535473)]
gb|EQQ96127.1| protein dcrB [Escherichia coli HVH 115 (4-4465989)]
gb|EQQ99720.1| protein dcrB [Escherichia coli HVH 115 (4-4465997)]
gb|EQR17370.1| protein dcrB [Escherichia coli HVH 119 (4-6879578)]
gb|EQR30696.1| protein dcrB [Escherichia coli HVH 122 (4-6851606)]
gb|EQR35571.1| protein dcrB [Escherichia coli HVH 121 (4-6877826)]
gb|EQR59497.1| protein dcrB [Escherichia coli HVH 130 (4-7036876)]
gb|EQR79805.1| protein dcrB [Escherichia coli HVH 135 (4-4449320)]
gb|EQR81668.1| protein dcrB [Escherichia coli HVH 134 (4-6073441)]
gb|EQR83201.1| protein dcrB [Escherichia coli HVH 133 (4-4466519)]
gb|EQR93165.1| protein dcrB [Escherichia coli HVH 139 (4-3192644)]
gb|EQR99356.1| protein dcrB [Escherichia coli HVH 140 (4-5894387)]
gb|EQS27516.1| protein dcrB [Escherichia coli HVH 145 (4-5672112)]
gb|EQS30633.1| protein dcrB [Escherichia coli HVH 147 (4-5893887)]
gb|EQS45170.1| protein dcrB [Escherichia coli HVH 151 (4-5755573)]
gb|EQS52407.1| protein dcrB [Escherichia coli HVH 150 (4-3258106)]
gb|EQS80257.1| protein dcrB [Escherichia coli HVH 163 (4-4697553)]
gb|EQS82926.1| protein dcrB [Escherichia coli HVH 164 (4-5953081)]
gb|EQS84436.1| protein dcrB [Escherichia coli HVH 167 (4-6073565)]
gb|EQT10201.1| protein dcrB [Escherichia coli HVH 173 (3-9175482)]
gb|EQT34078.1| protein dcrB [Escherichia coli HVH 183 (4-3205932)]
gb|EQT35012.1| protein dcrB [Escherichia coli HVH 182 (4-0985554)]
gb|EQT50811.1| protein dcrB [Escherichia coli HVH 187 (4-4471660)]
gb|EQT73021.1| protein dcrB [Escherichia coli HVH 189 (4-3220125)]
gb|EQT90999.1| protein dcrB [Escherichia coli HVH 195 (3-7155360)]
gb|EQU20163.1| protein dcrB [Escherichia coli HVH 200 (4-4449924)]
gb|EQU48470.1| protein dcrB [Escherichia coli HVH 206 (4-3128229)]
gb|EQU57545.1| protein dcrB [Escherichia coli HVH 208 (4-3112292)]
gb|EQU73682.1| protein dcrB [Escherichia coli HVH 209 (4-3062651)]
gb|EQU85449.1| protein dcrB [Escherichia coli HVH 215 (4-3008371)]
gb|EQV05216.1| protein dcrB [Escherichia coli HVH 221 (4-3136817)]
gb|EQV17909.1| protein dcrB [Escherichia coli HVH 223 (4-2976528)]
gb|EQV42749.1| protein dcrB [Escherichia coli KOEGE 33 (68a)]
gb|EQV52601.1| protein dcrB [Escherichia coli KOEGE 40 (102a)]
gb|EQV77479.1| protein dcrB [Escherichia coli KOEGE 68 (182a)]
gb|EQV80591.1| protein dcrB [Escherichia coli KOEGE 62 (175a)]
gb|EQV97116.1| protein dcrB [Escherichia coli KOEGE 77 (202a)]
gb|EQV98062.1| protein dcrB [Escherichia coli KOEGE 73 (195a)]
gb|EQW09017.1| protein dcrB [Escherichia coli KOEGE 118 (317a)]
gb|EQW10014.1| protein dcrB [Escherichia coli KOEGE 131 (358a)]
gb|EQW28250.1| protein dcrB [Escherichia coli UMEA 3052-1]
gb|EQW28761.1| protein dcrB [Escherichia coli UMEA 3033-1]
gb|EQW41002.1| protein dcrB [Escherichia coli UMEA 3065-1]
gb|EQW84337.1| protein dcrB [Escherichia coli UMEA 3124-1]
gb|EQW89487.1| protein dcrB [Escherichia coli UMEA 3139-1]
gb|EQX29887.1| protein dcrB [Escherichia coli UMEA 3163-1]
gb|EQX49285.1| protein dcrB [Escherichia coli UMEA 3174-1]
gb|EQX53113.1| protein dcrB [Escherichia coli UMEA 3176-1]
gb|EQX66892.1| protein dcrB [Escherichia coli UMEA 3180-1]
gb|EQX77152.1| protein dcrB [Escherichia coli UMEA 3190-1]
gb|EQX81451.1| protein dcrB [Escherichia coli UMEA 3199-1]
gb|EQX84834.1| protein dcrB [Escherichia coli UMEA 3200-1]
gb|EQX92426.1| protein dcrB [Escherichia coli UMEA 3201-1]
gb|EQY15471.1| protein dcrB [Escherichia coli UMEA 3212-1]
gb|EQY57133.1| protein dcrB [Escherichia coli UMEA 3240-1]
gb|EQY80934.1| protein dcrB [Escherichia coli UMEA 3304-1]
gb|EQY85082.1| protein dcrB [Escherichia coli UMEA 3314-1]
gb|EQY89713.1| protein dcrB [Escherichia coli UMEA 3317-1]
gb|EQY95530.1| protein dcrB [Escherichia coli UMEA 3329-1]
gb|EQY98051.1| protein dcrB [Escherichia coli UMEA 3318-1]
gb|EQZ10794.1| protein dcrB [Escherichia coli UMEA 3355-1]
gb|EQZ31502.1| protein dcrB [Escherichia coli UMEA 3592-1]
gb|EQZ37154.1| protein dcrB [Escherichia coli UMEA 3609-1]
gb|EQZ62534.1| protein dcrB [Escherichia coli UMEA 3682-1]
gb|EQZ63388.1| protein dcrB [Escherichia coli UMEA 3671-1]
gb|EQZ97910.1| protein dcrB [Escherichia coli UMEA 3718-1]
gb|ERA02976.1| protein dcrB [Escherichia coli UMEA 3805-1]
gb|ERA14958.1| protein dcrB [Escherichia coli UMEA 3889-1]
gb|ERA37940.1| protein dcrB [Escherichia coli UMEA 3899-1]
gb|ERA57417.1| hypothetical protein L668_14390 [Escherichia coli 95NR1]
gb|ERA64194.1| protein dcrB [Escherichia coli HVH 155 (4-4509048)]
gb|ERA98530.1| protein dcrB [Escherichia coli KOEGE 3 (4a)]
gb|ERB02000.1| protein dcrB [Escherichia coli KOEGE 7 (16a)]
gb|ERB12633.1| protein dcrB [Escherichia coli UMEA 3144-1]
gb|ERB16350.1| protein dcrB [Escherichia coli UMEA 3151-1]
gb|ERB21861.1| protein dcrB [Escherichia coli UMEA 3150-1]
gb|ERB25067.1| protein dcrB [Escherichia coli UMEA 3271-1]
gb|ERB33007.1| protein dcrB [Escherichia coli UMEA 3292-1]
gb|ERB69745.1| protein dcrB [Escherichia coli B102]
gb|ERB70321.1| protein dcrB [Escherichia coli B107]
gb|ERB72674.1| protein dcrB [Escherichia coli 09BKT076207]
gb|ERB81473.1| protein dcrB [Escherichia coli B26-1]
gb|ERB86019.1| protein dcrB [Escherichia coli B26-2]
gb|ERB94608.1| protein dcrB [Escherichia coli B28-1]
gb|ERB95141.1| protein dcrB [Escherichia coli B28-2]
gb|ERC03633.1| protein dcrB [Escherichia coli B29-1]
gb|ERC11138.1| protein dcrB [Escherichia coli B29-2]
gb|ERC14937.1| protein dcrB [Escherichia coli B36-1]
gb|ERC18674.1| protein dcrB [Escherichia coli B36-2]
gb|ERC26854.1| protein dcrB [Escherichia coli B7-1]
gb|ERC32090.1| protein dcrB [Escherichia coli B7-2]
gb|ERC36347.1| protein dcrB [Escherichia coli B93]
gb|ERC41428.1| protein dcrB [Escherichia coli B94]
gb|ERC49231.1| protein dcrB [Escherichia coli B95]
gb|ERC54830.1| protein dcrB [Escherichia coli TW07509]
gb|ERC56943.1| protein dcrB [Escherichia coli 08BKT055439]
gb|ERC63701.1| protein dcrB [Escherichia coli Bd5610_99]
gb|ERC67731.1| protein dcrB [Escherichia coli T1840_97]
gb|ERC76318.1| protein dcrB [Escherichia coli T234_00]
gb|ERC79724.1| protein dcrB [Escherichia coli 14A]
gb|ERC82739.1| protein dcrB [Escherichia coli T924_01]
gb|ERC92926.1| protein dcrB [Escherichia coli 2886-75]
gb|ERC96142.1| protein dcrB [Escherichia coli B103]
gb|ERC96755.1| protein dcrB [Escherichia coli B104]
gb|ERD07465.1| protein dcrB [Escherichia coli B105]
gb|ERD11809.1| protein dcrB [Escherichia coli B106]
gb|ERD12400.1| protein dcrB [Escherichia coli B108]
gb|ERD24576.1| protein dcrB [Escherichia coli B109]
gb|ERD26087.1| protein dcrB [Escherichia coli B112]
gb|ERD29906.1| protein dcrB [Escherichia coli B113]
gb|ERD38962.1| protein dcrB [Escherichia coli B114]
gb|ERD42500.1| protein dcrB [Escherichia coli B15]
gb|ERD47169.1| protein dcrB [Escherichia coli B17]
gb|ERD56935.1| protein dcrB [Escherichia coli B40-2]
gb|ERD58673.1| protein dcrB [Escherichia coli B40-1]
gb|ERD61183.1| protein dcrB [Escherichia coli B49-2]
gb|ERD70026.1| protein dcrB [Escherichia coli B5-2]
gb|ERD74943.1| protein dcrB [Escherichia coli B83]
gb|ERD78356.1| protein dcrB [Escherichia coli B84]
gb|ERD85668.1| protein dcrB [Escherichia coli B85]
gb|ERD90019.1| protein dcrB [Escherichia coli B86]
gb|ERE01735.1| protein dcrB [Escherichia coli 08BKT77219]
gb|ERE08377.1| hypothetical protein L667_05965 [Escherichia coli 95JB1]
gb|ERE12436.1| protein dcrB [Escherichia coli 09BKT024447]
gb|ERE16132.1| protein dcrB [Escherichia coli T1282_01]
gb|ERE24076.1| protein dcrB [Escherichia coli B89]
gb|ERE26515.1| protein dcrB [Escherichia coli B90]
gb|ERE31637.1| protein dcrB [Escherichia coli Tx1686]
gb|ERE39109.1| protein dcrB [Escherichia coli Tx3800]
gb|ERF93611.1| hypothetical protein CFSAN002237_13150 [Escherichia coli O104:H21
str. CFSAN002237]
gb|AGW10536.1| hypothetical protein LY180_17810 [Escherichia coli LY180]
gb|AGX35427.1| periplasmic protein, predicted lipoprotein [synthetic Escherichia
coli C321.deltaA]
gb|ERO98444.1| protein dcrB [Escherichia coli BIDMC 19C]
gb|ESA27099.1| DcrB protein precursor [Escherichia coli SCD2]
gb|ESA30856.1| DcrB protein precursor [Escherichia coli SCD1]
gb|ESK01084.1| protein dcrB [Escherichia coli HVH 98 (4-5799287)]
gb|ESK03650.1| protein dcrB [Escherichia coli UMEA 3336-1]
gb|ESK16399.1| protein dcrB [Escherichia coli HVH 50 (4-2593475)]
gb|ESK32891.1| protein dcrB [Escherichia coli UMEA 3323-1]
gb|ESL19186.1| protein dcrB [Escherichia coli BIDMC 39]
gb|ESL34369.1| protein dcrB [Escherichia coli BIDMC 37]
gb|ESM33527.1| protein dcrB [Escherichia coli BWH 32]
gb|ESP06950.1| protein dcrB [Escherichia coli HVH 36 (4-5675286)]
gb|ESP13744.1| protein dcrB [Escherichia coli HVH 136 (4-5970458)]
gb|ESP34367.1| protein dcrB [Escherichia coli HVH 152 (4-3447545)]
gb|ESP42276.1| protein dcrB [Escherichia coli UMEA 3148-1]
emb|CDJ73402.1| hypothetical protein BN896_3163 [Escherichia coli str. K-12 substr.
MC4100]
gb|ESS92493.1| DcrB protein precursor [Escherichia coli CE516]
gb|ESS97279.1| DcrB protein precursor [Escherichia coli CE549]
gb|EST01374.1| DcrB protein precursor [Escherichia coli CE418]
gb|EST64590.1| hypothetical protein ECCZ_04573 [Escherichia coli ECC-Z]
gb|EST65552.1| hypothetical protein M13_19387 [Escherichia coli P4-96]
gb|EST66012.1| hypothetical protein MOI_21286 [Escherichia coli P4-NR]
gb|EST68199.1| hypothetical protein ECA727_25661 [Escherichia coli ECA-727]
gb|EST77993.1| hypothetical protein ECC1470_21142 [Escherichia coli ECC-1470]
gb|ESV03827.1| DcrB protein precursor [Escherichia coli E1777]
gb|ETD59714.1| hypothetical protein Q459_02060 [Escherichia coli ATCC BAA-2215]
gb|ETD63921.1| hypothetical protein Q458_09745 [Escherichia coli ATCC BAA-2209]
gb|ETE04639.1| hypothetical protein V413_23450 [Escherichia coli LAU-EC8]
gb|ETE13846.1| hypothetical protein V415_25535 [Escherichia coli LAU-EC10]
gb|ETE32637.1| hypothetical protein V414_21590 [Escherichia coli LAU-EC9]
gb|ETI73016.1| hypothetical protein Q460_21885 [Escherichia coli ATCC BAA-2219]
gb|ETI73492.1| hypothetical protein Q457_22260 [Escherichia coli ATCC BAA-2196]
gb|ETJ23351.1| Protein dcrB [Escherichia coli DORA_A_5_14_21]
gb|ETJ56985.1| hypothetical protein Q456_0221500 [Escherichia coli ATCC BAA-2193]
gb|ETJ81299.1| hypothetical protein Q455_0202160 [Escherichia coli ATCC BAA-2192]
emb|CDK44275.1| DcrB protein precursor [Escherichia coli IS1]
emb|CDK52519.1| DcrB protein precursor [Escherichia coli IS5]
emb|CDK85565.1| DcrB protein precursor [Escherichia coli IS25]
emb|CDL24707.1| DcrB protein precursor [Escherichia coli ISC7]
emb|CDK76090.1| DcrB protein precursor [Klebsiella pneumoniae IS22]
emb|CDK58433.1| DcrB protein precursor [Escherichia coli IS9]
gb|ETS28750.1| hypothetical protein N444_01625 [Escherichia coli O6:H16:CFA/II
str. B2C]
gb|ETX79231.1| protein dcrB [Escherichia coli BIDMC 43b]
gb|ETX86797.1| protein dcrB [Escherichia coli BIDMC 43a]
gb|ETX99385.1| protein dcrB [Escherichia coli BIDMC 19B]
gb|ETY06643.1| protein dcrB [Escherichia coli BIDMC 19A]
gb|ETY11235.1| protein dcrB [Escherichia coli BIDMC 17B]
gb|ETY17593.1| protein dcrB [Escherichia coli BIDMC 17A]
gb|ETY23789.1| protein dcrB [Escherichia coli BIDMC 15]
gb|ETY29807.1| protein dcrB [Escherichia coli BIDMC 9]
gb|ETY31056.1| protein dcrB [Escherichia coli BIDMC 3]
gb|ETY37423.1| protein dcrB [Escherichia coli BIDMC 2B]
gb|ETY41292.1| protein dcrB [Escherichia coli BWH 40]
gb|ETY62760.1| protein dcrB [Escherichia coli BIDMC 6]
gb|EWC57641.1| hypothetical protein G654_01622 [Escherichia coli EC096/10]
gb|AHM29445.1| hypothetical protein BU34_10620 [Escherichia coli]
gb|AHM32697.1| hypothetical protein CF57_01825 [Escherichia coli]
gb|AHM37300.1| hypothetical protein CF61_02585 [Escherichia coli]
gb|AHM45696.1| hypothetical protein CF58_27875 [Escherichia coli]
gb|AHM50298.1| hypothetical protein CF59_27855 [Escherichia coli]
gb|AHM54740.1| hypothetical protein CF60_27485 [Escherichia coli]
gb|EYB46558.1| hypothetical protein BU69_09335 [Escherichia coli]
gb|EYB48273.1| hypothetical protein BU65_21570 [Escherichia coli]
gb|EYB65047.1| hypothetical protein BU70_01625 [Escherichia coli]
gb|EYD80509.1| protein dcrB [Escherichia coli 1-176-05_S1_C1]
gb|EYD81644.1| protein dcrB [Escherichia coli 1-176-05_S3_C1]
gb|EYD95309.1| protein dcrB [Escherichia coli 1-110-08_S4_C3]
gb|EYD96832.1| protein dcrB [Escherichia coli 1-110-08_S4_C2]
gb|EYE00158.1| protein dcrB [Escherichia coli 1-110-08_S4_C1]
gb|EYE10912.1| protein dcrB [Escherichia coli 1-110-08_S3_C3]
gb|EYE17975.1| protein dcrB [Escherichia coli 1-110-08_S3_C2]
gb|EYE19218.1| protein dcrB [Escherichia coli 1-110-08_S1_C3]
gb|EYE20669.1| protein dcrB [Escherichia coli 1-110-08_S3_C1]
gb|EYE21102.1| protein dcrB [Escherichia coli 1-110-08_S1_C3]
gb|EYE33003.1| protein dcrB [Escherichia coli 1-110-08_S1_C1]
gb|EYE34549.1| protein dcrB [Escherichia coli 1-110-08_S1_C2]
gb|EYE35220.1| protein dcrB [Escherichia coli 1-110-08_S1_C1]
gb|EYU75992.1| hypothetical protein BX62_12785 [Escherichia coli O121:H19 str.
2010C-4254]
gb|EYU80965.1| hypothetical protein BX60_02855 [Escherichia coli O111:NM str.
2010C-4221]
gb|EYU86237.1| hypothetical protein BX63_02145 [Escherichia coli O26:NM str.
2010C-4347]
gb|EYU89860.1| hypothetical protein BX58_22865 [Escherichia coli O111:NM str.
2010C-3977]
gb|EYU92749.1| hypothetical protein BX59_11960 [Escherichia coli O111:NM str.
2010C-4086]
gb|EYU96163.1| hypothetical protein BX56_00440 [Escherichia coli O45:H2 str.
2010C-3876]
gb|EYV02439.1| hypothetical protein BX54_03685 [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV10137.1| hypothetical protein BX52_10540 [Escherichia coli O121:H19 str.
2010C-3609]
gb|EYV64362.1| hypothetical protein BX34_23175 [Escherichia coli O157:H7 str.
2009EL1705]
gb|EYV64523.1| hypothetical protein BX40_17620 [Escherichia coli O103:H11 str.
2010C-3214]
gb|EYV67312.1| hypothetical protein BX36_10455 [Escherichia coli O157:H7 str.
2009EL2109]
gb|EYV73543.1| hypothetical protein BY91_24710 [Escherichia coli O157:H7 str.
K5806]
gb|EYV75253.1| hypothetical protein BX32_15995 [Escherichia coli O121:H19 str.
2009EL1412]
gb|EYV80221.1| hypothetical protein BX25_10855 [Escherichia coli O121:H19 str.
2009C-4659]
gb|EYV87137.1| hypothetical protein BY51_21150 [Escherichia coli O157:H7 str.
F7350]
gb|EYV92244.1| hypothetical protein BY42_12730 [Escherichia coli O6:H16 str.
99-3165]
gb|EYV98017.1| hypothetical protein BY41_18115 [Escherichia coli O86:H34 str.
99-3124]
gb|EYW08282.1| hypothetical protein BY37_00670 [Escherichia coli O157:H7 str.
2011EL-2312]
gb|EYW11094.1| hypothetical protein BY34_07565 [Escherichia coli O157:H7 str.
2011EL-2288]
gb|EYW13146.1| hypothetical protein BY35_19800 [Escherichia coli O157:H7 str.
2011EL-2289]
gb|EYW18920.1| hypothetical protein BY33_09390 [Escherichia coli O157:H7 str.
2011EL-2287]
gb|EYW25190.1| hypothetical protein BY31_12265 [Escherichia coli O157:H7 str.
2011EL-2114]
gb|EYW28151.1| hypothetical protein BY32_11635 [Escherichia coli O157:H7 str.
2011EL-2286]
gb|EYW30670.1| hypothetical protein BY29_20035 [Escherichia coli O157:H7 str.
2011EL-2112]
gb|EYW37255.1| hypothetical protein BY30_24085 [Escherichia coli O157:H7 str.
2011EL-2113]
gb|EYW40757.1| hypothetical protein BY28_08970 [Escherichia coli O157:H7 str.
2011EL-2111]
gb|EYW48271.1| hypothetical protein BY27_08055 [Escherichia coli O157:H7 str.
2011EL-2109]
gb|EYW53867.1| hypothetical protein BY26_19070 [Escherichia coli O157:H7 str.
2011EL-2108]
gb|EYW55364.1| hypothetical protein BY25_07540 [Escherichia coli O157:H7 str.
2011EL-2107]
gb|EYW60451.1| hypothetical protein BY24_12530 [Escherichia coli O157:H7 str.
2011EL-2106]
gb|EYW68753.1| hypothetical protein BY23_00670 [Escherichia coli O157:H7 str.
2011EL-2105]
gb|EYW71023.1| hypothetical protein BY22_06930 [Escherichia coli O157:H7 str.
2011EL-2104]
gb|EYW73373.1| hypothetical protein BY21_20985 [Escherichia coli O157:H7 str.
2011EL-2103]
gb|EYW82798.1| hypothetical protein BY20_10165 [Escherichia coli O157:H7 str.
2011EL-2101]
gb|EYW84592.1| hypothetical protein BY19_08800 [Escherichia coli O157:H7 str.
2011EL-2099]
gb|EYW92836.1| hypothetical protein BX03_01850 [Escherichia coli O111:NM str.
08-4487]
gb|EYW97662.1| hypothetical protein BX01_11655 [Escherichia coli O157:H7 str.
08-4169]
gb|EYX05100.1| hypothetical protein BX00_04635 [Escherichia coli O118:H16 str.
08-3651]
gb|EYX10298.1| hypothetical protein BW98_12110 [Escherichia coli O157:H7 str.
08-3037]
gb|EYX17156.1| hypothetical protein BW99_07890 [Escherichia coli O157:H7 str.
08-3527]
gb|EYX20473.1| hypothetical protein BW97_02570 [Escherichia coli O69:H11 str.
07-4281]
gb|EYX25455.1| hypothetical protein BY18_06890 [Escherichia coli O157:H7 str.
2011EL-2098]
gb|EYX28599.1| hypothetical protein BY17_06415 [Escherichia coli O157:H7 str.
2011EL-2097]
gb|EYX35881.1| hypothetical protein BY16_01465 [Escherichia coli O157:H7 str.
2011EL-2096]
gb|EYX40802.1| hypothetical protein BY15_06395 [Escherichia coli O157:H7 str.
2011EL-2094]
gb|EYX44421.1| hypothetical protein BY14_03880 [Escherichia coli O157:H7 str.
2011EL-2093]
gb|EYX49194.1| hypothetical protein BY13_07475 [Escherichia coli O157:H7 str.
2011EL-2092]
gb|EYX56363.1| hypothetical protein BY11_13930 [Escherichia coli O157:H7 str.
2011EL-2090]
gb|EYX57015.1| hypothetical protein BY12_24840 [Escherichia coli O157:H7 str.
2011EL-2091]
gb|EYX65852.1| hypothetical protein BY10_05345 [Escherichia coli O104:H4 str.
2011EL-1675A]
gb|EYX69223.1| hypothetical protein BY09_03610 [Escherichia coli O157:H7 str.
2011EL-1107]
gb|EYX76922.1| hypothetical protein BY07_25180 [Escherichia coli O111:NM str.
2011C-3679]
gb|EYX80487.1| hypothetical protein BY05_01975 [Escherichia coli O111:NM str.
2011C-3632]
gb|EYX85765.1| hypothetical protein BY08_15950 [Escherichia coli O103:H2 str.
2011C-3750]
gb|EYX87783.1| hypothetical protein BY04_10505 [Escherichia coli O156:H25 str.
2011C-3602]
gb|EYX93271.1| hypothetical protein BY03_12215 [Escherichia coli O111:NM str.
2011C-3573]
gb|EYX98143.1| hypothetical protein BY02_09110 [Escherichia coli O121:H19 str.
2011C-3537]
gb|EYY02368.1| hypothetical protein BY00_10030 [Escherichia coli O121:H19 str.
2011C-3500]
gb|EYY07384.1| hypothetical protein BX97_11910 [Escherichia coli O111:NM str.
2011C-3362]
gb|EYY14043.1| hypothetical protein BX93_18155 [Escherichia coli O111:NM str.
2011C-3170]
gb|EYY15959.1| hypothetical protein BX94_22600 [Escherichia coli O121:H19 str.
2011C-3216]
gb|EYY23226.1| hypothetical protein BX92_06120 [Escherichia coli O121:H19 str.
2011C-3108]
gb|EYY25491.1| hypothetical protein BX91_13395 [Escherichia coli O121:H19 str.
2011C-3072]
gb|EYY32219.1| hypothetical protein BX84_19405 [Escherichia coli O121:H19 str.
2010C-4989]
gb|EYY33595.1| hypothetical protein BX87_02300 [Escherichia coli O121:H19 str.
2010EL1058]
gb|EYY41047.1| hypothetical protein BX86_09680 [Escherichia coli O153:H2 str.
2010C-5034]
gb|EYY46838.1| hypothetical protein BX83_05345 [Escherichia coli O157:H7 str.
2010C-4979C1]
gb|EYY51487.1| hypothetical protein BX81_17435 [Escherichia coli O165:H25 str.
2010C-4874]
gb|EYY51681.1| hypothetical protein BX82_14725 [Escherichia coli O121:H19 str.
2010C-4966]
gb|EYY58966.1| hypothetical protein BX79_14065 [Escherichia coli O121:H19 str.
2010C-4824]
gb|EYY64512.1| hypothetical protein BX77_15580 [Escherichia coli O111:NM str.
2010C-4818]
gb|EYY67902.1| hypothetical protein BX76_11430 [Escherichia coli O111:NM str.
2010C-4799]
gb|EYY78960.1| hypothetical protein BX74_22805 [Escherichia coli O111:NM str.
2010C-4746]
gb|EYY81787.1| hypothetical protein BX75_08785 [Escherichia coli O26:NM str.
2010C-4788]
gb|EYY84065.1| hypothetical protein BX73_13820 [Escherichia coli O111:NM str.
2010C-4735]
gb|EYY91294.1| hypothetical protein BX72_04605 [Escherichia coli O121:H19 str.
2010C-4732]
gb|EYY96737.1| hypothetical protein BX71_01405 [Escherichia coli O111:NM str.
2010C-4715]
gb|EYY97459.1| hypothetical protein BX70_14165 [Escherichia coli O111:NM str.
2010C-4622]
gb|EYZ03740.1| hypothetical protein BX69_19780 [Escherichia coli O111:NM str.
2010C-4592]
gb|EYZ10317.1| hypothetical protein BX68_20005 [Escherichia coli O177:NM str.
2010C-4558]
gb|EYZ23275.1| hypothetical protein BX65_23805 [Escherichia coli O103:H2 str.
2010C-4433]
gb|EYZ24925.1| hypothetical protein BX66_06775 [Escherichia coli O103:H25 str.
2010C-4529]
gb|EYZ32132.1| hypothetical protein BW94_13700 [Escherichia coli O157:H7 str.
06-4039]
gb|EYZ32569.1| hypothetical protein BW96_04410 [Escherichia coli O157:H7 str.
07-3391]
gb|EYZ37881.1| hypothetical protein BW95_19570 [Escherichia coli O157:H7 str.
07-3091]
gb|EYZ45408.1| hypothetical protein BW91_23310 [Escherichia coli O91:H14 str.
06-3691]
gb|EYZ51191.1| hypothetical protein BW92_11300 [Escherichia coli O157:H7 str.
06-3745]
gb|EYZ51718.1| hypothetical protein BW93_22240 [Escherichia coli O121:H19 str.
06-3822]
gb|EYZ60242.1| hypothetical protein BW88_20405 [Escherichia coli O79:H7 str.
06-3501]
gb|EYZ68296.1| hypothetical protein BW90_05365 [Escherichia coli O118:H16 str.
06-3612]
gb|EYZ74854.1| hypothetical protein BW85_13210 [Escherichia coli O69:H11 str.
06-3325]
gb|EYZ85132.1| hypothetical protein BW82_09350 [Escherichia coli O111:NM str.
04-3211]
gb|EYZ86938.1| hypothetical protein BW84_20385 [Escherichia coli O118:H16 str.
06-3256]
gb|EYZ87477.1| hypothetical protein BW83_23930 [Escherichia coli O121:H19 str.
06-3003]
gb|EZA00771.1| hypothetical protein BW78_04225 [Escherichia coli O174:H21 str.
03-3269]
gb|EZA06126.1| hypothetical protein BW80_01870 [Escherichia coli O111:NM str.
03-3484]
gb|EZA11372.1| hypothetical protein BW77_02145 [Escherichia coli O121:H19 str.
03-3227]
gb|EZA18902.1| hypothetical protein BW71_23480 [Escherichia coli O113:H21 str.
07-4224]
gb|EZA20832.1| hypothetical protein BW76_20320 [Escherichia coli O28ac:NM str.
02-3404]
gb|EZA30778.1| hypothetical protein BW74_04470 [Escherichia coli O45:H2 str.
01-3147]
gb|EZA37468.1| hypothetical protein BW70_00130 [Escherichia coli O174:H8 str.
04-3038]
gb|EZA40364.1| hypothetical protein BW69_04550 [Escherichia coli O103:H11 str.
04-3023]
gb|EZA66031.1| hypothetical protein BY39_18655 [Escherichia coli O104:H21 str.
94-3025]
gb|EZA71238.1| hypothetical protein BY40_08020 [Escherichia coli O157:H16 str.
98-3133]
gb|EZA76056.1| hypothetical protein BY44_16205 [Escherichia coli O6:H16 str.
F5656C1]
gb|EZA77085.1| hypothetical protein BY43_10675 [Escherichia coli O25:NM str.
E2539C1]
gb|EZA82021.1| hypothetical protein BY46_23545 [Escherichia coli O111:H8 str.
F6627]
gb|EZA86006.1| hypothetical protein BY45_10305 [Escherichia coli O157:H7 str.
F6142]
gb|EZA95820.1| hypothetical protein BY47_19050 [Escherichia coli O121:H19 str.
F6714]
gb|EZA98086.1| hypothetical protein BY49_20635 [Escherichia coli O157:H7 str.
F6750]
gb|EZB01264.1| hypothetical protein BY48_13705 [Escherichia coli O157:H7 str.
F6749]
gb|EZB09472.1| hypothetical protein BY50_07680 [Escherichia coli O157:H7 str.
F6751]
gb|EZB15900.1| hypothetical protein BY53_07930 [Escherichia coli O157:H7 str.
F7384]
gb|EZB19659.1| hypothetical protein BY52_24660 [Escherichia coli O157:H7 str.
F7377]
gb|EZB22791.1| hypothetical protein BY55_17815 [Escherichia coli O169:H41 str.
F9792]
gb|EZB28579.1| hypothetical protein BY54_24725 [Escherichia coli O157:H7 str.
F7410]
gb|EZB33108.1| hypothetical protein BY56_06765 [Escherichia coli O157:H7 str.
G5303]
gb|EZB38207.1| hypothetical protein BY57_16560 [Escherichia coli O157:H7 str.
H2495]
gb|EZB43285.1| hypothetical protein BY58_06830 [Escherichia coli O157:H7 str.
H2498]
gb|EZB48050.1| hypothetical protein BY59_02380 [Escherichia coli O157:H7 str.
K1420]
gb|EZB54999.1| hypothetical protein BY60_11935 [Escherichia coli O15:H18 str.
K1516]
gb|EZB60377.1| hypothetical protein BY62_08670 [Escherichia coli O157:H7 str.
K1793]
gb|EZB63472.1| hypothetical protein BY61_08290 [Escherichia coli O157:H7 str.
K1792]
gb|EZB66485.1| hypothetical protein BY65_02515 [Escherichia coli O157:H7 str.
K1845]
gb|EZB75581.1| hypothetical protein BY64_08405 [Escherichia coli O157:H7 str.
K1796]
gb|EZB75826.1| hypothetical protein BY63_10480 [Escherichia coli O157:H7 str.
K1795]
gb|EZB82126.1| hypothetical protein BY68_26245 [Escherichia coli O157:H7 str.
K2188]
gb|EZB87856.1| hypothetical protein BY67_09495 [Escherichia coli O157:H7 str.
K1927]
gb|EZB91867.1| hypothetical protein BY66_00785 [Escherichia coli O157:H7 str.
K1921]
gb|EZB96186.1| hypothetical protein BY70_04500 [Escherichia coli O157:H7 str.
K2192]
gb|EZB96508.1| hypothetical protein BY70_04015 [Escherichia coli O157:H7 str.
K2192]
gb|EZB98636.1| hypothetical protein BY71_17855 [Escherichia coli O157:H7 str.
K2324]
gb|EZC02687.1| hypothetical protein BY69_09220 [Escherichia coli O157:H7 str.
K2191]
gb|EZC17679.1| hypothetical protein BY72_01175 [Escherichia coli O157:H7 str.
K2581]
gb|EZC19861.1| hypothetical protein BY73_23605 [Escherichia coli O157:H7 str.
K2622]
gb|EZC24891.1| hypothetical protein BY76_25995 [Escherichia coli O157:H7 str.
K4396]
gb|EZC25182.1| hypothetical protein BY74_17685 [Escherichia coli O157:H7 str.
K2845]
gb|EZC29588.1| hypothetical protein BY75_18025 [Escherichia coli O157:H7 str.
K2854]
gb|EZC37980.1| hypothetical protein BY77_07700 [Escherichia coli O157:H7 str.
K4405]
gb|EZC43414.1| hypothetical protein BY78_13815 [Escherichia coli O157:H7 str.
K4406]
gb|EZC48212.1| hypothetical protein BY79_07890 [Escherichia coli O157:H7 str.
K4527]
gb|EZC49963.1| hypothetical protein BY80_21450 [Escherichia coli O121:H19 str.
K5198]
gb|EZC57279.1| hypothetical protein BY81_10185 [Escherichia coli O121:H19 str.
K5269]
gb|EZC61550.1| hypothetical protein BY82_17670 [Escherichia coli O157:H7 str.
K5418]
gb|EZC63925.1| hypothetical protein BY84_23560 [Escherichia coli O157:H7 str.
K5449]
gb|EZC69427.1| hypothetical protein BY83_01215 [Escherichia coli O157:H7 str.
K5448]
gb|EZC76108.1| hypothetical protein BY85_11660 [Escherichia coli O157:H7 str.
K5453]
gb|EZC77481.1| hypothetical protein BY87_25875 [Escherichia coli O157:H7 str.
K5467]
gb|EZC82623.1| hypothetical protein BY86_23125 [Escherichia coli O157:H7 str.
K5460]
gb|EZC93957.1| hypothetical protein BY88_06390 [Escherichia coli O157:H7 str.
K5602]
gb|EZC98506.1| hypothetical protein BY89_06515 [Escherichia coli O157:H7 str.
K5607]
gb|EZD03272.1| hypothetical protein BY90_09445 [Escherichia coli O157:H7 str.
K5609]
gb|EZD08116.1| hypothetical protein BY92_16580 [Escherichia coli O157:H7 str.
K5852]
gb|EZD14588.1| hypothetical protein BY94_03675 [Escherichia coli O157:H7 str.
K6676]
gb|EZD17057.1| hypothetical protein BY93_20270 [Escherichia coli O157:H7 str.
K6590]
gb|EZD25126.1| hypothetical protein BY95_10760 [Escherichia coli O157:H7 str.
K6687]
gb|EZD26618.1| hypothetical protein BY97_22545 [Escherichia coli O111:NM str.
K6723]
gb|EZD31266.1| hypothetical protein BY96_07720 [Escherichia coli O111:NM str.
K6722]
gb|EZD39644.1| hypothetical protein BY98_24235 [Escherichia coli O111:NM str.
K6728]
gb|EZD43307.1| hypothetical protein BY99_26035 [Escherichia coli O111:NM str.
K6890]
gb|EZD46647.1| hypothetical protein BZ00_01230 [Escherichia coli O111:NM str.
K6895]
gb|EZD49637.1| hypothetical protein BZ01_18500 [Escherichia coli O111:NM str.
K6897]
gb|EZD55162.1| hypothetical protein BZ02_12005 [Escherichia coli O111:NM str.
K6898]
gb|EZD59352.1| hypothetical protein BZ04_10910 [Escherichia coli O111:NM str.
K6908]
gb|EZD62079.1| hypothetical protein BZ03_08045 [Escherichia coli O111:NM str.
K6904]
gb|EZD72612.1| hypothetical protein BZ05_21910 [Escherichia coli O111:NM str.
K6915]
gb|EZD76027.1| hypothetical protein BZ06_02975 [Escherichia coli O157:H7 str.
K7140]
gb|EZD79319.1| hypothetical protein P411_24010 [Escherichia coli O39:NM str.
F8704-2]
gb|EZD79873.1| hypothetical protein BX04_18820 [Escherichia coli O157:H7 str.
08-4529]
gb|EZD91406.1| hypothetical protein BX05_25355 [Escherichia coli O157:NM str.
08-4540]
gb|EZD93580.1| hypothetical protein BX07_15440 [Escherichia coli O91:H14 str.
2009C-3227]
gb|EZE01460.1| hypothetical protein BX06_24350 [Escherichia coli O69:H11 str.
08-4661]
gb|EZE05699.1| hypothetical protein BX09_23145 [Escherichia coli O145:H28 str.
2009C-3292]
gb|EZE08585.1| hypothetical protein BX08_03100 [Escherichia coli O103:H2 str.
2009C-3279]
gb|EZE13070.1| hypothetical protein BX10_23020 [Escherichia coli O121:H7 str.
2009C-3299]
gb|EZE24946.1| hypothetical protein BX12_16960 [Escherichia coli O69:H11 str.
2009C-3601]
gb|EZE26324.1| hypothetical protein BX14_00740 [Escherichia coli O45:H2 str.
2009C-3686]
gb|EZE28005.1| hypothetical protein BX11_20340 [Escherichia coli O123:H11 str.
2009C-3307]
gb|EZE37489.1| hypothetical protein BX16_12740 [Escherichia coli O91:NM str.
2009C-3745]
gb|EZE38405.1| hypothetical protein BX18_21165 [Escherichia coli O111:NM str.
2009C-4006]
gb|EZE43643.1| hypothetical protein BX19_13340 [Escherichia coli O121:H19 str.
2009C-4050]
gb|EZE49461.1| hypothetical protein BX20_15890 [Escherichia coli O111:NM str.
2009C-4052]
gb|EZE56759.1| hypothetical protein BX23_27145 [Escherichia coli O118:H16 str.
2009C-4446]
gb|EZE58392.1| hypothetical protein BX22_15215 [Escherichia coli O157:H7 str.
2009C-4258]
gb|EZE64829.1| hypothetical protein BX24_10450 [Escherichia coli O91:H21 str.
2009C-4646]
gb|EZE72115.1| hypothetical protein BX29_12250 [Escherichia coli O45:H2 str.
2009C-4780]
gb|EZE77177.1| hypothetical protein BX27_18775 [Escherichia coli O121:H19 str.
2009C-4750]
gb|EZE86857.1| hypothetical protein BX31_03780 [Escherichia coli O121:H19 str.
2009EL1302]
gb|EZE88104.1| hypothetical protein BX35_16880 [Escherichia coli O157:H7 str.
2009EL1913]
gb|EZE89924.1| hypothetical protein BX33_00900 [Escherichia coli O157:H7 str.
2009EL1449]
gb|EZE98474.1| hypothetical protein BX53_01505 [Escherichia coli O121:H19 str.
2010C-3794]
gb|EZF02974.1| hypothetical protein BY38_20500 [Escherichia coli O157:H7 str.
2011EL-2313]
gb|EZF07933.1| hypothetical protein BY36_01495 [Escherichia coli O157:H7 str.
2011EL-2290]
gb|EZG32986.1| hypothetical protein AU10_04945 [Escherichia coli E1728]
gb|EZG48844.1| hypothetical protein BW86_16540 [Escherichia coli O26:H11 str.
06-3464]
gb|EZG54638.1| hypothetical protein BW81_15420 [Escherichia coli O26:H11 str.
03-3500]
gb|EZG62125.1| hypothetical protein BX64_03875 [Escherichia coli O26:H11 str.
2010C-4430]
gb|EZG71912.1| hypothetical protein BX80_17255 [Escherichia coli O26:H11 str.
2010C-4834]
gb|EZG73280.1| hypothetical protein BX85_21605 [Escherichia coli O26:H11 str.
2010C-5028]
gb|EZG81350.1| hypothetical protein BX88_19935 [Escherichia coli O26:H11 str.
2010EL-1699]
gb|EZG85298.1| hypothetical protein BX95_21675 [Escherichia coli O26:H11 str.
2011C-3270]
gb|EZG89752.1| hypothetical protein BX98_07660 [Escherichia coli O26:H11 str.
2011C-3387]
gb|EZH01283.1| hypothetical protein BX96_12915 [Escherichia coli O26:H11 str.
2011C-3282]
gb|EZH04796.1| hypothetical protein BY01_00015 [Escherichia coli O26:H11 str.
2011C-3506]
gb|EZH13716.1| hypothetical protein BX15_11555 [Escherichia coli O26:H11 str.
2009C-3689]
gb|EZH13949.1| hypothetical protein BY06_07410 [Escherichia coli O26:H11 str.
2011C-3655]
gb|EZH16649.1| hypothetical protein BX13_12655 [Escherichia coli O26:H11 str.
2009C-3612]
gb|EZH24785.1| hypothetical protein BX17_18540 [Escherichia coli O26:H11 str.
2009C-3996]
gb|EZH31342.1| hypothetical protein BX30_16635 [Escherichia coli O26:H11 str.
2009C-4826]
gb|EZH33307.1| hypothetical protein BX28_11420 [Escherichia coli O26:H11 str.
2009C-4760]
gb|EZH38481.1| hypothetical protein BX38_17170 [Escherichia coli O26:H11 str.
2010C-3051]
gb|EZH49309.1| hypothetical protein BX55_02455 [Escherichia coli O26:H11 str.
2010C-3871]
gb|EZH53848.1| hypothetical protein BX57_15190 [Escherichia coli O26:H11 str.
2010C-3902]
gb|EZH55638.1| hypothetical protein BX61_20130 [Escherichia coli O26:H11 str.
2010C-4244]
gb|EZJ17249.1| protein dcrB [Escherichia coli 1-182-04_S4_C3]
gb|EZJ20112.1| protein dcrB [Escherichia coli 1-176-05_S4_C3]
gb|EZJ29615.1| protein dcrB [Escherichia coli 1-392-07_S4_C2]
gb|EZJ34593.1| protein dcrB [Escherichia coli 1-250-04_S4_C2]
gb|EZJ38908.1| protein dcrB [Escherichia coli 1-182-04_S4_C2]
gb|EZJ52103.1| protein dcrB [Escherichia coli 1-250-04_S4_C1]
gb|EZJ59343.1| protein dcrB [Escherichia coli 1-182-04_S4_C1]
gb|EZJ67342.1| protein dcrB [Escherichia coli 1-176-05_S4_C1]
gb|EZJ67503.1| protein dcrB [Escherichia coli 1-392-07_S3_C3]
gb|EZJ69364.1| protein dcrB [Escherichia coli 1-182-04_S3_C3]
gb|EZJ80896.1| protein dcrB [Escherichia coli 1-182-04_S3_C2]
gb|EZJ82938.1| protein dcrB [Escherichia coli 1-250-04_S3_C1]
gb|EZJ89628.1| protein dcrB [Escherichia coli 1-182-04_S3_C1]
gb|EZJ93115.1| protein dcrB [Escherichia coli 1-182-04_S1_C3]
gb|EZJ94767.1| protein dcrB [Escherichia coli 1-250-04_S1_C3]
gb|EZK03466.1| protein dcrB [Escherichia coli 1-176-05_S1_C3]
gb|EZK11857.1| protein dcrB [Escherichia coli 2-005-03_S1_C3]
gb|EZK15939.1| protein dcrB [Escherichia coli 1-176-05_S1_C2]
gb|EZK19141.1| protein dcrB [Escherichia coli 2-011-08_S1_C2]
gb|EZK27950.1| protein dcrB [Escherichia coli 1-182-04_S1_C1]
gb|EZK29424.1| protein dcrB [Escherichia coli 2-005-03_S1_C2]
gb|EZK37680.1| protein dcrB [Escherichia coli 2-005-03_S1_C1]
gb|EZQ24053.1| hypothetical protein BX37_21630 [Escherichia coli O111:H8 str.
2009EL-2169]
gb|EZQ29936.1| hypothetical protein BX39_26365 [Escherichia coli O111:NM str.
2010C-3053]
gb|EZQ35682.1| hypothetical protein BX26_19925 [Escherichia coli O26:H1 str.
2009C-4747]
gb|EZQ41502.1| hypothetical protein BX21_04210 [Escherichia coli O111:H8 str.
2009C-4126]
gb|EZQ47825.1| hypothetical protein BX99_05725 [Escherichia coli O111:H8 str.
2011C-3453]
gb|EZQ49569.1| hypothetical protein BX90_10755 [Escherichia coli O157: str.
2010EL-2045]
gb|EZQ55127.1| hypothetical protein BX89_24205 [Escherichia coli O157: str.
2010EL-2044]
gb|EZQ70713.1| protein dcrB [Escherichia coli BIDMC 82]
gb|KDA62007.1| protein dcrB [Escherichia coli 2-052-05_S1_C1]
gb|KDA68899.1| protein dcrB [Escherichia coli 1-182-04_S1_C2]
gb|KDA71939.1| protein dcrB [Escherichia coli 2-005-03_S3_C2]
gb|KDA78079.1| protein dcrB [Escherichia coli 2-011-08_S3_C2]
gb|KDA83094.1| protein dcrB [Escherichia coli 2-011-08_S3_C3]
gb|KDA86926.1| protein dcrB [Escherichia coli 1-176-05_S4_C2]
gb|KDA87163.1| protein dcrB [Escherichia coli 1-176-05_S4_C2]
emb|CDP70188.1| Periplasmic protein [Escherichia coli]
emb|CDP78180.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
gb|KDF65003.1| protein dcrB [Escherichia coli BIDMC 59]
gb|KDG05262.1| protein dcrB [Escherichia coli BIDMC 71]
gb|KDG18956.1| protein dcrB [Escherichia coli BIDMC 74]
gb|KDG41206.1| protein dcrB [Escherichia coli BIDMC 77]
gb|KDG55639.1| protein dcrB [Escherichia coli CHS 77]
gb|KDG63256.1| protein dcrB [Escherichia coli MGH 57]
gb|KDG72500.1| protein dcrB [Escherichia coli MGH 58]
gb|KDG82776.1| protein dcrB [Escherichia coli UCI 57]
gb|KDG83222.1| protein dcrB [Escherichia coli UCI 58]
gb|KDG92318.1| protein dcrB [Escherichia coli UCI 65]
gb|KDG94359.1| protein dcrB [Escherichia coli UCI 66]
gb|KDM70666.1| hypothetical protein DA88_22635 [Escherichia coli]
gb|KDM88474.1| hypothetical protein DC22_01190 [Escherichia coli]
gb|KDP16976.1| hypothetical protein EP08_00435 [Escherichia coli]
gb|KDS96822.1| protein dcrB [Escherichia coli 2-011-08_S3_C1]
gb|KDS97024.1| protein dcrB [Escherichia coli 2-011-08_S1_C3]
gb|KDT03186.1| protein dcrB [Escherichia coli 2-011-08_S4_C1]
gb|KDT10814.1| protein dcrB [Escherichia coli 2-052-05_S1_C3]
gb|KDT15640.1| protein dcrB [Escherichia coli 2-011-08_S4_C3]
gb|KDT16937.1| protein dcrB [Escherichia coli 2-052-05_S3_C1]
gb|KDT31511.1| protein dcrB [Escherichia coli 3-105-05_S1_C1]
gb|KDT38683.1| protein dcrB [Escherichia coli 3-105-05_S3_C1]
gb|KDT50160.1| protein dcrB [Escherichia coli 3-105-05_S3_C2]
gb|KDT57099.1| protein dcrB [Escherichia coli 3-105-05_S4_C3]
gb|KDT60854.1| protein dcrB [Escherichia coli 3-267-03_S1_C3]
gb|KDT67273.1| protein dcrB [Escherichia coli 3-267-03_S3_C1]
gb|KDT71056.1| protein dcrB [Escherichia coli 3-373-03_S3_C1]
gb|KDT73592.1| protein dcrB [Escherichia coli 3-373-03_S3_C3]
gb|KDT80316.1| protein dcrB [Escherichia coli 3-373-03_S1_C2]
gb|KDT85776.1| protein dcrB [Escherichia coli 3-475-03_S4_C1]
gb|KDT89969.1| protein dcrB [Escherichia coli 3-475-03_S1_C1]
gb|KDT90671.1| protein dcrB [Escherichia coli 3-105-05_S4_C1]
gb|KDT97533.1| protein dcrB [Escherichia coli 3-267-03_S3_C2]
gb|KDU02866.1| protein dcrB [Escherichia coli 3-267-03_S1_C2]
gb|KDU06409.1| protein dcrB [Escherichia coli 3-105-05_S3_C3]
gb|KDU10463.1| protein dcrB [Escherichia coli 3-373-03_S3_C2]
gb|KDU18683.1| protein dcrB [Escherichia coli 3-267-03_S1_C1]
gb|KDU26392.1| protein dcrB [Escherichia coli 3-267-03_S4_C2]
gb|KDU31218.1| protein dcrB [Escherichia coli 3-373-03_S4_C2]
gb|KDU41398.1| protein dcrB [Escherichia coli 3-373-03_S1_C3]
gb|KDU46447.1| protein dcrB [Escherichia coli 3-373-03_S1_C1]
gb|KDU53095.1| protein dcrB [Escherichia coli 3-373-03_S4_C1]
gb|KDU53565.1| protein dcrB [Escherichia coli 3-475-03_S4_C2]
gb|KDU62862.1| protein dcrB [Escherichia coli 4-203-08_S1_C1]
gb|KDU68888.1| protein dcrB [Escherichia coli 4-203-08_S4_C3]
gb|KDV18750.1| hypothetical protein BW73_10830 [Escherichia coli O111:NM str.
01-3076]
gb|KDV19577.1| hypothetical protein BW72_11025 [Escherichia coli O78:H12 str.
00-3279]
gb|KDV33500.1| hypothetical protein BU59_12380 [Escherichia coli O69:H11 str.
07-3763]
gb|KDV37054.1| hypothetical protein BU56_11345 [Escherichia coli O145:H25 str.
07-3858]
gb|KDV40915.1| hypothetical protein BU55_20490 [Escherichia coli O146:H21 str.
2010C-3325]
gb|KDV45259.1| hypothetical protein BU53_09795 [Escherichia coli O91:H21 str.
2009C-3740]
gb|KDV53871.1| hypothetical protein BU57_20820 [Escherichia coli O121:H19 str.
2011C-3609]
gb|KDV58677.1| hypothetical protein BU54_11785 [Escherichia coli O45:H2 str.
2010C-4211]
gb|KDV63176.1| hypothetical protein BU64_13645 [Escherichia coli O128:H2 str.
2011C-3317]
gb|KDV68601.1| hypothetical protein BU58_14540 [Escherichia coli O26:H11 str.
2011C-3274]
gb|KDV74256.1| hypothetical protein BU63_19905 [Escherichia coli O118:H16 str.
07-4255]
gb|KDV79677.1| protein dcrB [Escherichia coli 2-052-05_S4_C2]
gb|KDV81070.1| protein dcrB [Escherichia coli 2-052-05_S3_C3]
gb|KDV81502.1| protein dcrB [Escherichia coli 2-052-05_S4_C3]
gb|KDV98682.1| protein dcrB [Escherichia coli 2-156-04_S3_C1]
gb|KDV99421.1| protein dcrB [Escherichia coli 2-156-04_S1_C3]
gb|KDW06010.1| protein dcrB [Escherichia coli 2-156-04_S3_C3]
gb|KDW13571.1| protein dcrB [Escherichia coli 2-177-06_S3_C1]
gb|KDW16214.1| protein dcrB [Escherichia coli 2-177-06_S1_C1]
gb|KDW16426.1| protein dcrB [Escherichia coli 2-156-04_S4_C1]
gb|KDW28888.1| protein dcrB [Escherichia coli 2-156-04_S3_C2]
gb|KDW29284.1| protein dcrB [Escherichia coli 2-177-06_S1_C2]
gb|KDW38417.1| protein dcrB [Escherichia coli 2-177-06_S1_C3]
gb|KDW43645.1| protein dcrB [Escherichia coli 2-177-06_S4_C2]
gb|KDW50497.1| protein dcrB [Escherichia coli 2-210-07_S1_C3]
gb|KDW55790.1| protein dcrB [Escherichia coli 1-392-07_S3_C2]
gb|KDW59731.1| protein dcrB [Escherichia coli 2-005-03_S3_C1]
gb|KDW67951.1| protein dcrB [Escherichia coli 2-005-03_S3_C3]
gb|KDW69395.1| protein dcrB [Escherichia coli 2-005-03_S4_C1]
gb|KDW73956.1| protein dcrB [Escherichia coli 1-392-07_S1_C1]
gb|KDW82182.1| protein dcrB [Escherichia coli 1-392-07_S1_C2]
gb|KDW88980.1| protein dcrB [Escherichia coli 2-210-07_S4_C1]
gb|KDW92292.1| protein dcrB [Escherichia coli 2-210-07_S1_C2]
gb|KDX00169.1| protein dcrB [Escherichia coli 2-210-07_S3_C2]
gb|KDX01784.1| protein dcrB [Escherichia coli 1-392-07_S3_C1]
gb|KDX11007.1| protein dcrB [Escherichia coli 2-177-06_S4_C3]
gb|KDX19640.1| protein dcrB [Escherichia coli 2-210-07_S3_C3]
gb|KDX23530.1| protein dcrB [Escherichia coli 2-156-04_S4_C2]
gb|KDX27411.1| protein dcrB [Escherichia coli 1-250-04_S1_C1]
gb|KDX30969.1| protein dcrB [Escherichia coli 1-250-04_S1_C2]
gb|KDX38980.1| protein dcrB [Escherichia coli 2-156-04_S4_C3]
gb|KDX45998.1| protein dcrB [Escherichia coli 2-177-06_S3_C2]
gb|KDX57036.1| protein dcrB [Escherichia coli 2-210-07_S3_C1]
gb|KDX60612.1| protein dcrB [Escherichia coli 2-210-07_S4_C2]
gb|KDX61098.1| protein dcrB [Escherichia coli 2-210-07_S4_C3]
gb|KDX64822.1| protein dcrB [Escherichia coli 2-222-05_S1_C1]
gb|KDX66596.1| protein dcrB [Escherichia coli 2-210-07_S4_C3]
gb|KDX73160.1| protein dcrB [Escherichia coli 2-222-05_S1_C2]
gb|KDX79188.1| protein dcrB [Escherichia coli 2-222-05_S1_C3]
gb|KDX88596.1| protein dcrB [Escherichia coli 2-222-05_S3_C3]
gb|KDX93423.1| protein dcrB [Escherichia coli 2-222-05_S4_C2]
gb|KDX96872.1| protein dcrB [Escherichia coli 2-316-03_S3_C1]
gb|KDY01982.1| protein dcrB [Escherichia coli 2-316-03_S3_C2]
gb|KDY05995.1| protein dcrB [Escherichia coli 2-316-03_S3_C3]
gb|KDY11631.1| protein dcrB [Escherichia coli 2-316-03_S4_C1]
gb|KDY23240.1| protein dcrB [Escherichia coli 2-316-03_S4_C2]
gb|KDY26170.1| protein dcrB [Escherichia coli 2-427-07_S1_C2]
gb|KDY32850.1| protein dcrB [Escherichia coli 2-427-07_S3_C3]
gb|KDY33056.1| protein dcrB [Escherichia coli 2-427-07_S3_C1]
gb|KDY48491.1| protein dcrB [Escherichia coli 2-427-07_S4_C1]
gb|KDY49932.1| protein dcrB [Escherichia coli 2-460-02_S3_C1]
gb|KDY56200.1| protein dcrB [Escherichia coli 2-460-02_S3_C2]
gb|KDY68577.1| protein dcrB [Escherichia coli 2-460-02_S3_C3]
gb|KDY69448.1| protein dcrB [Escherichia coli 2-460-02_S4_C2]
gb|KDY71970.1| protein dcrB [Escherichia coli 2-474-04_S1_C1]
gb|KDY74381.1| protein dcrB [Escherichia coli 2-474-04_S1_C1]
gb|KDY75998.1| protein dcrB [Escherichia coli 2-460-02_S4_C3]
gb|KDY85952.1| protein dcrB [Escherichia coli 2-474-04_S3_C2]
gb|KDY91471.1| protein dcrB [Escherichia coli 2-474-04_S3_C1]
gb|KDY94567.1| protein dcrB [Escherichia coli 2-427-07_S1_C3]
gb|KDZ02298.1| protein dcrB [Escherichia coli 2-474-04_S1_C2]
gb|KDZ07270.1| protein dcrB [Escherichia coli 2-474-04_S4_C2]
gb|KDZ15072.1| protein dcrB [Escherichia coli 2-474-04_S4_C3]
gb|KDZ19646.1| protein dcrB [Escherichia coli 2-474-04_S3_C3]
gb|KDZ23392.1| protein dcrB [Escherichia coli 3-020-07_S1_C1]
gb|KDZ27068.1| protein dcrB [Escherichia coli 3-020-07_S1_C2]
gb|KDZ32440.1| protein dcrB [Escherichia coli 3-020-07_S1_C3]
gb|KDZ40599.1| protein dcrB [Escherichia coli 3-020-07_S3_C1]
gb|KDZ44148.1| protein dcrB [Escherichia coli 3-020-07_S4_C2]
gb|KDZ52387.1| protein dcrB [Escherichia coli 3-020-07_S4_C3]
gb|KDZ59892.1| protein dcrB [Escherichia coli 3-073-06_S1_C2]
gb|KDZ70617.1| protein dcrB [Escherichia coli 3-073-06_S3_C1]
gb|KDZ72089.1| protein dcrB [Escherichia coli 3-073-06_S3_C2]
gb|KDZ73713.1| protein dcrB [Escherichia coli 3-073-06_S4_C2]
gb|KDZ81880.1| protein dcrB [Escherichia coli 3-105-05_S1_C2]
gb|KDZ89113.1| protein dcrB [Escherichia coli 3-105-05_S1_C3]
gb|KDZ96503.1| protein dcrB [Escherichia coli 2-427-07_S1_C1]
gb|KEJ08959.1| protein dcrB [Escherichia coli 6-175-07_S1_C2]
gb|KEJ22136.1| protein dcrB [Escherichia coli 2-316-03_S1_C1]
gb|KEJ23661.1| protein dcrB [Escherichia coli 2-316-03_S1_C2]
gb|KEJ44219.1| protein dcrB [Escherichia coli 2-427-07_S4_C3]
gb|KEJ47842.1| protein dcrB [Escherichia coli 2-460-02_S4_C1]
gb|KEJ58065.1| protein dcrB [Escherichia coli 3-267-03_S4_C1]
gb|KEJ66062.1| protein dcrB [Escherichia coli 3-020-07_S3_C2]
gb|KEJ72239.1| protein dcrB [Escherichia coli 5-366-08_S1_C3]
gb|KEK75975.1| protein dcrB [Escherichia coli 3-475-03_S3_C1]
gb|KEK83444.1| protein dcrB [Escherichia coli 3-475-03_S1_C2]
gb|KEK87508.1| protein dcrB [Escherichia coli 3-475-03_S3_C2]
gb|KEK94198.1| protein dcrB [Escherichia coli 4-203-08_S1_C2]
gb|KEL00243.1| protein dcrB [Escherichia coli 4-203-08_S1_C3]
gb|KEL02525.1| protein dcrB [Escherichia coli 4-203-08_S3_C3]
gb|KEL11957.1| protein dcrB [Escherichia coli 4-203-08_S4_C2]
gb|KEL14196.1| protein dcrB [Escherichia coli 4-203-08_S3_C2]
gb|KEL19478.1| protein dcrB [Escherichia coli 4-203-08_S3_C1]
gb|KEL25358.1| protein dcrB [Escherichia coli 3-373-03_S4_C3]
gb|KEL26323.1| protein dcrB [Escherichia coli 5-172-05_S4_C2]
gb|KEL32277.1| protein dcrB [Escherichia coli 5-366-08_S4_C2]
gb|KEL38743.1| protein dcrB [Escherichia coli 5-172-05_S4_C1]
gb|KEL44995.1| protein dcrB [Escherichia coli 5-172-05_S3_C1]
gb|KEL46766.1| protein dcrB [Escherichia coli 5-172-05_S3_C3]
gb|KEL59015.1| protein dcrB [Escherichia coli 5-172-05_S1_C3]
gb|KEL61187.1| protein dcrB [Escherichia coli 5-172-05_S4_C3]
gb|KEL70086.1| protein dcrB [Escherichia coli 5-366-08_S1_C1]
gb|KEL73718.1| protein dcrB [Escherichia coli 5-366-08_S3_C3]
gb|KEL86278.1| protein dcrB [Escherichia coli 5-366-08_S3_C2]
gb|KEL93555.1| protein dcrB [Escherichia coli 5-366-08_S3_C1]
gb|KEM02776.1| protein dcrB [Escherichia coli 6-175-07_S4_C2]
gb|KEM04101.1| protein dcrB [Escherichia coli 6-175-07_S4_C1]
gb|KEM29597.1| protein dcrB [Escherichia coli 6-319-05_S4_C2]
gb|KEM38571.1| protein dcrB [Escherichia coli 6-537-08_S1_C1]
gb|KEM46063.1| protein dcrB [Escherichia coli 6-175-07_S4_C3]
gb|KEM50790.1| protein dcrB [Escherichia coli 6-175-07_S1_C3]
gb|KEM57761.1| protein dcrB [Escherichia coli 6-319-05_S4_C3]
gb|KEM60210.1| protein dcrB [Escherichia coli 7-233-03_S1_C2]
gb|KEM70226.1| protein dcrB [Escherichia coli 7-233-03_S3_C1]
gb|KEM73728.1| protein dcrB [Escherichia coli 6-537-08_S3_C1]
gb|KEM81713.1| protein dcrB [Escherichia coli 6-537-08_S3_C3]
gb|KEM84209.1| protein dcrB [Escherichia coli 2-222-05_S4_C1]
gb|KEM89130.1| protein dcrB [Escherichia coli 6-537-08_S4_C1]
gb|KEM98291.1| protein dcrB [Escherichia coli 7-233-03_S1_C3]
gb|KEM99971.1| protein dcrB [Escherichia coli 7-233-03_S3_C3]
gb|KEN10818.1| protein dcrB [Escherichia coli 7-233-03_S4_C2]
gb|KEN15374.1| protein dcrB [Escherichia coli 6-537-08_S3_C2]
gb|KEN29921.1| protein dcrB [Escherichia coli 8-415-05_S1_C1]
gb|KEN39646.1| protein dcrB [Escherichia coli 7-233-03_S4_C1]
gb|KEN45518.1| protein dcrB [Escherichia coli 6-537-08_S1_C2]
gb|KEN52457.1| protein dcrB [Escherichia coli 7-233-03_S4_C3]
gb|KEN52592.1| protein dcrB [Escherichia coli 6-537-08_S1_C3]
gb|KEN61035.1| protein dcrB [Escherichia coli 6-537-08_S4_C2]
gb|KEN64570.1| protein dcrB [Escherichia coli 1-392-07_S4_C3]
gb|KEN80589.1| protein dcrB [Escherichia coli 2-052-05_S3_C2]
gb|KEN83193.1| protein dcrB [Escherichia coli 2-474-04_S4_C1]
gb|KEN87420.1| protein dcrB [Escherichia coli 2-222-05_S3_C1]
gb|KEN92582.1| protein dcrB [Escherichia coli 2-222-05_S3_C2]
gb|KEN96877.1| protein dcrB [Escherichia coli 2-222-05_S3_C1]
gb|KEN97142.1| protein dcrB [Escherichia coli 1-392-07_S4_C1]
gb|KEO04174.1| protein dcrB [Escherichia coli 2-222-05_S4_C3]
gb|KEO06862.1| protein dcrB [Escherichia coli 2-177-06_S3_C3]
gb|KEO06921.1| protein dcrB [Escherichia coli 8-415-05_S1_C2]
gb|KEO14341.1| protein dcrB [Escherichia coli 2-222-05_S4_C3]
gb|KEO21861.1| protein dcrB [Escherichia coli 5-366-08_S4_C1]
gb|KEO27146.1| protein dcrB [Escherichia coli 2-460-02_S1_C1]
gb|KEO28770.1| protein dcrB [Escherichia coli 1-250-04_S3_C2]
gb|KEO96187.1| hypothetical protein EH66_24765 [Escherichia coli]
gb|KEP08820.1| hypothetical protein EH62_03340 [Escherichia coli]
gb|KEP16621.1| hypothetical protein EH61_13595 [Escherichia coli]
gb|KEP77597.1| hypothetical protein AU08_0214060 [Escherichia coli E1140]
gb|AIF38753.1| hypothetical protein HQ24_17820 [Escherichia coli KLY]
emb|CDU37379.1| Periplasmic protein [Escherichia coli]
gb|AIF95994.1| DcrB protein precursor [Escherichia coli O157:H7 str. SS17]
gb|AIG70830.1| DcrB protein precursor [Escherichia coli O157:H7 str. EDL933]
gb|KFD78173.1| hypothetical protein JD73_03245 [Escherichia coli]
gb|KFF38709.1| hypothetical protein BC97_0202965 [Escherichia coli]
gb|KFF53560.1| hypothetical protein BC99_0304820 [Escherichia coli]
gb|KFH78199.1| hypothetical protein GR03_20590 [Escherichia coli]
gb|KFH78335.1| hypothetical protein GR04_13445 [Escherichia coli]
gb|KFH96832.1| hypothetical protein GR07_04095 [Escherichia coli]
gb|KFH97777.1| hypothetical protein GR02_20160 [Escherichia coli]
gb|AIL37796.1| Protein dcrB [Shigella flexneri 2003036]
gb|AIL42740.1| Protein dcrB [Shigella flexneri Shi06HN006]
gb|KFV25554.1| hypothetical protein GS40_11085 [Escherichia coli]
gb|KFV30401.1| hypothetical protein GS37_17930 [Escherichia coli]
gb|KFV32184.1| hypothetical protein GS38_03940 [Escherichia coli]
gb|KFV36151.1| hypothetical protein GS39_18045 [Escherichia coli]
emb|CEE08518.1| protein dcrB [Escherichia coli]
gb|AIN33800.1| putative lipoprotein [Escherichia coli BW25113]
gb|KFZ98214.1| protein dcrB [Shigella flexneri]
gb|KGA83352.1| hypothetical protein KV39_22265 [Escherichia coli]
emb|CDY63402.1| conserved protein involved in bacteriophage adsorption [Escherichia
coli]
emb|CDZ22246.1| conserved protein involved in bacteriophage adsorption [Escherichia
coli]
gb|KGI49822.1| DcrB protein precursor [Escherichia coli]
gb|AIT36609.1| hypothetical protein LI75_21070 [Escherichia coli FAP1]
gb|KGL68573.1| periplasmic protein [Escherichia coli NCTC 50110]
gb|KGM61828.1| Protein DcrB [Escherichia coli G3/10]
gb|KGM66490.1| Protein DcrB [Escherichia coli]
gb|KGM71619.1| Protein DcrB [Escherichia coli]
gb|KGM75512.1| Protein DcrB [Escherichia coli]
gb|KGM84242.1| Protein DcrB [Escherichia coli]
gb|KGM85165.1| Protein DcrB [Escherichia coli]
gb|KGP11301.1| hypothetical protein JQ57_12855 [Escherichia coli]
gb|KGP13397.1| hypothetical protein JQ58_11855 [Escherichia coli]
gb|KGP19239.1| hypothetical protein JQ56_10980 [Escherichia coli]
gb|KGP40092.1| hypothetical protein JQ59_07705 [Escherichia coli]
gb|KGT07457.1| hypothetical protein GY32_02645 [Escherichia coli]
gb|KGT13662.1| hypothetical protein JO89_11650 [Escherichia coli]
gb|KGT15676.1| hypothetical protein JO87_20970 [Escherichia coli]
gb|KGT19861.1| hypothetical protein JO90_14375 [Escherichia coli]
gb|KGT27337.1| hypothetical protein JO88_08870 [Escherichia coli]
gb|KGT32915.1| hypothetical protein JO86_02945 [Escherichia coli]
emb|CDX08882.1| hypothetical protein,hypothetical protein [Shigella flexneri]
gb|AIX65403.1| hypothetical protein ECONIH1_20215 [Escherichia coli]
gb|KHD42974.1| hypothetical protein LS39_04665 [Escherichia coli]
gb|KHD51136.1| hypothetical protein LS40_14505 [Escherichia coli]
gb|KHD52556.1| hypothetical protein LS41_07125 [Escherichia coli]
gb|KHD53705.1| hypothetical protein LS42_19830 [Escherichia coli]
gb|KHG75978.1| hypothetical protein PU77_05435 [Escherichia coli]
gb|KHG80731.1| hypothetical protein PU76_12680 [Escherichia coli]
gb|KHG85773.1| hypothetical protein PU75_02885 [Escherichia coli]
gb|KHG86090.1| hypothetical protein PU74_20775 [Escherichia coli]
gb|KHG97402.1| hypothetical protein PU72_13070 [Escherichia coli]
gb|KHG97840.1| hypothetical protein PU73_03200 [Escherichia coli]
gb|KHH03007.1| hypothetical protein PU71_12715 [Escherichia coli]
gb|KHH11477.1| hypothetical protein PU69_01540 [Escherichia coli]
gb|KHH15320.1| hypothetical protein PU67_16655 [Escherichia coli]
gb|KHH23465.1| hypothetical protein PU68_00545 [Escherichia coli]
gb|KHH27257.1| hypothetical protein PU61_21610 [Escherichia coli]
gb|KHH27855.1| hypothetical protein PU62_15310 [Escherichia coli]
gb|KHH39172.1| hypothetical protein PU60_06540 [Escherichia coli]
gb|KHH43484.1| hypothetical protein PU59_10110 [Escherichia coli]
gb|KHH51772.1| hypothetical protein PU56_17505 [Escherichia coli]
gb|KHH59510.1| hypothetical protein PU55_18720 [Escherichia coli]
gb|KHH59656.1| hypothetical protein PU57_00175 [Escherichia coli]
gb|KHH63067.1| hypothetical protein PU54_17920 [Escherichia coli]
gb|KHH75831.1| hypothetical protein PU51_17220 [Escherichia coli]
gb|KHH78881.1| hypothetical protein PU50_11800 [Escherichia coli]
gb|KHH81594.1| hypothetical protein PU49_12275 [Escherichia coli]
gb|KHH88928.1| hypothetical protein PU47_17730 [Escherichia coli]
gb|KHH91780.1| hypothetical protein PU46_17270 [Escherichia coli]
gb|KHI01052.1| hypothetical protein PU44_16865 [Escherichia coli]
gb|KHI02488.1| hypothetical protein PU48_10930 [Escherichia coli]
gb|KHI10393.1| hypothetical protein PU43_07610 [Escherichia coli]
gb|KHI10719.1| hypothetical protein PU36_22950 [Escherichia coli]
gb|KHI22208.1| hypothetical protein PU40_00150 [Escherichia coli]
gb|KHI23557.1| hypothetical protein PU35_11855 [Escherichia coli]
gb|KHI28283.1| hypothetical protein PU33_20555 [Escherichia coli]
gb|KHI28398.1| hypothetical protein PU34_18850 [Escherichia coli]
gb|KHI40889.1| hypothetical protein PU32_01545 [Escherichia coli]
gb|KHI46067.1| hypothetical protein PU31_05725 [Escherichia coli]
gb|KHI47960.1| hypothetical protein PU27_11595 [Escherichia coli]
gb|KHI53944.1| hypothetical protein PU22_23750 [Escherichia coli]
gb|KHI55204.1| hypothetical protein PU24_10380 [Escherichia coli]
gb|KHI60269.1| hypothetical protein PU26_09375 [Escherichia coli]
gb|KHI65326.1| hypothetical protein PU20_21910 [Escherichia coli]
gb|KHI69766.1| hypothetical protein PU19_18775 [Escherichia coli]
gb|KHI80098.1| hypothetical protein PU16_07395 [Escherichia coli]
gb|KHI87570.1| hypothetical protein PU14_14640 [Escherichia coli]
gb|KHI95147.1| hypothetical protein PU11_23390 [Escherichia coli]
gb|KHI98978.1| hypothetical protein PU15_03320 [Escherichia coli]
gb|KHJ00515.1| hypothetical protein PU12_06715 [Escherichia coli]
gb|KHJ08115.1| hypothetical protein PU08_10000 [Escherichia coli]
gb|KHJ14988.1| hypothetical protein PU10_03505 [Escherichia coli]
gb|KHJ18075.1| hypothetical protein PU06_13645 [Escherichia coli]
gb|KHJ25386.1| hypothetical protein PU03_11335 [Escherichia coli]
gb|KHJ29703.1| hypothetical protein PU04_01355 [Escherichia coli]
gb|AIZ29943.1| periplasmic protein, predicted lipoprotein [Escherichia coli
ER2796]
gb|AIZ53267.1| periplasmic protein, predicted lipoprotein [Escherichia coli K-12]
gb|AIZ84502.1| hypothetical protein HW42_22115 [Escherichia coli]
gb|AIZ89077.1| hypothetical protein HW43_22205 [Escherichia coli]
gb|AIZ89528.1| hypothetical protein EO53_00375 [Escherichia coli str. K-12 substr.
MG1655]
gb|AJA28467.1| DcrB protein precursor [Escherichia coli O157:H7 str. SS52]
gb|KHO59778.1| hypothetical protein RT53_05645 [Escherichia coli]
emb|CEK07465.1| periplasmic protein [Escherichia coli O26:H11]
gb|AJB53487.1| hypothetical protein RR31_18145 [Escherichia coli]
emb|CCQ30989.2| periplasmic protein, putative lipoprotein [Escherichia coli]
gb|KIE76649.1| hypothetical protein GT42_15455 [Escherichia coli]
gb|KIG28691.1| hypothetical protein ECC69171_01685 [Escherichia coli C691-71
(14b)]
gb|KIG31537.1| hypothetical protein PU66_14070 [Escherichia coli]
gb|KIG35596.1| hypothetical protein PU65_22760 [Escherichia coli]
gb|KIG36565.1| hypothetical protein PU70_17960 [Escherichia coli]
gb|KIG54301.1| hypothetical protein PU45_15905 [Escherichia coli]
gb|KIG56968.1| hypothetical protein PU53_00180 [Escherichia coli]
gb|KIG57436.1| hypothetical protein PU42_18735 [Escherichia coli]
gb|KIG67159.1| hypothetical protein PU39_10675 [Escherichia coli]
gb|KIG72405.1| hypothetical protein PU41_07040 [Escherichia coli]
gb|KIG78579.1| hypothetical protein PU37_04225 [Escherichia coli]
gb|KIG79936.1| hypothetical protein PU38_16860 [Escherichia coli]
gb|KIG89219.1| hypothetical protein PU30_04575 [Escherichia coli]
gb|KIG92446.1| hypothetical protein PU29_05245 [Escherichia coli]
gb|KIG95363.1| hypothetical protein PU23_20110 [Escherichia coli]
gb|KIH01053.1| hypothetical protein PU21_23545 [Escherichia coli]
gb|KIH02929.1| hypothetical protein PU25_11330 [Escherichia coli]
gb|KIH14802.1| hypothetical protein PU09_06455 [Escherichia coli]
gb|KIH16949.1| hypothetical protein PU17_08775 [Escherichia coli]
gb|KIH19028.1| hypothetical protein PU13_23175 [Escherichia coli]
gb|KIH21408.1| hypothetical protein PU05_19180 [Escherichia coli]
gb|KIH34596.1| hypothetical protein PD07_18820 [Escherichia coli]
gb|AJE58031.1| DcrB protein precursor [Escherichia coli]
gb|KII06820.1| hypothetical protein LS43_14755 [Escherichia coli]
gb|AJF58274.1| putative lipoprotein [Escherichia coli 1303]
gb|AJF78576.1| hypothetical protein TH69_17335 [Escherichia coli]
gb|KIN84374.1| hypothetical protein PU28_19900 [Escherichia coli]
gb|AJG10472.1| putative lipoprotein [Escherichia coli ECC-1470]
gb|KIO42373.1| hypothetical protein SU67_00500 [Escherichia coli O139:H28 str.
E24377A]
gb|AJH12092.1| hypothetical protein SR36_17130 [Escherichia coli]
gb|KIO85753.1| protein DcrB [Escherichia coli 97.0264]
gb|KIQ42203.1| hypothetical protein IY33_04755 [Escherichia coli]
gb|KIQ47486.1| hypothetical protein IY32_04750 [Escherichia coli]
gb|KIY30234.1| hypothetical protein TB57_01980 [Escherichia coli]
gb|KIZ12889.1| hypothetical protein UC39_01770 [Escherichia coli]
gb|KIZ59514.1| hypothetical protein UH28_16130 [Escherichia coli]
gb|KIZ62443.1| hypothetical protein UH34_15375 [Escherichia coli]
gb|KIZ73014.1| hypothetical protein UH35_13430 [Escherichia coli]
gb|KIZ80163.1| hypothetical protein UH32_01525 [Escherichia coli]
gb|KIZ83016.1| hypothetical protein UH29_11615 [Escherichia coli]
gb|KIZ89174.1| hypothetical protein UH37_06850 [Escherichia coli]
gb|KIZ92571.1| hypothetical protein UH33_12210 [Escherichia coli]
gb|KIZ98525.1| hypothetical protein UH36_07505 [Escherichia coli]
gb|KIZ98676.1| hypothetical protein UH27_21520 [Escherichia coli]
gb|KJA07445.1| hypothetical protein UH30_06990 [Escherichia coli]
gb|KJD64699.1| hypothetical protein LT79_04810 [Escherichia coli]
gb|KJD66086.1| hypothetical protein LP50_21980 [Escherichia coli]
gb|KJD73393.1| hypothetical protein LR66_19820 [Escherichia coli]
gb|KJD80713.1| hypothetical protein LR67_10820 [Escherichia coli]
gb|KJD85617.1| hypothetical protein LR65_01910 [Escherichia coli]
gb|KJD91935.1| hypothetical protein LV67_05300 [Escherichia coli]
gb|KJD92955.1| hypothetical protein LV68_14660 [Escherichia coli]
gb|KJH08093.1| hypothetical protein UC41_08200 [Escherichia coli]
gb|KJJ48476.1| hypothetical protein VM92_02995 [Escherichia coli]
gb|KJJ74981.1| putative lipoprotein [Escherichia coli]
gb|KJJ80084.1| putative lipoprotein [Escherichia coli]
gb|KJW24452.1| hypothetical protein UN88_21280 [Escherichia coli]
gb|KJW26390.1| hypothetical protein UN86_23125 [Escherichia coli]
gb|KJW32379.1| hypothetical protein UN87_13185 [Escherichia coli]
gb|KJW37050.1| hypothetical protein UN89_24850 [Escherichia coli]
gb|KJW54842.1| hypothetical protein UN92_25495 [Escherichia coli]
gb|KJW62753.1| hypothetical protein UN93_18480 [Escherichia coli]
gb|KJW67111.1| hypothetical protein UN94_09380 [Escherichia coli]
gb|KJW72214.1| hypothetical protein UN95_21870 [Escherichia coli]
gb|KJY10835.1| hypothetical protein UC21_15455 [Escherichia coli]
gb|AKA92648.1| protein DcrB [Escherichia coli VR50]
gb|KKB16638.1| hypothetical protein VP69_16375 [Escherichia coli]
gb|KKB23189.1| hypothetical protein VP68_05475 [Escherichia coli]
gb|AKC14392.1| hypothetical protein VK74_17995 [Escherichia coli]
gb|AKD62902.1| hypothetical protein SH05_21630 [Escherichia coli K-12]
gb|AKD67275.1| hypothetical protein SH02_21585 [Escherichia coli K-12]
gb|AKD71627.1| hypothetical protein SH08_21630 [Escherichia coli K-12]
gb|AKD75994.1| hypothetical protein SH03_21525 [Escherichia coli K-12]
gb|AKD80405.1| hypothetical protein SH06_21830 [Escherichia coli K-12]
gb|AKD84773.1| hypothetical protein SH04_21515 [Escherichia coli K-12]
gb|AKD89130.1| hypothetical protein SH07_21520 [Escherichia coli K-12]
gb|AKD93566.1| hypothetical protein SF31_21915 [Escherichia coli K-12]
gb|KKF77478.1| hypothetical protein XE90_15000 [Escherichia coli O157:H7]
gb|KKF81611.1| hypothetical protein XF37_21625 [Escherichia coli O157:H7]
gb|AKE87135.1| hypothetical protein AAF13_24800 [Escherichia coli O104:H4 str.
C227-11]
gb|KKK31068.1| hypothetical protein WY12_15620 [Escherichia coli]
gb|AKF22648.1| hypothetical protein DP32_20210 [Escherichia coli]
gb|AKF57229.1| putative lipoprotein [Escherichia coli]
gb|AKF61369.1| putative lipoprotein [Escherichia coli]
gb|AKF65507.1| putative lipoprotein [Escherichia coli]
gb|AKF69647.1| putative lipoprotein [Escherichia coli]
gb|AKF73786.1| putative lipoprotein [Escherichia coli]
gb|KKY45678.1| hypothetical protein AAY45_20200 [Escherichia coli O157:H7]
gb|AKH24132.1| hypothetical protein AA102_09425 [Escherichia coli]
gb|KLD50443.1| hypothetical protein XB00_15910 [Escherichia coli]
gb|KLG32003.1| hypothetical protein WQ65_09715 [Escherichia coli]
gb|KLG42416.1| hypothetical protein WQ92_11015 [Escherichia coli]
gb|KLG47988.1| hypothetical protein WR16_03905 [Escherichia coli]
gb|KLG55368.1| hypothetical protein WQ74_05165 [Escherichia coli]
gb|KLG63367.1| hypothetical protein WQ95_05705 [Escherichia coli]
gb|KLG65918.1| hypothetical protein WR00_17900 [Escherichia coli]
gb|KLG70241.1| hypothetical protein WR24_17010 [Escherichia coli]
gb|KLG76202.1| hypothetical protein WR12_15790 [Escherichia coli]
gb|KLG85355.1| hypothetical protein WR01_00245 [Escherichia coli]
gb|KLG94015.1| hypothetical protein WQ77_00965 [Escherichia coli]
gb|KLG95706.1| hypothetical protein WR05_01935 [Escherichia coli]
gb|KLG97084.1| hypothetical protein WR03_17560 [Escherichia coli]
gb|KLH02225.1| hypothetical protein WQ71_19645 [Escherichia coli]
gb|KLH08514.1| hypothetical protein WR23_23190 [Escherichia coli]
gb|KLH10227.1| hypothetical protein WQ88_04900 [Escherichia coli]
gb|KLH19306.1| hypothetical protein WQ72_03530 [Escherichia coli]
gb|KLH20811.1| hypothetical protein WR13_22450 [Escherichia coli]
gb|KLH27679.1| hypothetical protein WR17_13585 [Escherichia coli]
gb|KLH34258.1| hypothetical protein WQ96_14295 [Escherichia coli]
gb|KLH40591.1| hypothetical protein WQ69_00805 [Escherichia coli]
gb|KLH44238.1| hypothetical protein WQ84_07200 [Escherichia coli]
gb|KLH51622.1| hypothetical protein WQ70_13630 [Escherichia coli]
gb|KLH52219.1| hypothetical protein WQ99_07295 [Escherichia coli]
gb|KLH61197.1| hypothetical protein WQ64_02445 [Escherichia coli]
gb|KLH64248.1| hypothetical protein WQ79_16565 [Escherichia coli]
gb|KLH72610.1| hypothetical protein WQ73_05720 [Escherichia coli]
gb|KLH75266.1| hypothetical protein WQ66_02905 [Escherichia coli]
gb|KLH77370.1| hypothetical protein WR19_19525 [Escherichia coli]
gb|KLH87580.1| hypothetical protein WQ91_12630 [Escherichia coli]
gb|KLH88470.1| hypothetical protein WR04_02385 [Escherichia coli]
gb|KLH90459.1| hypothetical protein WR18_21625 [Escherichia coli]
gb|AKK50284.1| periplasmic protein [Escherichia coli PCN033]
gb|AKK55939.1| hypothetical protein SF2A_18935 [Shigella flexneri G1663]
gb|AKM37015.1| periplasmic protein [Escherichia coli PCN061]
gb|KLW96892.1| protein DcrB [Escherichia coli]
gb|KLX00860.1| protein DcrB [Escherichia coli]
gb|KLX33052.1| protein DcrB [Escherichia coli]
gb|KLX51942.1| protein DcrB [Escherichia coli]
gb|KLX64419.1| protein DcrB [Escherichia coli]
gb|KLX70044.1| protein DcrB [Escherichia coli]
gb|KLX73666.1| protein DcrB [Escherichia coli]
gb|KLX74809.1| protein DcrB [Escherichia coli]
gb|KLX91993.1| protein DcrB [Escherichia coli]
gb|KLX94402.1| protein DcrB [Escherichia coli]
gb|KME66990.1| protein DcrB [Escherichia coli]
gb|AKN49330.1| hypothetical protein TZ57_17200 [Escherichia coli]
gb|AKO54641.1| hypothetical protein AA953_01005 [Escherichia coli]
gb|AKP86448.1| periplasmic protein, predicted lipoprotein [Escherichia coli
ACN001]
emb|CEP56524.1| Uncharacterised protein [Shigella flexneri 2a]
gb|KMV37476.1| hypothetical protein ACM16_20745 [Escherichia coli]
gb|KMV42388.1| hypothetical protein ACM17_21355 [Escherichia coli]
gb|KMV43820.1| hypothetical protein ACM18_20510 [Escherichia coli]
gb|KMV46088.1| hypothetical protein ACM19_20715 [Escherichia coli]
gb|KMV59465.1| hypothetical protein ACM20_21130 [Escherichia coli]
gb|AKR22275.1| hypothetical protein ADS71_17795 [Escherichia coli]
gb|AKR26629.1| hypothetical protein ADZ27_17795 [Escherichia coli]
gb|AKR31110.1| hypothetical protein ADZ28_17795 [Escherichia coli]
gb|KNA42369.1| DCRB protein dcrB [Escherichia coli M114]
emb|CTD37816.1| Uncharacterised protein [Shigella sonnei]
emb|CTD06879.1| Uncharacterised protein [Shigella sonnei]
emb|CTC96493.1| Uncharacterised protein [Shigella sonnei]
emb|CTC94289.1| Uncharacterised protein [Shigella sonnei]
emb|CSP80512.1| Uncharacterised protein [Shigella sonnei]
emb|CTC77552.1| Uncharacterised protein [Shigella sonnei]
emb|CSS12126.1| Uncharacterised protein [Shigella sonnei]
emb|CTC82428.1| Uncharacterised protein [Shigella sonnei]
emb|CSR38681.1| Uncharacterised protein [Shigella sonnei]
emb|CSO92145.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ56440.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ66907.1| Uncharacterised protein [Shigella sonnei]
emb|CSP29852.1| Uncharacterised protein [Shigella sonnei]
emb|CSP38906.1| Uncharacterised protein [Shigella sonnei]
emb|CSG39761.1| Uncharacterised protein [Shigella sonnei]
emb|CTC71033.1| Uncharacterised protein [Shigella sonnei]
emb|CSP49918.1| Uncharacterised protein [Shigella sonnei]
emb|CSG32754.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ50897.1| Uncharacterised protein [Shigella sonnei]
emb|CSE79058.1| Uncharacterised protein [Shigella sonnei]
emb|CSP57129.1| Uncharacterised protein [Shigella sonnei]
emb|CSE33978.1| Uncharacterised protein [Shigella sonnei]
emb|CTC73797.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ32019.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ44222.1| Uncharacterised protein [Shigella sonnei]
emb|CSN93822.1| Uncharacterised protein [Shigella sonnei]
emb|CSR70811.1| Uncharacterised protein [Shigella sonnei]
emb|CSH42456.1| Uncharacterised protein [Shigella sonnei]
emb|CSP09843.1| Uncharacterised protein [Shigella sonnei]
emb|CSR23891.1| Uncharacterised protein [Shigella sonnei]
emb|CSO18606.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ89095.1| Uncharacterised protein [Shigella sonnei]
emb|CSR01305.1| Uncharacterised protein [Shigella sonnei]
emb|CSE58467.1| Uncharacterised protein [Shigella sonnei]
emb|CSE29150.1| Uncharacterised protein [Shigella sonnei]
emb|CSE67977.1| Uncharacterised protein [Shigella sonnei]
emb|CSN88987.1| Uncharacterised protein [Shigella sonnei]
emb|CSE44652.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ10178.1| Uncharacterised protein [Shigella sonnei]
emb|CSN84474.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ03500.1| Uncharacterised protein [Shigella sonnei]
emb|CSR43101.1| Uncharacterised protein [Shigella sonnei]
emb|CSN94842.1| Uncharacterised protein [Shigella sonnei]
emb|CSO94575.1| Uncharacterised protein [Shigella sonnei]
emb|CSG38500.1| Uncharacterised protein [Shigella sonnei]
emb|CSF04061.1| Uncharacterised protein [Shigella sonnei]
emb|CSF16475.1| Uncharacterised protein [Shigella sonnei]
emb|CSO14371.1| Uncharacterised protein [Shigella sonnei]
emb|CSE96161.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ87455.1| Uncharacterised protein [Shigella sonnei]
emb|CSP07229.1| Uncharacterised protein [Shigella sonnei]
emb|CSO78370.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ64532.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ93048.1| Uncharacterised protein [Shigella sonnei]
emb|CSE51531.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ15323.1| Uncharacterised protein [Shigella sonnei]
emb|CSE78878.1| Uncharacterised protein [Shigella sonnei]
emb|CSR29200.1| Uncharacterised protein [Shigella sonnei]
emb|CTC68195.1| Uncharacterised protein [Shigella sonnei]
emb|CSR21206.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ96755.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ34704.1| Uncharacterised protein [Shigella sonnei]
emb|CSE73015.1| Uncharacterised protein [Shigella sonnei]
emb|CSF67379.1| Uncharacterised protein [Shigella sonnei]
emb|CSE78499.1| Uncharacterised protein [Shigella sonnei]
emb|CSF78380.1| Uncharacterised protein [Shigella sonnei]
emb|CSS70358.1| Uncharacterised protein [Shigella sonnei]
emb|CSE94822.1| Uncharacterised protein [Shigella sonnei]
emb|CSO58395.1| Uncharacterised protein [Shigella sonnei]
emb|CSE67701.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ17317.1| Uncharacterised protein [Shigella sonnei]
emb|CSR89213.1| Uncharacterised protein [Shigella sonnei]
emb|CSE74012.1| Uncharacterised protein [Shigella sonnei]
emb|CSP28971.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ56589.1| Uncharacterised protein [Shigella sonnei]
emb|CSO41843.1| Uncharacterised protein [Shigella sonnei]
emb|CST50162.1| Uncharacterised protein [Shigella sonnei]
emb|CSO62079.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ91140.1| Uncharacterised protein [Shigella sonnei]
emb|CSP10803.1| Uncharacterised protein [Shigella sonnei]
emb|CSG37558.1| Uncharacterised protein [Shigella sonnei]
emb|CSN76770.1| Uncharacterised protein [Shigella sonnei]
emb|CSP83806.1| Uncharacterised protein [Shigella sonnei]
emb|CSR36796.1| Uncharacterised protein [Shigella sonnei]
emb|CSR12855.1| Uncharacterised protein [Shigella sonnei]
emb|CSR60798.1| Uncharacterised protein [Shigella sonnei]
emb|CSM51787.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ71655.1| Uncharacterised protein [Shigella sonnei]
emb|CSO23359.1| Uncharacterised protein [Shigella sonnei]
emb|CSM51633.1| Uncharacterised protein [Shigella sonnei]
emb|CSO74914.1| Uncharacterised protein [Shigella sonnei]
emb|CSO95873.1| Uncharacterised protein [Shigella sonnei]
emb|CSE28597.1| Uncharacterised protein [Shigella sonnei]
emb|CSO00214.1| Uncharacterised protein [Shigella sonnei]
emb|CSO29237.1| Uncharacterised protein [Shigella sonnei]
emb|CSO82063.1| Uncharacterised protein [Shigella sonnei]
emb|CSO11935.1| Uncharacterised protein [Shigella sonnei]
emb|CSK82447.1| Uncharacterised protein [Shigella sonnei]
emb|CST46979.1| Uncharacterised protein [Shigella sonnei]
emb|CSR55152.1| Uncharacterised protein [Shigella sonnei]
emb|CSE48563.1| Uncharacterised protein [Shigella sonnei]
emb|CSE89370.1| Uncharacterised protein [Shigella sonnei]
emb|CSN12241.1| Uncharacterised protein [Shigella sonnei]
emb|CSO47030.1| Uncharacterised protein [Shigella sonnei]
emb|CSP15519.1| Uncharacterised protein [Shigella sonnei]
emb|CSO72248.1| Uncharacterised protein [Shigella sonnei]
emb|CSN75334.1| Uncharacterised protein [Shigella sonnei]
emb|CSO84063.1| Uncharacterised protein [Shigella sonnei]
emb|CSU06048.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ37076.1| Uncharacterised protein [Shigella sonnei]
emb|CSO62311.1| Uncharacterised protein [Shigella sonnei]
emb|CSO70015.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ38277.1| Uncharacterised protein [Shigella sonnei]
emb|CST26444.1| Uncharacterised protein [Shigella sonnei]
emb|CSP34171.1| Uncharacterised protein [Shigella sonnei]
emb|CSM79864.1| Uncharacterised protein [Shigella sonnei]
emb|CSF79874.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ13739.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ38449.1| Uncharacterised protein [Shigella sonnei]
emb|CSP75034.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ92329.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ55848.1| Uncharacterised protein [Shigella sonnei]
emb|CSR34514.1| Uncharacterised protein [Shigella sonnei]
emb|CSS55841.1| Uncharacterised protein [Shigella sonnei]
emb|CSR71427.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ14885.1| Uncharacterised protein [Shigella sonnei]
emb|CSS88310.1| Uncharacterised protein [Shigella sonnei]
emb|CSW40273.1| Uncharacterised protein [Shigella sonnei]
emb|CSO64052.1| Uncharacterised protein [Shigella sonnei]
emb|CSM44543.1| Uncharacterised protein [Shigella sonnei]
emb|CSE75926.1| Uncharacterised protein [Shigella sonnei]
emb|CSL61512.1| Uncharacterised protein [Shigella sonnei]
emb|CSE95868.1| Uncharacterised protein [Shigella sonnei]
emb|CTP62549.1| Uncharacterised protein [Shigella sonnei]
emb|CSF20493.1| Uncharacterised protein [Shigella sonnei]
emb|CSU65242.1| Uncharacterised protein [Shigella sonnei]
emb|CST03614.1| Uncharacterised protein [Shigella sonnei]
emb|CSS60225.1| Uncharacterised protein [Shigella sonnei]
emb|CSV60621.1| Uncharacterised protein [Shigella sonnei]
emb|CSL52715.1| Uncharacterised protein [Shigella sonnei]
emb|CSF50247.1| Uncharacterised protein [Shigella sonnei]
emb|CSF09756.1| Uncharacterised protein [Shigella sonnei]
emb|CSV44501.1| Uncharacterised protein [Shigella sonnei]
emb|CSO01490.1| Uncharacterised protein [Shigella sonnei]
emb|CSL50582.1| Uncharacterised protein [Shigella sonnei]
emb|CSO70020.1| Uncharacterised protein [Shigella sonnei]
emb|CSS71898.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ16682.1| Uncharacterised protein [Shigella sonnei]
emb|CSO56562.1| Uncharacterised protein [Shigella sonnei]
emb|CSU06461.1| Uncharacterised protein [Shigella sonnei]
emb|CSE32397.1| Uncharacterised protein [Shigella sonnei]
emb|CSP68762.1| Uncharacterised protein [Shigella sonnei]
emb|CSR74598.1| Uncharacterised protein [Shigella sonnei]
emb|CSS66150.1| Uncharacterised protein [Shigella sonnei]
emb|CST80030.1| Uncharacterised protein [Shigella sonnei]
emb|CSF15987.1| Uncharacterised protein [Shigella sonnei]
emb|CSO34603.1| Uncharacterised protein [Shigella sonnei]
emb|CSR35902.1| Uncharacterised protein [Shigella sonnei]
emb|CSR35339.1| Uncharacterised protein [Shigella sonnei]
emb|CSV23776.1| Uncharacterised protein [Shigella sonnei]
emb|CSF40523.1| Uncharacterised protein [Shigella sonnei]
emb|CSF31269.1| Uncharacterised protein [Shigella sonnei]
emb|CSG51780.1| Uncharacterised protein [Shigella sonnei]
emb|CSN15424.1| Uncharacterised protein [Shigella sonnei]
emb|CSP74607.1| Uncharacterised protein [Shigella sonnei]
emb|CSO74750.1| Uncharacterised protein [Shigella sonnei]
emb|CSL89013.1| Uncharacterised protein [Shigella sonnei]
emb|CSI91602.1| Uncharacterised protein [Shigella sonnei]
emb|CSW63987.1| Uncharacterised protein [Shigella sonnei]
emb|CSE27917.1| Uncharacterised protein [Shigella sonnei]
emb|CSU80092.1| Uncharacterised protein [Shigella sonnei]
emb|CTC40483.1| Uncharacterised protein [Shigella sonnei]
emb|CSE99540.1| Uncharacterised protein [Shigella sonnei]
emb|CTC45168.1| Uncharacterised protein [Shigella sonnei]
emb|CSX19892.1| Uncharacterised protein [Shigella sonnei]
emb|CSF45666.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ72486.1| Uncharacterised protein [Shigella sonnei]
emb|CTA11517.1| Uncharacterised protein [Shigella sonnei]
emb|CSW49979.1| Uncharacterised protein [Shigella sonnei]
emb|CSL48006.1| Uncharacterised protein [Shigella sonnei]
emb|CSR41906.1| Uncharacterised protein [Shigella sonnei]
emb|CSS94547.1| Uncharacterised protein [Shigella sonnei]
emb|CSU57667.1| Uncharacterised protein [Shigella sonnei]
emb|CTP64392.1| Uncharacterised protein [Shigella sonnei]
emb|CSF53788.1| Uncharacterised protein [Shigella sonnei]
emb|CSR68817.1| Uncharacterised protein [Shigella sonnei]
emb|CSR23485.1| Uncharacterised protein [Shigella sonnei]
emb|CSS20533.1| Uncharacterised protein [Shigella sonnei]
emb|CSF48620.1| Uncharacterised protein [Shigella sonnei]
emb|CSL79856.1| Uncharacterised protein [Shigella sonnei]
emb|CST57816.1| Uncharacterised protein [Shigella sonnei]
emb|CSR88145.1| Uncharacterised protein [Shigella sonnei]
emb|CSN06924.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ39261.1| Uncharacterised protein [Shigella sonnei]
emb|CSL57641.1| Uncharacterised protein [Shigella sonnei]
emb|CSY57856.1| Uncharacterised protein [Shigella sonnei]
emb|CSU59793.1| Uncharacterised protein [Shigella sonnei]
emb|CST60364.1| Uncharacterised protein [Shigella sonnei]
emb|CSG82924.1| Uncharacterised protein [Shigella sonnei]
emb|CSU90058.1| Uncharacterised protein [Shigella sonnei]
emb|CSV23544.1| Uncharacterised protein [Shigella sonnei]
emb|CSU81062.1| Uncharacterised protein [Shigella sonnei]
emb|CSL70261.1| Uncharacterised protein [Shigella sonnei]
emb|CSW83849.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ01457.1| Uncharacterised protein [Shigella sonnei]
emb|CSS88349.1| Uncharacterised protein [Shigella sonnei]
emb|CSW94653.1| Uncharacterised protein [Shigella sonnei]
emb|CSR68759.1| Uncharacterised protein [Shigella sonnei]
emb|CSX96606.1| Uncharacterised protein [Shigella sonnei]
emb|CSU32908.1| Uncharacterised protein [Shigella sonnei]
emb|CSR01956.1| Uncharacterised protein [Shigella sonnei]
emb|CSL27879.1| Uncharacterised protein [Shigella sonnei]
emb|CSW13769.1| Uncharacterised protein [Shigella sonnei]
emb|CSR62703.1| Uncharacterised protein [Shigella sonnei]
emb|CSX78497.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ48701.1| Uncharacterised protein [Shigella sonnei]
emb|CSO14701.1| Uncharacterised protein [Shigella sonnei]
emb|CSF29477.1| Uncharacterised protein [Shigella sonnei]
emb|CSX02183.1| Uncharacterised protein [Shigella sonnei]
emb|CSV08007.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ33822.1| Uncharacterised protein [Shigella sonnei]
emb|CSK26401.1| Uncharacterised protein [Shigella sonnei]
emb|CSS27863.1| Uncharacterised protein [Shigella sonnei]
emb|CSU90180.1| Uncharacterised protein [Shigella sonnei]
emb|CSL42359.1| Uncharacterised protein [Shigella sonnei]
emb|CSU11032.1| Uncharacterised protein [Shigella sonnei]
emb|CTP65926.1| Uncharacterised protein [Shigella sonnei]
emb|CSI63757.1| Uncharacterised protein [Shigella sonnei]
emb|CSO09186.1| Uncharacterised protein [Shigella sonnei]
emb|CSW68402.1| Uncharacterised protein [Shigella sonnei]
emb|CSG85233.1| Uncharacterised protein [Shigella sonnei]
emb|CSX68112.1| Uncharacterised protein [Shigella sonnei]
emb|CSK53911.1| Uncharacterised protein [Shigella sonnei]
emb|CSS21711.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ84128.1| Uncharacterised protein [Shigella sonnei]
emb|CSL25097.1| Uncharacterised protein [Shigella sonnei]
emb|CSV56235.1| Uncharacterised protein [Shigella sonnei]
emb|CSU60935.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ74404.1| Uncharacterised protein [Shigella sonnei]
emb|CSF42837.1| Uncharacterised protein [Shigella sonnei]
emb|CSU16344.1| Uncharacterised protein [Shigella sonnei]
emb|CSX22516.1| Uncharacterised protein [Shigella sonnei]
emb|CSL28370.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ18072.1| Uncharacterised protein [Shigella sonnei]
emb|CSX01234.1| Uncharacterised protein [Shigella sonnei]
emb|CSK45296.1| Uncharacterised protein [Shigella sonnei]
emb|CSE54006.1| Uncharacterised protein [Shigella sonnei]
emb|CSR56270.1| Uncharacterised protein [Shigella sonnei]
emb|CSM91037.1| Uncharacterised protein [Shigella sonnei]
emb|CSL75624.1| Uncharacterised protein [Shigella sonnei]
emb|CSS11238.1| Uncharacterised protein [Shigella sonnei]
emb|CSU92656.1| Uncharacterised protein [Shigella sonnei]
emb|CSV23737.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ34577.1| Uncharacterised protein [Shigella sonnei]
emb|CSX68424.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ68521.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ58610.1| Uncharacterised protein [Shigella sonnei]
emb|CSK59905.1| Uncharacterised protein [Shigella sonnei]
emb|CSX88484.1| Uncharacterised protein [Shigella sonnei]
emb|CSH95636.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ12940.1| Uncharacterised protein [Shigella sonnei]
emb|CSU67936.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ57786.1| Uncharacterised protein [Shigella sonnei]
emb|CSI83583.1| Uncharacterised protein [Shigella sonnei]
emb|CSL10302.1| Uncharacterised protein [Shigella sonnei]
emb|CTB03209.1| Uncharacterised protein [Shigella sonnei]
emb|CSU31438.1| Uncharacterised protein [Shigella sonnei]
emb|CSR39380.1| Uncharacterised protein [Shigella sonnei]
emb|CSM00293.1| Uncharacterised protein [Shigella sonnei]
emb|CSR29719.1| Uncharacterised protein [Shigella sonnei]
emb|CSK16019.1| Uncharacterised protein [Shigella sonnei]
emb|CSU32756.1| Uncharacterised protein [Shigella sonnei]
emb|CSI60329.1| Uncharacterised protein [Shigella sonnei]
emb|CST91835.1| Uncharacterised protein [Shigella sonnei]
emb|CSK98508.1| Uncharacterised protein [Shigella sonnei]
emb|CSK29454.1| Uncharacterised protein [Shigella sonnei]
emb|CSL27093.1| Uncharacterised protein [Shigella sonnei]
emb|CSS28907.1| Uncharacterised protein [Shigella sonnei]
emb|CSK62512.1| Uncharacterised protein [Shigella sonnei]
emb|CSX21079.1| Uncharacterised protein [Shigella sonnei]
emb|CSU04275.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ06844.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ73108.1| Uncharacterised protein [Shigella sonnei]
emb|CSX18960.1| Uncharacterised protein [Shigella sonnei]
emb|CSV09464.1| Uncharacterised protein [Shigella sonnei]
emb|CSL60684.1| Uncharacterised protein [Shigella sonnei]
emb|CSX20208.1| Uncharacterised protein [Shigella sonnei]
emb|CSF63957.1| Uncharacterised protein [Shigella sonnei]
emb|CTA75459.1| Uncharacterised protein [Shigella sonnei]
emb|CSU69417.1| Uncharacterised protein [Shigella sonnei]
emb|CSR65420.1| Uncharacterised protein [Shigella sonnei]
emb|CSH30703.1| Uncharacterised protein [Shigella sonnei]
emb|CSR36476.1| Uncharacterised protein [Shigella sonnei]
emb|CSL15008.1| Uncharacterised protein [Shigella sonnei]
emb|CSL57224.1| Uncharacterised protein [Shigella sonnei]
emb|CST70012.1| Uncharacterised protein [Shigella sonnei]
emb|CSV09856.1| Uncharacterised protein [Shigella sonnei]
emb|CTB45745.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ23927.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ47806.1| Uncharacterised protein [Shigella sonnei]
emb|CSF10413.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ68935.1| Uncharacterised protein [Shigella sonnei]
emb|CSU53164.1| Uncharacterised protein [Shigella sonnei]
emb|CSW08619.1| Uncharacterised protein [Shigella sonnei]
emb|CSX65204.1| Uncharacterised protein [Shigella sonnei]
emb|CSV26048.1| Uncharacterised protein [Shigella sonnei]
emb|CSX27617.1| Uncharacterised protein [Shigella sonnei]
emb|CSI48868.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ73523.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ52351.1| Uncharacterised protein [Shigella sonnei]
emb|CSY20454.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ36688.1| Uncharacterised protein [Shigella sonnei]
emb|CSX75708.1| Uncharacterised protein [Shigella sonnei]
emb|CSF38390.1| Uncharacterised protein [Shigella sonnei]
emb|CSG44534.1| Uncharacterised protein [Shigella sonnei]
emb|CSU99407.1| Uncharacterised protein [Shigella sonnei]
emb|CSM38969.1| Uncharacterised protein [Shigella sonnei]
emb|CSR02684.1| Uncharacterised protein [Shigella sonnei]
emb|CTB62254.1| Uncharacterised protein [Shigella sonnei]
emb|CTC36916.1| Uncharacterised protein [Shigella sonnei]
emb|CSY09397.1| Uncharacterised protein [Shigella sonnei]
emb|CSU55066.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ86403.1| Uncharacterised protein [Shigella sonnei]
emb|CSY66382.1| Uncharacterised protein [Shigella sonnei]
emb|CTB25230.1| Uncharacterised protein [Shigella sonnei]
emb|CSV59423.1| Uncharacterised protein [Shigella sonnei]
emb|CSX81299.1| Uncharacterised protein [Shigella sonnei]
emb|CSV64273.1| Uncharacterised protein [Shigella sonnei]
emb|CSM15365.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ68074.1| Uncharacterised protein [Shigella sonnei]
emb|CSX68592.1| Uncharacterised protein [Shigella sonnei]
emb|CSF11125.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ31508.1| Uncharacterised protein [Shigella sonnei]
emb|CSH01736.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ62137.1| Uncharacterised protein [Shigella sonnei]
emb|CST73916.1| Uncharacterised protein [Shigella sonnei]
emb|CSE91888.1| Uncharacterised protein [Shigella sonnei]
emb|CSI74107.1| Uncharacterised protein [Shigella sonnei]
emb|CSL74658.1| Uncharacterised protein [Shigella sonnei]
emb|CTD67015.1| Uncharacterised protein [Shigella sonnei]
emb|CSL73446.1| Uncharacterised protein [Shigella sonnei]
emb|CSV24320.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ29327.1| Uncharacterised protein [Shigella sonnei]
emb|CSS26315.1| Uncharacterised protein [Shigella sonnei]
emb|CSY25673.1| Uncharacterised protein [Shigella sonnei]
emb|CSG82158.1| Uncharacterised protein [Shigella sonnei]
emb|CSI59231.1| Uncharacterised protein [Shigella sonnei]
emb|CSU66679.1| Uncharacterised protein [Shigella sonnei]
emb|CSM07379.1| Uncharacterised protein [Shigella sonnei]
emb|CSU67144.1| Uncharacterised protein [Shigella sonnei]
emb|CSN67883.1| Uncharacterised protein [Shigella sonnei]
emb|CSS18541.1| Uncharacterised protein [Shigella sonnei]
emb|CSV13706.1| Uncharacterised protein [Shigella sonnei]
emb|CSL92986.1| Uncharacterised protein [Shigella sonnei]
emb|CSH65568.1| Uncharacterised protein [Shigella sonnei]
emb|CSU72171.1| Uncharacterised protein [Shigella sonnei]
emb|CSX60375.1| Uncharacterised protein [Shigella sonnei]
emb|CSX88147.1| Uncharacterised protein [Shigella sonnei]
emb|CSX94985.1| Uncharacterised protein [Shigella sonnei]
emb|CSX21077.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ31783.1| Uncharacterised protein [Shigella sonnei]
emb|CSO78621.1| Uncharacterised protein [Shigella sonnei]
emb|CTB79727.1| Uncharacterised protein [Shigella sonnei]
emb|CSO59131.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ33366.1| Uncharacterised protein [Shigella sonnei]
emb|CSX43935.1| Uncharacterised protein [Shigella sonnei]
emb|CSL82316.1| Uncharacterised protein [Shigella sonnei]
emb|CSW67679.1| Uncharacterised protein [Shigella sonnei]
emb|CSG88341.1| Uncharacterised protein [Shigella sonnei]
emb|CTB30027.1| Uncharacterised protein [Shigella sonnei]
emb|CSX71751.1| Uncharacterised protein [Shigella sonnei]
emb|CTD58210.1| Uncharacterised protein [Shigella sonnei]
emb|CSU70807.1| Uncharacterised protein [Shigella sonnei]
emb|CST70715.1| Uncharacterised protein [Shigella sonnei]
emb|CSW94618.1| Uncharacterised protein [Shigella sonnei]
emb|CSU40402.1| Uncharacterised protein [Shigella sonnei]
emb|CTA01955.1| Uncharacterised protein [Shigella sonnei]
emb|CSV47091.1| Uncharacterised protein [Shigella sonnei]
emb|CSO14980.1| Uncharacterised protein [Shigella sonnei]
emb|CSR05496.1| Uncharacterised protein [Shigella sonnei]
emb|CSX11906.1| Uncharacterised protein [Shigella sonnei]
emb|CSQ98328.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ25285.1| Uncharacterised protein [Shigella sonnei]
emb|CSH45427.1| Uncharacterised protein [Shigella sonnei]
emb|CTB30215.1| Uncharacterised protein [Shigella sonnei]
emb|CSH33826.1| Uncharacterised protein [Shigella sonnei]
emb|CSW97217.1| Uncharacterised protein [Shigella sonnei]
emb|CSH85729.1| Uncharacterised protein [Shigella sonnei]
emb|CSX20751.1| Uncharacterised protein [Shigella sonnei]
emb|CSY06224.1| Uncharacterised protein [Shigella sonnei]
emb|CTB37851.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ24139.1| Uncharacterised protein [Shigella sonnei]
emb|CSH42402.1| Uncharacterised protein [Shigella sonnei]
emb|CSW99328.1| Uncharacterised protein [Shigella sonnei]
emb|CSX12944.1| Uncharacterised protein [Shigella sonnei]
emb|CSM33391.1| Uncharacterised protein [Shigella sonnei]
emb|CSO94517.1| Uncharacterised protein [Shigella sonnei]
emb|CSH57949.1| Uncharacterised protein [Shigella sonnei]
emb|CSU34854.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ79863.1| Uncharacterised protein [Shigella sonnei]
emb|CSK09587.1| Uncharacterised protein [Shigella sonnei]
emb|CTC69860.1| Uncharacterised protein [Shigella sonnei]
emb|CSU57098.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ19806.1| Uncharacterised protein [Shigella sonnei]
emb|CTB26654.1| Uncharacterised protein [Shigella sonnei]
emb|CSU56081.1| Uncharacterised protein [Shigella sonnei]
emb|CSX52387.1| Uncharacterised protein [Shigella sonnei]
emb|CSX04738.1| Uncharacterised protein [Shigella sonnei]
emb|CSH51845.1| Uncharacterised protein [Shigella sonnei]
emb|CSR96157.1| Uncharacterised protein [Shigella sonnei]
emb|CTB29816.1| Uncharacterised protein [Shigella sonnei]
emb|CSR90029.1| Uncharacterised protein [Shigella sonnei]
emb|CSV74193.1| Uncharacterised protein [Shigella sonnei]
emb|CTB40785.1| Uncharacterised protein [Shigella sonnei]
emb|CSI47190.1| Uncharacterised protein [Shigella sonnei]
emb|CSM09262.1| Uncharacterised protein [Shigella sonnei]
emb|CSH57438.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ29494.1| Uncharacterised protein [Shigella sonnei]
emb|CSH05722.1| Uncharacterised protein [Shigella sonnei]
emb|CTA04701.1| Uncharacterised protein [Shigella sonnei]
emb|CSM20138.1| Uncharacterised protein [Shigella sonnei]
emb|CSL58340.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ06198.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ73090.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ45844.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ01680.1| Uncharacterised protein [Shigella sonnei]
emb|CSM36669.1| Uncharacterised protein [Shigella sonnei]
emb|CTB86401.1| Uncharacterised protein [Shigella sonnei]
emb|CTB26369.1| Uncharacterised protein [Shigella sonnei]
emb|CTD71454.1| Uncharacterised protein [Shigella sonnei]
emb|CTC31552.1| Uncharacterised protein [Shigella sonnei]
emb|CTB26040.1| Uncharacterised protein [Shigella sonnei]
emb|CTC23432.1| Uncharacterised protein [Shigella sonnei]
emb|CSL68455.1| Uncharacterised protein [Shigella sonnei]
emb|CSX62941.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ70892.1| Uncharacterised protein [Shigella sonnei]
emb|CSX95316.1| Uncharacterised protein [Shigella sonnei]
emb|CSH02580.1| Uncharacterised protein [Shigella sonnei]
emb|CTC04632.1| Uncharacterised protein [Shigella sonnei]
emb|CSX13794.1| Uncharacterised protein [Shigella sonnei]
emb|CSU44808.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ50785.1| Uncharacterised protein [Shigella sonnei]
emb|CTC04059.1| Uncharacterised protein [Shigella sonnei]
emb|CSH43988.1| Uncharacterised protein [Shigella sonnei]
emb|CSS30754.1| Uncharacterised protein [Shigella sonnei]
emb|CST31376.1| Uncharacterised protein [Shigella sonnei]
emb|CSL84097.1| Uncharacterised protein [Shigella sonnei]
emb|CTC51149.1| Uncharacterised protein [Shigella sonnei]
emb|CSU38522.1| Uncharacterised protein [Shigella sonnei]
emb|CSU49789.1| Uncharacterised protein [Shigella sonnei]
emb|CSY40307.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ03712.1| Uncharacterised protein [Shigella sonnei]
emb|CSX72480.1| Uncharacterised protein [Shigella sonnei]
emb|CST77931.1| Uncharacterised protein [Shigella sonnei]
emb|CTB37676.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ20366.1| Uncharacterised protein [Shigella sonnei]
emb|CSG96587.1| Uncharacterised protein [Shigella sonnei]
emb|CSU12379.1| Uncharacterised protein [Shigella sonnei]
emb|CTC60875.1| Uncharacterised protein [Shigella sonnei]
emb|CSX74901.1| Uncharacterised protein [Shigella sonnei]
emb|CSX02849.1| Uncharacterised protein [Shigella sonnei]
emb|CSH08086.1| Uncharacterised protein [Shigella sonnei]
emb|CSG74107.1| Uncharacterised protein [Shigella sonnei]
emb|CSI64441.1| Uncharacterised protein [Shigella sonnei]
emb|CSG91588.1| Uncharacterised protein [Shigella sonnei]
emb|CSU51773.1| Uncharacterised protein [Shigella sonnei]
emb|CSG43125.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ98034.1| Uncharacterised protein [Shigella sonnei]
emb|CSY78875.1| Uncharacterised protein [Shigella sonnei]
emb|CTC15125.1| Uncharacterised protein [Shigella sonnei]
emb|CSM21944.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ32578.1| Uncharacterised protein [Shigella sonnei]
emb|CSX93730.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ34427.1| Uncharacterised protein [Shigella sonnei]
emb|CSU57309.1| Uncharacterised protein [Shigella sonnei]
emb|CSU85172.1| Uncharacterised protein [Shigella sonnei]
emb|CSG59951.1| Uncharacterised protein [Shigella sonnei]
emb|CSU50703.1| Uncharacterised protein [Shigella sonnei]
emb|CSH91799.1| Uncharacterised protein [Shigella sonnei]
emb|CSH42063.1| Uncharacterised protein [Shigella sonnei]
emb|CSU72712.1| Uncharacterised protein [Shigella sonnei]
emb|CSW84593.1| Uncharacterised protein [Shigella sonnei]
emb|CSX24459.1| Uncharacterised protein [Shigella sonnei]
emb|CSG92493.1| Uncharacterised protein [Shigella sonnei]
emb|CSG55523.1| Uncharacterised protein [Shigella sonnei]
emb|CSG49763.1| Uncharacterised protein [Shigella sonnei]
emb|CTA77418.1| Uncharacterised protein [Shigella sonnei]
emb|CTA76656.1| Uncharacterised protein [Shigella sonnei]
emb|CSZ86731.1| Uncharacterised protein [Shigella sonnei]
emb|CTA75524.1| Uncharacterised protein [Shigella sonnei]
emb|CTA37283.1| Uncharacterised protein [Shigella sonnei]
emb|CTA21790.1| Uncharacterised protein [Shigella sonnei]
emb|CSH51553.1| Uncharacterised protein [Shigella sonnei]
emb|CSH73774.1| Uncharacterised protein [Shigella sonnei]
emb|CSM19436.1| Uncharacterised protein [Shigella sonnei]
emb|CSS29835.1| Uncharacterised protein [Shigella sonnei]
emb|CSH21223.1| Uncharacterised protein [Shigella sonnei]
emb|CSM88960.1| Uncharacterised protein [Shigella sonnei]
emb|CSX91126.1| Uncharacterised protein [Shigella sonnei]
emb|CSH12344.1| Uncharacterised protein [Shigella sonnei]
emb|CSL67887.1| Uncharacterised protein [Shigella sonnei]
emb|CSR67099.1| Uncharacterised protein [Shigella sonnei]
emb|CSL96106.1| Uncharacterised protein [Shigella sonnei]
emb|CTA45791.1| Uncharacterised protein [Shigella sonnei]
emb|CSM15485.1| Uncharacterised protein [Shigella sonnei]
emb|CSM08387.1| Uncharacterised protein [Shigella sonnei]
emb|CSL86862.1| Uncharacterised protein [Shigella sonnei]
emb|CTB01310.1| Uncharacterised protein [Shigella sonnei]
emb|CSH38367.1| Uncharacterised protein [Shigella sonnei]
emb|CSL79663.1| Uncharacterised protein [Shigella sonnei]
emb|CTA91076.1| Uncharacterised protein [Shigella sonnei]
emb|CSM15158.1| Uncharacterised protein [Shigella sonnei]
emb|CSH35122.1| Uncharacterised protein [Shigella sonnei]
emb|CSS49529.1| Uncharacterised protein [Shigella sonnei]
emb|CSM35388.1| Uncharacterised protein [Shigella sonnei]
emb|CTA15054.1| Uncharacterised protein [Shigella sonnei]
emb|CSM00685.1| Uncharacterised protein [Shigella sonnei]
emb|CTA60501.1| Uncharacterised protein [Shigella sonnei]
emb|CTB12862.1| Uncharacterised protein [Shigella sonnei]
emb|CTA20561.1| Uncharacterised protein [Shigella sonnei]
emb|CSL95966.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ42925.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ56881.1| Uncharacterised protein [Shigella sonnei]
emb|CSH36645.1| Uncharacterised protein [Shigella sonnei]
emb|CSL87204.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ26386.1| Uncharacterised protein [Shigella sonnei]
emb|CTB08968.1| Uncharacterised protein [Shigella sonnei]
emb|CSM03713.1| Uncharacterised protein [Shigella sonnei]
emb|CTB24799.1| Uncharacterised protein [Shigella sonnei]
emb|CTA56210.1| Uncharacterised protein [Shigella sonnei]
emb|CTA72828.1| Uncharacterised protein [Shigella sonnei]
emb|CSH18775.1| Uncharacterised protein [Shigella sonnei]
emb|CTA47603.1| Uncharacterised protein [Shigella sonnei]
emb|CTB07268.1| Uncharacterised protein [Shigella sonnei]
emb|CTA53755.1| Uncharacterised protein [Shigella sonnei]
emb|CTC22203.1| Uncharacterised protein [Shigella sonnei]
emb|CSH19044.1| Uncharacterised protein [Shigella sonnei]
emb|CSI07823.1| Uncharacterised protein [Shigella sonnei]
emb|CTA28462.1| Uncharacterised protein [Shigella sonnei]
emb|CTA62051.1| Uncharacterised protein [Shigella sonnei]
emb|CTA88987.1| Uncharacterised protein [Shigella sonnei]
emb|CTA38129.1| Uncharacterised protein [Shigella sonnei]
emb|CTB27731.1| Uncharacterised protein [Shigella sonnei]
emb|CTA51792.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ85481.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ56208.1| Uncharacterised protein [Shigella sonnei]
emb|CSK15126.1| Uncharacterised protein [Shigella sonnei]
emb|CTB80646.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ99981.1| Uncharacterised protein [Shigella sonnei]
emb|CSK09117.1| Uncharacterised protein [Shigella sonnei]
emb|CSJ83410.1| Uncharacterised protein [Shigella sonnei]
emb|CSX89532.1| Uncharacterised protein [Shigella sonnei]
gb|KNF15722.1| hypothetical protein WQ94_11350 [Escherichia coli]
gb|KNF32267.1| hypothetical protein WQ82_04160 [Escherichia coli]
gb|KNF35482.1| hypothetical protein WR10_01220 [Escherichia coli]
gb|KNF39121.1| hypothetical protein WR26_11405 [Escherichia coli]
gb|KNF40434.1| hypothetical protein WR22_18905 [Escherichia coli]
gb|KNF57286.1| hypothetical protein WQ76_01485 [Escherichia coli]
gb|KNF61928.1| hypothetical protein WQ98_01605 [Escherichia coli]
gb|KNF64501.1| hypothetical protein WQ67_15430 [Escherichia coli]
gb|KNF71666.1| hypothetical protein WR15_03295 [Escherichia coli]
gb|KNF79993.1| hypothetical protein WQ89_12350 [Escherichia coli]
gb|KNF84419.1| hypothetical protein WQ78_17760 [Escherichia coli]
gb|KNF91075.1| hypothetical protein WQ75_18565 [Escherichia coli]
gb|KNF93778.1| hypothetical protein WR14_15195 [Escherichia coli]
gb|KNG02347.1| hypothetical protein WQ80_06635 [Escherichia coli]
gb|KNG05466.1| hypothetical protein WQ93_24590 [Escherichia coli]
gb|KNG07870.1| hypothetical protein WR06_18270 [Escherichia coli]
gb|KNG23145.1| hypothetical protein WQ97_15915 [Escherichia coli]
gb|KNG23572.1| hypothetical protein WQ87_12655 [Escherichia coli]
gb|KNG27392.1| hypothetical protein WR21_24925 [Escherichia coli]
gb|KNG38810.1| hypothetical protein WR11_11555 [Escherichia coli]
gb|KNY57293.1| hypothetical protein AGA24_05740 [Escherichia coli]
gb|KNY65237.1| hypothetical protein AGA21_03100 [Escherichia coli]
gb|KNY67241.1| hypothetical protein AGA22_00245 [Escherichia coli]
gb|KNY69559.1| hypothetical protein AGA25_17135 [Escherichia coli]
gb|KNY81164.1| hypothetical protein AGA27_06785 [Escherichia coli]
gb|KNY83818.1| hypothetical protein AGA28_20795 [Escherichia coli]
gb|KNY89032.1| hypothetical protein AGA29_12055 [Escherichia coli]
gb|KNY96568.1| hypothetical protein AGA37_14960 [Escherichia coli]
gb|KNY97132.1| hypothetical protein AGA31_20615 [Escherichia coli]
gb|KNZ07895.1| hypothetical protein AGA36_09960 [Escherichia coli]
gb|KNZ09490.1| hypothetical protein AGA20_18965 [Escherichia coli]
gb|KNZ17419.1| hypothetical protein AGA30_03090 [Escherichia coli]
gb|KNZ18567.1| hypothetical protein AGA23_24045 [Escherichia coli]
gb|KNZ25988.1| hypothetical protein AGA32_12575 [Escherichia coli]
gb|KOA00887.1| hypothetical protein AKG99_01930 [Escherichia coli]
gb|KOA24642.1| hypothetical protein AC065_16790 [Escherichia coli]
gb|KOA34746.1| hypothetical protein AC067_11460 [Escherichia coli]
emb|CTX19361.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX17518.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW99094.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW90516.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX00058.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR28422.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR31277.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU36206.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU48769.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR44864.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV29535.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR44336.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR30695.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV15529.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU97991.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS44159.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU93374.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT90419.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT54272.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV47023.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR76379.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT99277.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU66148.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR70940.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW30003.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU91435.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV53191.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU48344.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS59107.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR80414.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU06234.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR78304.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW39010.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV04100.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS14864.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR59853.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT43074.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR35394.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV05327.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV38573.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW48966.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW21203.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS41223.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU59946.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW64024.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR99553.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV56526.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT32795.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS21809.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR92094.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV21481.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV12487.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS29390.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT97436.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV07404.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT08438.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS47513.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV61353.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT38558.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS39449.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU48716.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR55395.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS05488.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS78876.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU95450.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW93076.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR74632.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT42688.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW49522.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU16957.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV34694.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV70436.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT27678.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV95359.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS00583.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS85288.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT55979.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV76978.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV34324.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV32393.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV19687.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV39868.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS69368.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR98328.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS05574.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS97631.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW51872.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS29186.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV36439.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR50536.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW25491.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW39753.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS76414.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW00611.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR71846.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS17560.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR57109.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS14200.1| periplasmic protein DcrB [Escherichia coli]
emb|CTW70285.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV29692.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS31306.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT88518.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV06874.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV26796.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT71992.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV19309.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS14132.1| periplasmic protein DcrB [Escherichia coli]
emb|CTU84064.1| periplasmic protein DcrB [Escherichia coli]
emb|CTR92907.1| periplasmic protein DcrB [Escherichia coli]
emb|CTV14926.1| periplasmic protein DcrB [Escherichia coli]
emb|CTS77907.1| periplasmic protein DcrB [Escherichia coli]
emb|CTT63683.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY45501.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY50231.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY45607.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY20814.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY18152.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY27029.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY21129.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ75117.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY70398.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ41528.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY24874.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ25749.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ00406.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY83069.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY77915.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX95796.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY09410.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX96316.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY02451.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY32959.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX70081.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY86812.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ81655.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY87969.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY72928.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ63280.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY08918.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY79153.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ01831.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ66120.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY70448.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ67392.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ93381.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY23395.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX77251.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY42288.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY43151.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ82089.1| periplasmic protein DcrB [Escherichia coli]
emb|CTZ72019.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA57562.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA26510.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA43291.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA47383.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA31096.1| periplasmic protein DcrB [Escherichia coli]
emb|CUA35913.1| periplasmic protein DcrB [Escherichia coli]
gb|KOR03482.1| hypothetical protein ABW50_12500 [Escherichia coli]
gb|ALB33490.1| hypothetical protein SR35_17710 [Escherichia coli]
emb|CUH57715.1| putative lipoprotein [Escherichia coli KRX]
gb|KOZ07443.1| hypothetical protein AC814_14750 [Escherichia coli]
gb|KOZ15369.1| hypothetical protein ACP59_00685 [Escherichia coli]
gb|KOZ18262.1| hypothetical protein ACP60_01130 [Escherichia coli]
gb|KOZ22005.1| hypothetical protein ACP62_12430 [Escherichia coli]
gb|KOZ31650.1| hypothetical protein ACP63_05055 [Escherichia coli]
gb|KOZ34347.1| hypothetical protein ACP61_00830 [Escherichia coli]
gb|KOZ40394.1| hypothetical protein ACP64_03555 [Escherichia coli]
gb|KOZ45549.1| hypothetical protein ACP65_13245 [Escherichia coli]
gb|KOZ49119.1| hypothetical protein ACP66_02685 [Escherichia coli]
gb|KOZ53377.1| hypothetical protein ACP68_14100 [Escherichia coli]
gb|KOZ58368.1| hypothetical protein ACP69_16090 [Escherichia coli]
gb|KOZ61145.1| hypothetical protein ACP74_18250 [Escherichia coli]
gb|KOZ71018.1| hypothetical protein ACP70_08960 [Escherichia coli]
gb|KOZ75989.1| hypothetical protein ACP71_05095 [Escherichia coli]
gb|KOZ79681.1| hypothetical protein ACP72_15920 [Escherichia coli]
gb|KOZ86031.1| hypothetical protein ACP73_11120 [Escherichia coli]
gb|KOZ93302.1| hypothetical protein ACP75_00450 [Escherichia coli]
gb|KOZ97412.1| hypothetical protein ACP67_02835 [Escherichia coli]
emb|CUJ88087.1| Uncharacterised protein [Achromobacter sp. ATCC35328]
gb|KPH34626.1| hypothetical protein ACZ78_07265 [Escherichia coli]
gb|KPH36453.1| hypothetical protein ACZ77_15755 [Escherichia coli]
gb|KPH41162.1| hypothetical protein ACZ84_19800 [Escherichia coli]
gb|KPH46430.1| hypothetical protein ABT67_03600 [Escherichia coli]
emb|CUQ98730.1| DcrB protein precursor [Escherichia coli]
emb|CTX49381.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX40648.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX79764.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX46057.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX72575.1| periplasmic protein DcrB [Escherichia coli]
emb|CTY23440.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX43844.1| periplasmic protein DcrB [Escherichia coli]
emb|CTD41330.1| Uncharacterised protein [Shigella sonnei]
emb|CTX36215.1| periplasmic protein DcrB [Escherichia coli]
emb|CTX84933.1| periplasmic protein DcrB [Escherichia coli]
gb|ALH92705.1| hypothetical protein AO055_21670 [Escherichia coli O157:H7]
gb|ALI38848.1| hypothetical protein QQ24_04975 [Escherichia coli str. K-12 substr.
MG1655]
gb|ALI43248.1| hypothetical protein QR62_04980 [Escherichia coli]
gb|ALI47645.1| hypothetical protein QR63_04980 [Escherichia coli]
gb|KPO05016.1| hypothetical protein ACU62_20680 [Escherichia coli]
gb|KPO09718.1| hypothetical protein ACU57_16995 [Escherichia coli]
gb|KPO15346.1| hypothetical protein VM39_05905 [Escherichia coli]
gb|KPO24081.1| hypothetical protein ACU58_06495 [Escherichia coli]
gb|KPO26881.1| hypothetical protein ACU65_11445 [Escherichia coli]
gb|KPO27801.1| hypothetical protein ACU75_26670 [Escherichia coli]
gb|KPO35096.1| hypothetical protein ACU70_09655 [Escherichia coli]
gb|KPO41098.1| hypothetical protein ACU81_05855 [Escherichia coli]
gb|KPO51798.1| hypothetical protein ACU90_15530 [Escherichia coli]
gb|KPO52274.1| hypothetical protein ACU82_05910 [Escherichia coli]
gb|KPO57202.1| hypothetical protein ACU60_25155 [Escherichia coli]
gb|KPO59282.1| hypothetical protein ACU79_08555 [Escherichia coli]
gb|KPO69013.1| hypothetical protein ACU80_20670 [Escherichia coli]
gb|KPO70898.1| hypothetical protein ACU64_03095 [Escherichia coli]
gb|KPO84695.1| hypothetical protein ACU87_22995 [Escherichia coli]
gb|KPO85850.1| hypothetical protein ACU91_01060 [Escherichia coli]
gb|KPO86978.1| hypothetical protein ACU72_04515 [Escherichia coli]
gb|KPO95997.1| hypothetical protein ACU88_15295 [Escherichia coli]
gb|KPP06890.1| hypothetical protein ACU83_00855 [Escherichia coli]
gb|KPP13630.1| hypothetical protein ACU66_17660 [Escherichia coli]
gb|KPP28518.1| hypothetical protein ACU68_02415 [Escherichia coli]
gb|KPP33150.1| hypothetical protein ACU86_03265 [Escherichia coli]
gb|KPP35572.1| hypothetical protein ACU99_04265 [Escherichia coli]
gb|KPP36680.1| hypothetical protein ACU94_17645 [Escherichia coli]
gb|KPP42291.1| hypothetical protein ACU76_14870 [Escherichia coli]
gb|KPP50883.1| hypothetical protein ACU77_07405 [Escherichia coli]
gb|KPP55874.1| hypothetical protein ACU96_01020 [Escherichia coli]
gb|KPQ49352.1| Protein DcrB [Escherichia coli TW10598]
gb|KQB25490.1| hypothetical protein APV31_19290 [Escherichia coli]
gb|KQC25874.1| hypothetical protein AML92_12895 [Escherichia coli]
gb|KQI75803.1| hypothetical protein AM258_14215 [Escherichia coli]
gb|KQI80942.1| hypothetical protein AM259_10555 [Escherichia coli]
gb|KQI86859.1| hypothetical protein AM260_06655 [Escherichia coli]
gb|KQI91515.1| hypothetical protein AM261_07655 [Escherichia coli]
gb|KQI97298.1| hypothetical protein AM263_09065 [Escherichia coli]
gb|KQJ04884.1| hypothetical protein AM264_13040 [Escherichia coli]
gb|KQJ11176.1| hypothetical protein AM265_01140 [Escherichia coli]
gb|KQJ17165.1| hypothetical protein AM266_07830 [Escherichia coli]
gb|KQJ17696.1| hypothetical protein AM267_17220 [Escherichia coli]
gb|KQJ25305.1| hypothetical protein AM268_07255 [Escherichia coli]
gb|KQJ30553.1| hypothetical protein AM269_06250 [Escherichia coli]
gb|KQJ34115.1| hypothetical protein AM271_09795 [Escherichia coli]
gb|KQJ41380.1| hypothetical protein AM272_10785 [Escherichia coli]
gb|KQJ44316.1| hypothetical protein AM270_07680 [Escherichia coli]
gb|KQJ48165.1| hypothetical protein AM273_15120 [Escherichia coli]
gb|ALL96046.1| hypothetical protein AKK22_26735 [Escherichia coli]
gb|KQL78189.1| periplasmic protein, lipoprotein [Escherichia coli]
gb|KRQ06811.1| hypothetical protein ASO15_22350 [Escherichia coli O157:H7]
gb|KRR53681.1| hypothetical protein EC2732_10080 [Escherichia coli VL2732]
gb|KRR57114.1| hypothetical protein ECK71_16346 [Escherichia coli K71]
gb|KRR58612.1| hypothetical protein EC2874_15669 [Escherichia coli VL2874]
gb|KRV68554.1| hypothetical protein AO733_20605 [Escherichia coli]
gb|KRV96892.1| hypothetical protein AO737_21260 [Escherichia coli]
gb|KRV97008.1| hypothetical protein AO743_19685 [Escherichia coli]
gb|KST29449.1| hypothetical protein APZ13_02820 [Escherichia coli]
gb|KST30219.1| hypothetical protein APZ14_13785 [Escherichia coli]
gb|ALQ57533.1| hypothetical protein AB850_03030 [Escherichia coli]
gb|ALQ74924.1| hypothetical protein ATL78_21660 [Escherichia coli]
gb|KSX63804.1| hypothetical protein APT88_21735 [Escherichia coli]
gb|KSX92268.1| hypothetical protein APT94_00110 [Escherichia coli]
gb|KSY15762.1| hypothetical protein APT99_20630 [Escherichia coli]
gb|KSY59767.1| hypothetical protein APU06_17105 [Escherichia coli]
gb|KSY60542.1| hypothetical protein APU07_19550 [Escherichia coli]
gb|KSY68211.1| hypothetical protein APU10_05060 [Escherichia coli]
gb|KUG66888.1| hypothetical protein ARC81_19735 [Escherichia coli]
gb|KUG67384.1| hypothetical protein ARC96_21180 [Escherichia coli]
gb|KUG69368.1| hypothetical protein ARC97_19330 [Escherichia coli]
gb|KUG79847.1| hypothetical protein ARC95_22200 [Escherichia coli]
gb|KUG80699.1| hypothetical protein ARC90_20430 [Escherichia coli]
gb|KUG88682.1| hypothetical protein ARC88_06610 [Escherichia coli]
gb|KUG93115.1| hypothetical protein ARC92_22330 [Escherichia coli]
gb|KUG95294.1| hypothetical protein ARC93_18775 [Escherichia coli]
gb|KUH03682.1| hypothetical protein ARC82_11465 [Escherichia coli]
gb|KUH05855.1| hypothetical protein ARC83_20680 [Escherichia coli]
gb|KUH07896.1| hypothetical protein ARC99_23075 [Escherichia coli]
gb|KUH17984.1| hypothetical protein ARC89_19700 [Escherichia coli]
gb|KUH19186.1| hypothetical protein ARC94_07175 [Escherichia coli]
gb|KUH23462.1| hypothetical protein ARC98_21205 [Escherichia coli]
gb|KUH25447.1| hypothetical protein ARC91_20305 [Escherichia coli]
gb|ALV70948.1| hypothetical protein FH07_23400 [Escherichia coli]
gb|KUR33002.1| hypothetical protein AWF56_08380 [Escherichia coli]
gb|ALZ57810.1| DcrB protein precursor [Shigella sonnei]
gb|KUS09431.1| hypothetical protein AWE61_07575 [Escherichia coli]
gb|KUS11690.1| hypothetical protein AWE62_06055 [Escherichia coli]
gb|KUS19981.1| hypothetical protein AWE67_10040 [Escherichia coli]
gb|KUS40738.1| hypothetical protein AWE69_16905 [Escherichia coli]
gb|KUS73520.1| hypothetical protein AWE72_22380 [Escherichia coli]
gb|KUS76748.1| hypothetical protein AWE78_18665 [Escherichia coli]
gb|KUS79984.1| hypothetical protein AWE76_12885 [Escherichia coli]
gb|KUS84517.1| hypothetical protein AWE77_11740 [Escherichia coli]
gb|KUS90011.1| hypothetical protein AWE74_21975 [Escherichia coli]
gb|KUT01294.1| hypothetical protein AWE81_16500 [Escherichia coli]
gb|KUT10086.1| hypothetical protein AWE82_01465 [Escherichia coli]
gb|KUT19926.1| hypothetical protein AWE58_20040 [Escherichia coli]
gb|KUT21153.1| hypothetical protein AWE84_18180 [Escherichia coli]
gb|KUT48504.1| hypothetical protein AWE99_01675 [Escherichia coli]
gb|KUT69576.1| hypothetical protein AWF02_01860 [Escherichia coli]
gb|KUT74204.1| hypothetical protein AWF03_24620 [Escherichia coli]
gb|KUT80309.1| hypothetical protein AWF07_16215 [Escherichia coli]
gb|KUT95857.1| hypothetical protein AWF12_18275 [Escherichia coli]
gb|KUU02695.1| hypothetical protein AWF13_03420 [Escherichia coli]
gb|KUU13758.1| hypothetical protein AWF16_02915 [Escherichia coli]
gb|KUU24975.1| hypothetical protein AWF18_12505 [Escherichia coli]
gb|KUU33725.1| hypothetical protein AWF20_18740 [Escherichia coli]
gb|KUU43466.1| hypothetical protein AWF22_06540 [Escherichia coli]
gb|KUU57588.1| hypothetical protein AWF26_20420 [Escherichia coli]
gb|KUU68254.1| hypothetical protein AWF30_18690 [Escherichia coli]
gb|KUU73266.1| hypothetical protein AWF27_12080 [Escherichia coli]
gb|KUV40776.1| hypothetical protein AWE89_15980 [Escherichia coli]
gb|KUV47869.1| hypothetical protein AWE92_15875 [Escherichia coli]
gb|KUV78269.1| hypothetical protein AWF48_23785 [Escherichia coli]
gb|KUV86875.1| hypothetical protein AWF51_14040 [Escherichia coli]
gb|KUW09148.1| hypothetical protein AWF53_24275 [Escherichia coli]
gb|KUW14282.1| hypothetical protein AWF55_05185 [Escherichia coli]
gb|KUW35274.1| hypothetical protein AWF60_23620 [Escherichia coli]
gb|KUW45904.1| hypothetical protein AWF65_16320 [Escherichia coli]
gb|KUW78766.1| hypothetical protein AWF69_06330 [Escherichia coli]
gb|KUX08017.1| hypothetical protein AWF78_04625 [Escherichia coli]
gb|KUX32182.1| hypothetical protein AWF80_22315 [Escherichia coli]
gb|KUX77956.1| hypothetical protein AWF91_24180 [Escherichia coli]
gb|KUX78385.1| hypothetical protein AWF93_06965 [Escherichia coli]
gb|KWV18564.1| hypothetical protein AWH70_19035 [Escherichia coli]
gb|AMB52480.1| hypothetical protein AWB62_00765 [Escherichia coli]
gb|AMC96353.1| hypothetical protein AW869_08995 [Escherichia coli str. K-12
substr. MG1655]
gb|KXC10902.1| hypothetical protein AWE30_06970 [Escherichia coli]
gb|AMG17527.1| protein DcrB [Shigella sonnei]
gb|AMG81271.1| hypothetical protein JEONG1266_25910 [Escherichia coli O157:H7]
gb|AMH24098.1| hypothetical protein C2566_20760 [Escherichia coli B]
gb|AMH28415.1| hypothetical protein C3029_21380 [Escherichia coli B]
gb|AMH32069.1| hypothetical protein DHB4_17585 [Escherichia coli K-12]
gb|AMH36791.1| hypothetical protein C3026_18805 [Escherichia coli K-12]
gb|KXG56997.1| hypothetical protein LT29_03781 [Escherichia coli]
gb|KXG72594.1| hypothetical protein LT30_01123 [Escherichia coli]
gb|AMF89932.1| protein DcrB [Escherichia coli]
gb|KXH92055.1| hypothetical protein AXE66_22400 [Escherichia coli]
gb|KXH95086.1| hypothetical protein AXE67_16675 [Escherichia coli]
emb|CUW23336.1| hypothetical protein JF733_3340 [Escherichia coli]
gb|AML00044.1| hypothetical protein AWN69_08440 [Escherichia coli str. K-12
substr. MG1655]
gb|KXK78367.1| hypothetical protein AUS13_02580 [Escherichia coli]
gb|KXK87850.1| hypothetical protein AUS52_06960 [Escherichia coli]
gb|KXK88980.1| hypothetical protein AUS51_00055 [Escherichia coli]
gb|KXK95826.1| hypothetical protein AXH17_17995 [Escherichia coli]
gb|KXL15265.1| hypothetical protein AXH19_00700 [Escherichia coli]
gb|KXL24418.1| hypothetical protein AXH14_04985 [Escherichia coli]
gb|KXL39972.1| hypothetical protein AXH10_14320 [Escherichia coli]
gb|KXL56928.1| hypothetical protein AUS22_21070 [Escherichia coli]
gb|KXL59894.1| hypothetical protein AUS12_16785 [Escherichia coli]
gb|KXL64705.1| hypothetical protein AUS26_07125 [Escherichia coli]
gb|KXL70950.1| hypothetical protein AUS14_03955 [Escherichia coli]
gb|KXL82098.1| hypothetical protein AUS15_10020 [Escherichia coli]
gb|KXL82577.1| hypothetical protein AUS48_06405 [Escherichia coli]
gb|KXL92293.1| hypothetical protein AUS16_10250 [Escherichia coli]
gb|KXL98191.1| hypothetical protein AUS17_00050 [Escherichia coli]
gb|KXM03735.1| hypothetical protein AUS49_04775 [Escherichia coli]
gb|KXM06709.1| hypothetical protein AUS50_16120 [Escherichia coli]
gb|KXM12249.1| hypothetical protein AUS19_10270 [Escherichia coli]
gb|KXM16170.1| hypothetical protein AUS24_07910 [Escherichia coli]
gb|KXM19682.1| hypothetical protein AUS20_21460 [Escherichia coli]
gb|KXM26018.1| hypothetical protein AUS25_14390 [Escherichia coli]
gb|KXM33947.1| hypothetical protein AUS23_17175 [Escherichia coli]
gb|KXM34456.1| hypothetical protein AUS21_03330 [Escherichia coli]
gb|KXM44081.1| hypothetical protein AUS28_12325 [Escherichia coli]
gb|KXM46425.1| hypothetical protein AUS29_07045 [Escherichia coli]
gb|KXM57669.1| hypothetical protein AUS33_17655 [Escherichia coli]
gb|KXM64420.1| hypothetical protein AUS30_01820 [Escherichia coli]
gb|KXM69698.1| hypothetical protein AUS32_22380 [Escherichia coli]
gb|KXM71578.1| hypothetical protein AUS34_13370 [Escherichia coli]
gb|KXM73190.1| hypothetical protein AUS31_14630 [Escherichia coli]
gb|KXM80199.1| hypothetical protein AUS36_09365 [Escherichia coli]
gb|KXM89077.1| hypothetical protein AUS39_15105 [Escherichia coli]
gb|KXM95211.1| hypothetical protein AUS37_10735 [Escherichia coli]
gb|KXM95976.1| hypothetical protein AUS41_05550 [Escherichia coli]
gb|KXN02901.1| hypothetical protein AUS46_17540 [Escherichia coli]
gb|KXN03242.1| hypothetical protein AUS38_14135 [Escherichia coli]
gb|KXN09895.1| hypothetical protein AUS47_13545 [Escherichia coli]
gb|KXN20074.1| hypothetical protein AUS18_02685 [Escherichia coli]
gb|KXN20716.1| hypothetical protein AUS45_13320 [Escherichia coli]
gb|KXN25578.1| hypothetical protein AUS40_13045 [Escherichia coli]
gb|KXN33147.1| hypothetical protein AUS35_23635 [Escherichia coli]
gb|KXN40423.1| hypothetical protein AUS42_09710 [Escherichia coli]
gb|KXN43406.1| hypothetical protein AUS53_09225 [Escherichia coli]
gb|KXN50829.1| hypothetical protein AUS44_07350 [Escherichia coli]
gb|KXN63167.1| hypothetical protein AUS43_22565 [Escherichia coli]
gb|KXN64525.1| hypothetical protein AUS27_02485 [Escherichia coli]
gb|KXP17986.1| hypothetical protein AUQ36_20140 [Escherichia coli]
gb|KXP22755.1| hypothetical protein AUP76_05060 [Escherichia coli]
gb|KXP27673.1| hypothetical protein AUP75_07215 [Escherichia coli]
gb|KXP33852.1| hypothetical protein AUQ35_14450 [Escherichia coli]
gb|KXP33993.1| hypothetical protein AUP79_12370 [Escherichia coli]
gb|KXP42404.1| hypothetical protein AUP97_02165 [Escherichia coli]
gb|KXP43656.1| hypothetical protein AUQ19_23640 [Escherichia coli]
gb|KXP45749.1| hypothetical protein AUQ30_12790 [Escherichia coli]
gb|KXP50972.1| hypothetical protein AUQ34_14670 [Escherichia coli]
gb|KXP55276.1| hypothetical protein AUP86_20325 [Escherichia coli]
gb|KXP66837.1| hypothetical protein AUP84_01745 [Escherichia coli]
gb|KXP67293.1| hypothetical protein AUP82_16360 [Escherichia coli]
gb|KXP73726.1| hypothetical protein AUP83_18690 [Escherichia coli]
gb|KXP76121.1| hypothetical protein AUQ08_03585 [Escherichia coli]
gb|KXP87259.1| hypothetical protein AUP78_02615 [Escherichia coli]
gb|KXP87792.1| hypothetical protein AUP80_17235 [Escherichia coli]
gb|KXP88502.1| hypothetical protein AUP77_06655 [Escherichia coli]
gb|KXP92986.1| hypothetical protein AUP90_20990 [Escherichia coli]
gb|KXP95256.1| hypothetical protein AUP85_14450 [Escherichia coli]
gb|KXP97464.1| hypothetical protein AUP87_17225 [Escherichia coli]
gb|KXQ09362.1| hypothetical protein AUP98_10680 [Escherichia coli]
gb|KXQ13999.1| hypothetical protein AUP96_04045 [Escherichia coli]
gb|KXQ18362.1| hypothetical protein AUP92_17100 [Escherichia coli]
gb|KXQ19741.1| hypothetical protein AUP95_09955 [Escherichia coli]
gb|KXQ22450.1| hypothetical protein AUP94_19990 [Escherichia coli]
gb|KXQ27737.1| hypothetical protein AUQ03_19910 [Escherichia coli]
gb|KXQ31961.1| hypothetical protein AUP88_17175 [Escherichia coli]
gb|KXQ42285.1| hypothetical protein AUQ01_02835 [Escherichia coli]
gb|KXQ43931.1| hypothetical protein AUP89_17275 [Escherichia coli]
gb|KXQ51393.1| hypothetical protein AUP93_03965 [Escherichia coli]
gb|KXQ53953.1| hypothetical protein AUQ04_13575 [Escherichia coli]
gb|KXQ56676.1| hypothetical protein AUQ09_16235 [Escherichia coli]
gb|KXQ64908.1| hypothetical protein AUQ07_06595 [Escherichia coli]
gb|KXQ67947.1| hypothetical protein AUQ00_08410 [Escherichia coli]
gb|KXQ72022.1| hypothetical protein AUQ10_10030 [Escherichia coli]
gb|KXQ80180.1| hypothetical protein AUQ18_12880 [Escherichia coli]
gb|KXQ82092.1| hypothetical protein AUQ02_17680 [Escherichia coli]
gb|KXQ83441.1| hypothetical protein AUP99_00680 [Escherichia coli]
gb|KXQ93703.1| hypothetical protein AUQ06_01255 [Escherichia coli]
gb|KXQ99770.1| hypothetical protein AUQ17_00740 [Escherichia coli]
gb|KXR00377.1| hypothetical protein AUQ05_09645 [Escherichia coli]
gb|KXR02444.1| hypothetical protein AUQ14_20695 [Escherichia coli]
gb|KXR14205.1| hypothetical protein AUQ12_04895 [Escherichia coli]
gb|KXR15517.1| hypothetical protein AUQ15_00370 [Escherichia coli]
gb|KXR19590.1| hypothetical protein AUQ16_11060 [Escherichia coli]
gb|KXR20507.1| hypothetical protein AUQ21_17365 [Escherichia coli]
gb|KXR25610.1| hypothetical protein AUQ20_21575 [Escherichia coli]
gb|KXR27720.1| hypothetical protein AUQ24_22735 [Escherichia coli]
gb|KXR31839.1| hypothetical protein AUQ22_17005 [Escherichia coli]
gb|KXR40531.1| hypothetical protein AUQ27_19760 [Escherichia coli]
gb|KXR49247.1| hypothetical protein AUQ31_02350 [Escherichia coli]
gb|KXR50317.1| hypothetical protein AUQ26_16585 [Escherichia coli]
gb|KXR59062.1| hypothetical protein AUQ32_05130 [Escherichia coli]
gb|KXR61480.1| hypothetical protein AUQ28_14445 [Escherichia coli]
gb|KXR62415.1| hypothetical protein AUQ11_13170 [Escherichia coli]
gb|KXR68858.1| hypothetical protein AUQ23_21930 [Escherichia coli]
gb|KXR71919.1| hypothetical protein AUQ33_09070 [Escherichia coli]
gb|KXR78485.1| hypothetical protein AUQ25_20530 [Escherichia coli]
gb|KXR86034.1| hypothetical protein AUQ29_05105 [Escherichia coli]
gb|KXR91683.1| hypothetical protein AUQ13_08895 [Escherichia coli]
gb|KXS00427.1| hypothetical protein AUP91_00055 [Escherichia coli]
gb|KXS01829.1| hypothetical protein AUP81_05045 [Escherichia coli]
gb|AMM77548.1| hypothetical protein AOT98_06950 [Shigella flexneri 1a]
emb|CUU95620.1| periplasmic protein [Escherichia coli]
gb|AMN59760.1| hypothetical protein AD867_19725 [Shigella flexneri 2a]
gb|AMN64594.1| hypothetical protein AD871_19925 [Shigella flexneri 4c]
gb|KXU67456.1| hypothetical protein AWN71_14825 [Escherichia coli]
gb|KXU69242.1| hypothetical protein AWN70_09300 [Escherichia coli]
gb|KXU77971.1| hypothetical protein AWN72_23240 [Escherichia coli]
gb|AMR24984.1| hypothetical protein A0259_21120 [Shigella sp. PAMC 28760]
gb|KYL38354.1| hypothetical protein ECEG1_18395 [Escherichia coli]
gb|KYN51148.1| hypothetical protein AZ625_10205 [Escherichia coli]
gb|KYN61667.1| hypothetical protein AZ620_10645 [Escherichia coli]
gb|KYO63561.1| hypothetical protein LT27_03911 [Escherichia coli]
gb|KYR04211.1| hypothetical protein AMK98_28335 [Escherichia coli]
gb|KYR08303.1| hypothetical protein AMK99_21635 [Escherichia coli]
gb|KYR09635.1| hypothetical protein AML00_17825 [Escherichia coli]
gb|KYR24364.1| hypothetical protein AML01_09890 [Escherichia coli]
gb|KYR25602.1| hypothetical protein AML03_22725 [Escherichia coli]
gb|KYR48907.1| hypothetical protein AML06_11225 [Escherichia coli]
gb|KYR54654.1| hypothetical protein AML04_00705 [Escherichia coli]
gb|KYR62736.1| hypothetical protein AML07_00905 [Escherichia coli]
gb|KYR66820.1| hypothetical protein AML10_21755 [Escherichia coli]
gb|KYR72692.1| hypothetical protein AML09_03770 [Escherichia coli]
gb|KYR78215.1| hypothetical protein AML12_16965 [Escherichia coli]
gb|KYR93605.1| hypothetical protein AML14_08560 [Escherichia coli]
gb|KYR97319.1| hypothetical protein AML15_06790 [Escherichia coli]
gb|KYS00785.1| hypothetical protein AML17_21925 [Escherichia coli]
gb|KYS03210.1| hypothetical protein AML16_04050 [Escherichia coli]
gb|KYS16681.1| hypothetical protein AML20_17105 [Escherichia coli]
gb|KYS20974.1| hypothetical protein AML19_02310 [Escherichia coli]
gb|KYS26644.1| hypothetical protein AML21_06990 [Escherichia coli]
gb|KYS32982.1| hypothetical protein AML24_21610 [Escherichia coli]
gb|KYS42370.1| hypothetical protein AML23_10325 [Escherichia coli]
gb|KYS47490.1| hypothetical protein AML26_18060 [Escherichia coli]
gb|KYS61055.1| hypothetical protein AML28_08815 [Escherichia coli]
gb|KYS65179.1| hypothetical protein AML30_20190 [Escherichia coli]
gb|KYS78602.1| hypothetical protein AML32_04755 [Escherichia coli]
gb|KYS79516.1| hypothetical protein AML33_12270 [Escherichia coli]
gb|KYS88601.1| hypothetical protein AML35_23150 [Escherichia coli]
gb|KYS90258.1| hypothetical protein AML34_03150 [Escherichia coli]
gb|KYS92525.1| hypothetical protein AML40_19575 [Escherichia coli]
gb|KYS99559.1| hypothetical protein AML41_15470 [Escherichia coli]
gb|KYT04598.1| hypothetical protein AML42_23760 [Escherichia coli]
gb|KYT09625.1| hypothetical protein AML43_17605 [Escherichia coli]
gb|KYT14750.1| hypothetical protein AML44_13620 [Escherichia coli]
gb|KYT30833.1| hypothetical protein AML48_04525 [Escherichia coli]
gb|KYT31039.1| hypothetical protein AML47_11020 [Escherichia coli]
gb|KYT41735.1| hypothetical protein AML29_09430 [Escherichia coli]
gb|KYT42728.1| hypothetical protein AML38_19200 [Escherichia coli]
gb|KYT47550.1| hypothetical protein AML51_00245 [Escherichia coli]
gb|KYT48404.1| hypothetical protein AML45_22350 [Escherichia coli]
gb|KYT50362.1| hypothetical protein AML49_23710 [Escherichia coli]
gb|KYT65327.1| hypothetical protein AML52_20965 [Escherichia coli]
gb|KYT66110.1| hypothetical protein AML50_08760 [Escherichia coli]
gb|KYT77694.1| hypothetical protein AML54_03400 [Escherichia coli]
gb|KYT89216.1| hypothetical protein AML78_07005 [Escherichia coli]
gb|KYT89381.1| hypothetical protein AML60_04715 [Escherichia coli]
gb|KYT90770.1| hypothetical protein AML64_03860 [Escherichia coli]
gb|KYT98238.1| hypothetical protein AML53_19240 [Escherichia coli]
gb|KYT99440.1| hypothetical protein AML66_01570 [Escherichia coli]
gb|KYU09603.1| hypothetical protein AML58_02710 [Escherichia coli]
gb|KYU14713.1| hypothetical protein AML57_12725 [Escherichia coli]
gb|KYU24861.1| hypothetical protein AML59_21095 [Escherichia coli]
gb|KYU29331.1| hypothetical protein AML61_02585 [Escherichia coli]
gb|KYU41729.1| hypothetical protein AML65_14960 [Escherichia coli]
gb|KYU42173.1| hypothetical protein AML62_00225 [Escherichia coli]
gb|KYU42413.1| hypothetical protein AML63_06660 [Escherichia coli]
gb|KYU44020.1| hypothetical protein AML67_06985 [Escherichia coli]
gb|KYU51303.1| hypothetical protein AML68_25120 [Escherichia coli]
gb|KYU53824.1| hypothetical protein AML71_10290 [Escherichia coli]
gb|KYU60073.1| hypothetical protein AML72_19915 [Escherichia coli]
gb|KYU66762.1| hypothetical protein AML74_18355 [Escherichia coli]
gb|KYU68963.1| hypothetical protein AML73_21000 [Escherichia coli]
gb|KYU78213.1| hypothetical protein AML75_10675 [Escherichia coli]
gb|KYU80869.1| hypothetical protein AML76_10780 [Escherichia coli]
gb|KYU90783.1| hypothetical protein AML79_02710 [Escherichia coli]
gb|KYU91880.1| hypothetical protein AML77_10000 [Escherichia coli]
gb|KYU94907.1| hypothetical protein AML80_21320 [Escherichia coli]
gb|KYU99933.1| hypothetical protein AML69_05000 [Escherichia coli]
gb|KYV08881.1| hypothetical protein AML81_10835 [Escherichia coli]
gb|KYV17618.1| hypothetical protein AML70_13535 [Escherichia coli]
gb|KYV21064.1| hypothetical protein AML36_11550 [Escherichia coli]
gb|KYV27904.1| hypothetical protein AML37_13490 [Escherichia coli]
gb|KYV31105.1| hypothetical protein AML39_10645 [Escherichia coli]
gb|KYV36231.1| hypothetical protein AMK77_04845 [Escherichia coli]
gb|KYV37548.1| hypothetical protein AMK76_06090 [Escherichia coli]
gb|KYV48875.1| hypothetical protein AMK78_18170 [Escherichia coli]
gb|KYV49425.1| hypothetical protein AMK79_13080 [Escherichia coli]
gb|KYV54037.1| hypothetical protein AMK80_15930 [Escherichia coli]
gb|KYV64528.1| hypothetical protein AMK81_10905 [Escherichia coli]
gb|KYV67287.1| hypothetical protein AMK83_20155 [Escherichia coli]
gb|KYV69749.1| hypothetical protein AMK84_03445 [Escherichia coli]
gb|KYV74669.1| hypothetical protein AMK82_04460 [Escherichia coli]
gb|KYV76910.1| hypothetical protein AMK85_02580 [Escherichia coli]
gb|KYV87645.1| hypothetical protein AMK87_14565 [Escherichia coli]
gb|KYV92162.1| hypothetical protein AMK86_05900 [Escherichia coli]
gb|KYV97420.1| hypothetical protein AMK88_18925 [Escherichia coli]
gb|KYW03261.1| hypothetical protein AMK90_00190 [Escherichia coli]
gb|KYW07166.1| hypothetical protein AMK89_01290 [Escherichia coli]
gb|KYW12476.1| hypothetical protein AMK91_09535 [Escherichia coli]
gb|KYW13163.1| hypothetical protein AMK92_05300 [Escherichia coli]
gb|KYW24948.1| hypothetical protein AMK94_18710 [Escherichia coli]
gb|KYW25092.1| hypothetical protein AMK93_03745 [Escherichia coli]
gb|KYW31977.1| hypothetical protein AMK95_10105 [Escherichia coli]
gb|KYW38715.1| hypothetical protein AMK97_24800 [Escherichia coli]
gb|KYW45649.1| hypothetical protein AMK96_06795 [Escherichia coli]
gb|KYW51084.1| hypothetical protein AML82_10440 [Escherichia coli]
gb|KYW54355.1| hypothetical protein AML83_09900 [Escherichia coli]
gb|KYW58752.1| hypothetical protein AML84_18825 [Escherichia coli]
gb|KYW66897.1| hypothetical protein AML86_05515 [Escherichia coli]
gb|KYW67114.1| hypothetical protein AML85_04750 [Escherichia coli]
gb|KYW73897.1| hypothetical protein AML87_19980 [Escherichia coli]
gb|KYW79028.1| hypothetical protein AML88_16840 [Escherichia coli]
gb|AMU84036.1| hypothetical protein Y979_18580 [Escherichia coli str. Sanji]
gb|KYZ88669.1| hypothetical protein ACM49_13470 [Escherichia coli]
gb|KYZ92317.1| hypothetical protein ACM48_07725 [Escherichia coli]
gb|KZA00096.1| hypothetical protein ACM47_10190 [Escherichia coli]
gb|AMW43227.1| hypothetical protein ARC77_13730 [Escherichia coli]
gb|AMW48647.1| hypothetical protein AR439_12620 [Escherichia coli]
gb|KZG96696.1| hypothetical protein AWG39_14595 [Escherichia coli]
gb|KZH31615.1| hypothetical protein AWG36_17085 [Escherichia coli]
gb|KZH44580.1| hypothetical protein AWG43_11505 [Escherichia coli]
gb|KZH59485.1| hypothetical protein AWG49_15830 [Escherichia coli]
gb|KZH70259.1| hypothetical protein AWG51_25780 [Escherichia coli]
gb|KZH95018.1| hypothetical protein AWG50_18990 [Escherichia coli]
gb|KZI17314.1| hypothetical protein AWG64_04415 [Escherichia coli]
gb|KZI30848.1| hypothetical protein AWG66_10570 [Escherichia coli]
gb|KZI32793.1| hypothetical protein AWG75_18420 [Escherichia coli]
gb|KZI59148.1| hypothetical protein AWG71_16440 [Escherichia coli]
gb|KZI86608.1| hypothetical protein AWG74_14750 [Escherichia coli]
gb|KZI93653.1| hypothetical protein AWG76_13520 [Escherichia coli]
gb|KZJ60250.1| hypothetical protein AWG90_13790 [Escherichia coli]
gb|KZJ61901.1| hypothetical protein AWG98_05315 [Escherichia coli]
gb|KZJ68912.1| hypothetical protein AWG95_27270 [Escherichia coli]
gb|KZJ85742.1| hypothetical protein AWG97_08705 [Escherichia coli]
gb|KZK03084.1| hypothetical protein AWH01_25860 [Escherichia coli]
gb|KZO67350.1| hypothetical protein AAW07_12110 [Escherichia coli]
gb|KZO72624.1| hypothetical protein AAW09_04615 [Escherichia coli]
gb|KZO75696.1| hypothetical protein TH56_12865 [Escherichia coli]
gb|KZO80876.1| hypothetical protein AAW05_02745 [Escherichia coli]
gb|KZO86443.1| hypothetical protein TH54_05080 [Escherichia coli]
gb|KZP41423.1| hypothetical protein XF27_01625 [Escherichia coli]
gb|KZP45070.1| hypothetical protein XF28_12305 [Escherichia coli]
gb|OAC01406.1| putative lipoprotein [Escherichia coli]
gb|OAC02465.1| putative lipoprotein [Escherichia coli]
gb|OAC10497.1| putative lipoprotein [Escherichia coli]
gb|OAC18856.1| putative lipoprotein [Escherichia coli]
gb|OAC22333.1| putative lipoprotein [Escherichia coli]
gb|OAC29495.1| putative lipoprotein [Escherichia coli]
gb|OAC33585.1| putative lipoprotein [Escherichia coli]
gb|OAC39116.1| putative lipoprotein [Escherichia coli]
gb|OAC42388.1| putative lipoprotein [Escherichia coli]
gb|OAE59287.1| hypothetical protein A7J46_06860 [Escherichia coli]
gb|OAE72421.1| hypothetical protein A7J65_20745 [Escherichia coli]
gb|OAF27389.1| hypothetical protein AXK31_16305 [Escherichia coli]
gb|OAF31718.1| hypothetical protein AXK32_08055 [Escherichia coli]
gb|OAF34641.1| hypothetical protein AXK34_13205 [Escherichia coli]
gb|OAF42023.1| hypothetical protein AXK33_12755 [Escherichia coli]
gb|OAF44635.1| hypothetical protein AXK29_09535 [Escherichia coli]
gb|OAF50153.1| hypothetical protein AXK35_18820 [Escherichia coli]
gb|OAF91500.1| Protein dcrB [Escherichia coli PCN009]
gb|OAF91768.1| Protein dcrB [Escherichia coli PCN079]
gb|OAI32308.1| hypothetical protein A6M24_08740 [Escherichia coli]
gb|ANE59774.1| hypothetical protein A5956_08515 [Escherichia coli]
gb|ANE64452.1| hypothetical protein A5955_08825 [Escherichia coli]
gb|OAJ79436.1| hypothetical protein A5957_14855 [Escherichia coli]
gb|OAJ84105.1| hypothetical protein A5959_13250 [Escherichia coli]
emb|SAP59571.1| DcrB protein [Klebsiella oxytoca]
gb|OAN07231.1| hypothetical protein AU469_011230 [Escherichia coli O157:H7]
gb|OAO50090.1| hypothetical protein OO99_07925 [Escherichia coli]
gb|OAO59028.1| hypothetical protein OP00_14240 [Escherichia coli]
gb|OAO64786.1| hypothetical protein OO97_12735 [Escherichia coli]
gb|OAO68226.1| hypothetical protein OO96_15320 [Escherichia coli]
gb|ANG70883.1| protein DcrB [Escherichia coli O157:H7]
gb|ANG76379.1| protein DcrB [Escherichia coli O157:H7]
gb|ANG82061.1| protein DcrB [Escherichia coli O157:H7]
gb|OAR93307.1| hypothetical protein AYO03_12400 [Escherichia coli]
gb|OAR96241.1| hypothetical protein AYO02_10450 [Escherichia coli]
gb|OAR99539.1| hypothetical protein AYO07_04610 [Escherichia coli]
gb|OAS87333.1| hypothetical protein A6I92_19500 [Escherichia coli]
gb|OAV48461.1| hypothetical protein A6I93_01560 [Escherichia coli]
gb|ANJ33281.1| hypothetical protein A9K64_01370 [Escherichia coli]
gb|ANK07504.1| hypothetical protein A9X67_01280 [Escherichia coli]
gb|ANM84232.1| hypothetical protein A8V37_17645 [Escherichia coli]
gb|ANO91389.1| hypothetical protein GJ11_22240 [Escherichia coli]
gb|ANP09472.1| hypothetical protein CP48_20895 [Escherichia coli]
gb|ANP20290.1| hypothetical protein GJ12_21670 [Escherichia coli]
gb|ANP34423.1| hypothetical protein AB847_21995 [Escherichia coli]
gb|ANO80013.1| hypothetical protein CO57_21325 [Escherichia coli]
gb|ANQ02808.1| hypothetical protein A9C00_12675 [Escherichia coli]
gb|ANO27935.1| hypothetical protein BAY41_03190 [Escherichia coli]
gb|OCC36001.1| hypothetical protein AWZ62_13375 [Shigella sonnei]
gb|OCC36741.1| hypothetical protein AWZ63_15570 [Shigella sonnei]
gb|OCC38672.1| hypothetical protein AWZ64_08300 [Shigella sonnei]
gb|OCC45217.1| hypothetical protein AW010_05105 [Shigella sonnei]
gb|OCC51486.1| hypothetical protein AWZ65_08300 [Shigella sonnei]
gb|OCC56918.1| hypothetical protein AWZ66_00335 [Shigella sonnei]
gb|OCC66083.1| hypothetical protein AW007_15180 [Shigella sonnei]
gb|OCC68126.1| hypothetical protein AW008_01315 [Shigella sonnei]
gb|OCC68194.1| hypothetical protein AW009_11530 [Shigella sonnei]
gb|OCC73279.1| hypothetical protein AW000_00575 [Shigella sonnei]
gb|OCC79251.1| hypothetical protein AW003_15120 [Shigella sonnei]
gb|OCC80903.1| hypothetical protein AW001_12875 [Shigella sonnei]
gb|OCC83959.1| hypothetical protein AWZ99_07225 [Shigella sonnei]
gb|OCC84217.1| hypothetical protein AWZ98_05885 [Shigella sonnei]
gb|OCC87247.1| hypothetical protein AWZ97_05080 [Shigella sonnei]
gb|OCC93880.1| hypothetical protein AWZ96_09710 [Shigella sonnei]
gb|OCD05145.1| hypothetical protein AWZ94_16055 [Shigella sonnei]
gb|OCD06654.1| hypothetical protein AWZ95_11625 [Shigella sonnei]
gb|OCD10778.1| hypothetical protein AWZ92_08365 [Shigella sonnei]
gb|OCD11572.1| hypothetical protein AWZ91_05020 [Shigella sonnei]
gb|OCD12007.1| hypothetical protein AWZ93_05175 [Shigella sonnei]
gb|OCD32167.1| hypothetical protein AWZ90_01980 [Shigella sonnei]
gb|OCD33433.1| hypothetical protein AWZ87_09145 [Shigella sonnei]
gb|OCD33715.1| hypothetical protein AWZ89_10565 [Shigella sonnei]
gb|OCD35680.1| hypothetical protein AWZ88_14515 [Shigella sonnei]
gb|OCD36085.1| hypothetical protein AWZ86_05860 [Shigella sonnei]
gb|OCD38048.1| hypothetical protein AWZ85_06905 [Shigella sonnei]
gb|OCD48818.1| hypothetical protein AWZ70_08645 [Shigella sonnei]
gb|OCD55628.1| hypothetical protein AWZ73_17175 [Shigella sonnei]
gb|OCD56501.1| hypothetical protein AWZ84_12770 [Shigella sonnei]
gb|OCD63649.1| hypothetical protein AW028_03465 [Shigella sonnei]
gb|OCD64294.1| hypothetical protein AWZ69_03680 [Shigella sonnei]
gb|OCD72282.1| hypothetical protein AW027_12070 [Shigella sonnei]
gb|OCD74403.1| hypothetical protein AW026_06635 [Shigella sonnei]
gb|OCD82520.1| hypothetical protein AW024_15855 [Shigella sonnei]
gb|OCD84816.1| hypothetical protein AW025_12880 [Shigella sonnei]
gb|OCD85261.1| hypothetical protein AW023_01255 [Shigella sonnei]
gb|OCD88572.1| hypothetical protein AW022_04670 [Shigella sonnei]
gb|OCD93432.1| hypothetical protein AW021_18900 [Shigella sonnei]
gb|OCE00918.1| hypothetical protein AW019_07255 [Shigella sonnei]
gb|OCE08168.1| hypothetical protein AW020_13565 [Shigella sonnei]
gb|OCE11066.1| hypothetical protein AW018_11700 [Shigella sonnei]
gb|OCE12061.1| hypothetical protein AW016_09900 [Shigella sonnei]
gb|OCE12331.1| hypothetical protein AW017_07955 [Shigella sonnei]
gb|OCE16137.1| hypothetical protein AW015_03140 [Shigella sonnei]
gb|OCE28260.1| hypothetical protein AW013_02660 [Shigella sonnei]
gb|OCE28644.1| hypothetical protein AW012_04610 [Shigella sonnei]
gb|OCE34522.1| hypothetical protein AW014_12405 [Shigella sonnei]
gb|OCE40889.1| hypothetical protein AW011_04610 [Shigella sonnei]
gb|OCE41027.1| hypothetical protein AW006_00385 [Shigella sonnei]
gb|OCE48789.1| hypothetical protein AW005_17395 [Shigella sonnei]
gb|OCE55793.1| hypothetical protein AW004_02770 [Shigella sonnei]
gb|OCE57143.1| hypothetical protein AWZ83_02695 [Shigella sonnei]
gb|OCE61777.1| hypothetical protein AW002_16140 [Shigella sonnei]
gb|OCE64324.1| hypothetical protein AWZ80_10485 [Shigella sonnei]
gb|OCE67881.1| hypothetical protein AWZ81_04210 [Shigella sonnei]
gb|OCE70156.1| hypothetical protein AWZ82_14635 [Shigella sonnei]
gb|OCE80296.1| hypothetical protein AWZ77_03650 [Shigella sonnei]
gb|OCE84426.1| hypothetical protein AWZ79_00140 [Shigella sonnei]
gb|OCE85292.1| hypothetical protein AWZ78_01955 [Shigella sonnei]
gb|OCE87078.1| hypothetical protein AWZ76_05750 [Shigella sonnei]
gb|OCE95588.1| hypothetical protein AWZ75_01975 [Shigella sonnei]
gb|OCE99128.1| hypothetical protein AWZ72_05425 [Shigella sonnei]
gb|OCF01279.1| hypothetical protein AWZ74_01965 [Shigella sonnei]
gb|OCF02052.1| hypothetical protein AWZ71_04690 [Shigella sonnei]
gb|OCF08183.1| hypothetical protein AWZ67_04635 [Shigella sonnei]
gb|OCF10628.1| hypothetical protein AWZ68_03600 [Shigella sonnei]
gb|OCF19827.1| hypothetical protein AWZ61_15205 [Shigella sonnei]
emb|SCA73328.1| periplasmic protein DcrB [Escherichia coli]
gb|OCK71851.1| hypothetical protein BBZ58_13280 [Escherichia coli]
gb|ANW29848.1| hypothetical protein BB405_13480 [Escherichia coli]
gb|ANW42362.1| hypothetical protein A9L45_24055 [Escherichia coli O157:H7]
gb|OCO56701.1| hypothetical protein AN669_0213090 [Escherichia coli]
gb|OCQ13606.1| hypothetical protein AGA39_17350 [Escherichia coli]
gb|OCQ17839.1| hypothetical protein A6I94_01790 [Escherichia coli]
gb|OCQ45923.1| hypothetical protein BA191_07505 [Escherichia coli]
gb|OCS52814.1| hypothetical protein BBZ49_20420 [Escherichia coli]
gb|OCS69157.1| hypothetical protein BBZ54_17455 [Escherichia coli]
gb|OCT06645.1| hypothetical protein ECO37_06750 [Escherichia coli]
gb|OCW52432.1| hypothetical protein BEI66_07445 [Escherichia coli]
gb|OCW78531.1| hypothetical protein A8R19_06210 [Escherichia coli]
gb|AOD09447.1| hypothetical protein A7402_07075 [Escherichia coli]
gb|ODA85839.1| hypothetical protein A9D65_07115 [Escherichia coli]
gb|ODB49360.1| hypothetical protein A9J90_21010 [Escherichia coli]
gb|ODG69116.1| hypothetical protein BFF42_06840 [Shigella sp. FC1661]
gb|ODG74400.1| hypothetical protein BFF49_02210 [Shigella sp. FC2045]
gb|ODG81570.1| hypothetical protein BFF50_01805 [Shigella sp. FC2928]
gb|ODH16751.1| hypothetical protein A6V28_13025 [Escherichia coli]
gb|ODH23217.1| hypothetical protein A6804_10465 [Escherichia coli]
gb|ODH31028.1| hypothetical protein A6803_08325 [Escherichia coli]
gb|ODH36079.1| hypothetical protein A6413_08630 [Escherichia coli]
gb|ODH42135.1| hypothetical protein A6412_10630 [Escherichia coli]
gb|ODJ14137.1| hypothetical protein BFR10_03385 [Shigella sp. FC1180]
gb|ODJ14805.1| hypothetical protein BFR09_03000 [Shigella sp. FC1172]
gb|ODJ28938.1| hypothetical protein BFR11_06565 [Shigella sp. FC2383]
gb|ODJ35855.1| hypothetical protein A6I96_20255 [Escherichia coli]
gb|ODJ40166.1| hypothetical protein A6I97_17895 [Escherichia coli]
gb|AOM43327.1| DcrB protein precursor [Escherichia coli]
gb|AOM55931.1| hypothetical protein BCV59_16305 [Escherichia coli]
gb|AOM59956.1| hypothetical protein CFSAN004177_10255 [Escherichia coli]
gb|AOM71966.1| hypothetical protein MS6198_39750 [Escherichia coli]
gb|ODQ14240.1| hypothetical protein BGK53_02720 [Shigella sp. FC1139]
gb|AOO71672.1| hypothetical protein NEB5A_17735 [Escherichia coli]
gb|OEB97845.1| hypothetical protein AP216_13065 [Escherichia coli]
gb|OEG65278.1| hypothetical protein A7H95_13310 [Escherichia coli]
gb|AOR21686.1| hypothetical protein BBP24_21640 [Escherichia coli]
gb|OEI02407.1| hypothetical protein A9R45_02795 [Escherichia coli]
gb|OEI03457.1| hypothetical protein A9R47_16625 [Escherichia coli]
gb|OEI09041.1| hypothetical protein A9R46_00600 [Escherichia coli]
gb|OEI27411.1| hypothetical protein A9R49_08410 [Escherichia coli]
gb|OEI28224.1| hypothetical protein A9R48_04725 [Escherichia coli]
gb|OEI32528.1| hypothetical protein A9R44_19545 [Escherichia coli]
gb|OEI37008.1| hypothetical protein A9R50_16170 [Escherichia coli]
gb|OEI50198.1| hypothetical protein A9R51_02020 [Escherichia coli]
gb|OEI62245.1| hypothetical protein A9R57_02075 [Escherichia coli]
gb|OEI64809.1| hypothetical protein A9R56_23395 [Escherichia coli]
gb|OEL39627.1| hypothetical protein BHF05_21355 [Escherichia coli]
gb|OEL47874.1| hypothetical protein BHF06_05635 [Escherichia coli]
gb|OEL49926.1| hypothetical protein BHF04_16345 [Escherichia coli]
gb|OEL56821.1| hypothetical protein BHF08_14950 [Escherichia coli]
gb|OEL59512.1| hypothetical protein BHF07_09105 [Escherichia coli]
gb|OEL66334.1| hypothetical protein BHF11_18740 [Escherichia coli]
gb|OEL67001.1| hypothetical protein BHF09_08825 [Escherichia coli]
gb|OEL76808.1| hypothetical protein BHF10_01155 [Escherichia coli]
gb|OEL77747.1| hypothetical protein BHF13_25845 [Escherichia coli]
gb|OEL82120.1| hypothetical protein BHF12_06780 [Escherichia coli]
gb|OEL86991.1| hypothetical protein BHF14_14575 [Escherichia coli]
gb|OEL93190.1| hypothetical protein BHF15_13945 [Escherichia coli]
gb|OEL97038.1| hypothetical protein BHF16_18985 [Escherichia coli]
gb|OEM03164.1| hypothetical protein BHF17_12430 [Escherichia coli]
gb|OEM08171.1| hypothetical protein BHF18_19115 [Escherichia coli]
gb|OEM10460.1| hypothetical protein BHF19_09630 [Escherichia coli]
gb|OEM20400.1| hypothetical protein BHF22_13925 [Escherichia coli]
gb|OEM21936.1| hypothetical protein BHF21_02525 [Escherichia coli]
gb|OEM29957.1| hypothetical protein BHF24_08925 [Escherichia coli]
gb|OEM31367.1| hypothetical protein BHF20_09385 [Escherichia coli]
gb|OEM37899.1| hypothetical protein BHF26_15665 [Escherichia coli]
gb|OEM45658.1| hypothetical protein BHF27_17805 [Escherichia coli]
gb|OEM50823.1| hypothetical protein BHF28_14535 [Escherichia coli]
gb|OEM54368.1| hypothetical protein BHF29_20000 [Escherichia coli]
gb|OEM63102.1| hypothetical protein BHF30_09230 [Escherichia coli]
gb|OEM67041.1| hypothetical protein BHF31_09910 [Escherichia coli]
gb|OEM70333.1| hypothetical protein BHF32_12625 [Escherichia coli]
gb|OEM74115.1| hypothetical protein BHF33_20645 [Escherichia coli]
gb|OEM80299.1| hypothetical protein BHF34_14100 [Escherichia coli]
gb|OEM85942.1| hypothetical protein BHF35_12505 [Escherichia coli]
gb|OEM90927.1| hypothetical protein BHF36_11740 [Escherichia coli]
gb|OEM96571.1| hypothetical protein BHF37_06545 [Escherichia coli]
gb|OEN03249.1| hypothetical protein BHF38_09200 [Escherichia coli]
gb|OEN05733.1| hypothetical protein BHF39_03735 [Escherichia coli]
gb|OEN11941.1| hypothetical protein BHF40_03570 [Escherichia coli]
gb|OEN13893.1| hypothetical protein BHF41_13855 [Escherichia coli]
gb|OEN20764.1| hypothetical protein BHF42_05680 [Escherichia coli]
gb|OEN23341.1| hypothetical protein BHF43_15205 [Escherichia coli]
gb|OEN29792.1| hypothetical protein BHF45_07885 [Escherichia coli]
gb|OEN35484.1| hypothetical protein BHF46_10465 [Escherichia coli]
gb|OEN41578.1| hypothetical protein BHF47_13090 [Escherichia coli]
gb|OEN42705.1| hypothetical protein BHF44_07220 [Escherichia coli]
gb|OEN45505.1| hypothetical protein BHF48_23500 [Escherichia coli]
gb|OEN53985.1| hypothetical protein BHF49_12335 [Escherichia coli]
gb|OEN57098.1| hypothetical protein BHF50_12895 [Escherichia coli]
gb|OEN66845.1| hypothetical protein BHF51_00665 [Escherichia coli]
gb|OEN70407.1| hypothetical protein BHF52_03835 [Escherichia coli]
gb|OEN74189.1| hypothetical protein BHF54_11120 [Escherichia coli]
gb|OEN77697.1| hypothetical protein BHF53_13875 [Escherichia coli]
gb|OEN79681.1| hypothetical protein BHF55_18320 [Escherichia coli]
gb|OEN84295.1| hypothetical protein BHF56_16855 [Escherichia coli]
gb|OEN95160.1| hypothetical protein BHF59_12215 [Escherichia coli]
gb|OEO00047.1| hypothetical protein BHF58_01910 [Escherichia coli]
gb|OEO06004.1| hypothetical protein BHF57_01960 [Escherichia coli]
gb|OEO10200.1| hypothetical protein BHF60_00995 [Escherichia coli]
gb|OEO10817.1| hypothetical protein BHF61_13740 [Escherichia coli]
gb|OEO15527.1| hypothetical protein BHF23_20425 [Escherichia coli]
gb|OEO18136.1| hypothetical protein BHF62_12415 [Escherichia coli]
gb|AOT30811.1| protein DcrB [Escherichia coli]
gb|AOV19648.1| hypothetical protein A4C50_01920 [Escherichia coli O157:H7]
gb|AOV25002.1| hypothetical protein A4C44_01920 [Escherichia coli O157:H7]
gb|AOV30353.1| hypothetical protein A4C45_01920 [Escherichia coli O157:H7]
gb|AOV35722.1| hypothetical protein A4C38_01925 [Escherichia coli O157:H7]
gb|AOV41133.1| hypothetical protein A4C51_01920 [Escherichia coli O157:H7]
gb|AOV46481.1| hypothetical protein A4C39_01945 [Escherichia coli O157:H7]
gb|AOV51893.1| hypothetical protein A4C47_01920 [Escherichia coli O157:H7]
gb|OFE30319.1| hypothetical protein BBJ27_20610 [Escherichia coli]
emb|SDO24931.1| protein of unknown function [Shigella sonnei]
gb|AOX50245.1| hypothetical protein BHW76_01690 [Escherichia coli]
gb|AOX55649.1| hypothetical protein BHW77_01690 [Escherichia coli]
emb|SEQ18774.1| protein of unknown function [Escherichia coli]
gb|APA24492.1| hypothetical protein ATO45_03390 [Escherichia coli]
gb|OII55788.1| hypothetical protein BFX01_06385 [Escherichia coli]
gb|APA40183.1| hypothetical protein AU473_04410 [Escherichia coli]
gb|OII98895.1| hypothetical protein BHF03_10040 [Escherichia coli]
gb|OIJ08669.1| hypothetical protein BHF01_05825 [Escherichia coli]
emb|SCQ12130.1| hypothetical protein ECK802_3800 [Escherichia coli]
gb|APC53949.1| hypothetical protein BL257_19370 [Escherichia coli str. K-12
substr. W3110]
gb|OIZ67797.1| hypothetical protein BJI68_14470 [Escherichia coli]
gb|OIZ68202.1| hypothetical protein BM756_24040 [Escherichia coli]
gb|OIZ81098.1| hypothetical protein BM751_20325 [Escherichia coli]
gb|OIZ85331.1| hypothetical protein BMW25_19025 [Escherichia coli]
gb|OIZ96192.1| hypothetical protein BMS05_09945 [Escherichia coli]
gb|OJF20931.1| hypothetical protein AUR51_20640 [Escherichia coli]
gb|OJF24670.1| hypothetical protein AV889_20500 [Escherichia coli]
gb|OJF26266.1| hypothetical protein AP219_20540 [Escherichia coli]
gb|OJF36603.1| hypothetical protein AP220_20640 [Escherichia coli]
gb|OJF38446.1| hypothetical protein AUR53_20635 [Escherichia coli]
gb|OJF47268.1| hypothetical protein AP221_20645 [Escherichia coli]
gb|OJF53524.1| hypothetical protein AUR52_21680 [Escherichia coli]
gb|OJF54401.1| hypothetical protein AP222_20450 [Escherichia coli]
gb|OJF63377.1| hypothetical protein AUR50_20380 [Escherichia coli]
gb|APE55197.1| hypothetical protein BSG22_18530 [Escherichia coli]
gb|APE60147.1| hypothetical protein BSG21_18560 [Escherichia coli]
gb|APE65027.1| hypothetical protein BSG23_18565 [Escherichia coli]
gb|APE69862.1| hypothetical protein BSG24_18535 [Escherichia coli]
gb|APE77893.1| DcrB protein precursor [Escherichia coli]
gb|APE90080.1| DcrB protein precursor [Escherichia coli]
gb|APG34699.1| hypothetical protein BLJ80_08000 [Escherichia coli]
gb|API00498.1| hypothetical protein BFL20_23990 [Escherichia coli]
gb|API06102.1| hypothetical protein BFL22_23665 [Escherichia coli]
gb|API11651.1| hypothetical protein BFL24_23370 [Escherichia coli]
gb|API17255.1| hypothetical protein BFL21_23350 [Escherichia coli]
gb|API22903.1| hypothetical protein BFL23_24090 [Escherichia coli]
gb|API28395.1| hypothetical protein BFL18_23150 [Escherichia coli]
gb|API34061.1| hypothetical protein BFL16_24165 [Escherichia coli]
gb|API39627.1| hypothetical protein BFL17_23525 [Escherichia coli]
gb|API49374.1| hypothetical protein BSZ13_23030 [Escherichia coli]
gb|OJK13632.1| hypothetical protein BK238_18325 [Escherichia coli]
gb|OJK20500.1| hypothetical protein BK236_09530 [Escherichia coli]
gb|OJK26751.1| hypothetical protein BK237_02670 [Escherichia coli]
gb|OJK27377.1| hypothetical protein BK239_09750 [Escherichia coli]
gb|OJK37635.1| hypothetical protein BK240_15060 [Escherichia coli]
gb|OJK38364.1| hypothetical protein BK242_14765 [Escherichia coli]
gb|OJK40886.1| hypothetical protein BK241_03430 [Escherichia coli]
gb|OJK46835.1| hypothetical protein BK245_21835 [Escherichia coli]
gb|OJK50203.1| hypothetical protein BK243_17315 [Escherichia coli]
gb|OJK61721.1| hypothetical protein BK244_04595 [Escherichia coli]
gb|OJK63114.1| hypothetical protein BK246_16355 [Escherichia coli]
gb|OJK69501.1| hypothetical protein BK247_10950 [Escherichia coli]
gb|OJK76352.1| hypothetical protein BK248_05550 [Escherichia coli]
gb|OJK82676.1| hypothetical protein BK249_03680 [Escherichia coli]
gb|OJK87858.1| hypothetical protein BK250_00855 [Escherichia coli]
gb|OJK93125.1| hypothetical protein BK252_06900 [Escherichia coli]
gb|OJK96226.1| hypothetical protein BK251_08640 [Escherichia coli]
gb|OJL00112.1| hypothetical protein BK254_22395 [Escherichia coli]
gb|OJL10733.1| hypothetical protein BK253_03715 [Escherichia coli]
gb|OJL13102.1| hypothetical protein BK255_00245 [Escherichia coli]
gb|OJL16931.1| hypothetical protein BK256_15120 [Escherichia coli]
gb|OJL24890.1| hypothetical protein BK258_03495 [Escherichia coli]
gb|OJL26464.1| hypothetical protein BK257_12340 [Escherichia coli]
gb|OJL30837.1| hypothetical protein BK259_21765 [Escherichia coli]
gb|OJL32466.1| hypothetical protein BK260_18125 [Escherichia coli]
gb|OJL40912.1| hypothetical protein BK263_18455 [Escherichia coli]
gb|OJL45995.1| hypothetical protein BK264_19000 [Escherichia coli]
gb|OJL54623.1| hypothetical protein BK262_14495 [Escherichia coli]
gb|OJL54781.1| hypothetical protein BK261_12295 [Escherichia coli]
gb|OJL60148.1| hypothetical protein BK265_23010 [Escherichia coli]
gb|OJL69582.1| hypothetical protein BK267_03300 [Escherichia coli]
gb|OJL74246.1| hypothetical protein BK269_11635 [Escherichia coli]
gb|OJL81108.1| hypothetical protein BK268_02755 [Escherichia coli]
gb|OJL82879.1| hypothetical protein BK266_13305 [Escherichia coli]
gb|OJL89808.1| hypothetical protein BK270_09790 [Escherichia coli]
gb|OJL94353.1| hypothetical protein BK271_17260 [Escherichia coli]
gb|OJL95328.1| hypothetical protein BK272_13765 [Escherichia coli]
gb|OJM07800.1| hypothetical protein BK273_08650 [Escherichia coli]
gb|OJM11217.1| hypothetical protein BK274_00695 [Escherichia coli]
gb|OJM16012.1| hypothetical protein BK277_20095 [Escherichia coli]
gb|OJM20481.1| hypothetical protein BK276_07170 [Escherichia coli]
gb|OJM24826.1| hypothetical protein BK275_02420 [Escherichia coli]
gb|OJM30811.1| hypothetical protein BK279_19145 [Escherichia coli]
gb|OJM38414.1| hypothetical protein BK280_05780 [Escherichia coli]
gb|OJM42002.1| hypothetical protein BK278_01470 [Escherichia coli]
gb|OJM45583.1| hypothetical protein BK282_22325 [Escherichia coli]
gb|OJM46656.1| hypothetical protein BK281_12880 [Escherichia coli]
gb|OJM57785.1| hypothetical protein BK283_01005 [Escherichia coli]
gb|OJM62470.1| hypothetical protein BK285_11540 [Escherichia coli]
gb|OJM67035.1| hypothetical protein BK284_03610 [Escherichia coli]
gb|OJM68377.1| hypothetical protein BK286_22185 [Escherichia coli]
gb|OJM70927.1| hypothetical protein BK288_24600 [Escherichia coli]
gb|OJM76170.1| hypothetical protein BK287_12675 [Escherichia coli]
gb|OJM90154.1| hypothetical protein BK289_08590 [Escherichia coli]
gb|OJM96651.1| hypothetical protein BK291_00490 [Escherichia coli]
gb|OJM96844.1| hypothetical protein BK292_07265 [Escherichia coli]
gb|OJN03154.1| hypothetical protein BK293_07365 [Escherichia coli]
gb|OJN10365.1| hypothetical protein BK294_08125 [Escherichia coli]
gb|OJN13682.1| hypothetical protein BK295_03000 [Escherichia coli]
gb|OJN17457.1| hypothetical protein BK296_10020 [Escherichia coli]
gb|OJN20180.1| hypothetical protein BK298_20415 [Escherichia coli]
gb|OJN32338.1| hypothetical protein BK299_06325 [Escherichia coli]
gb|OJN33155.1| hypothetical protein BK297_03790 [Escherichia coli]
gb|OJN36479.1| hypothetical protein BK300_15770 [Escherichia coli]
gb|OJN43592.1| hypothetical protein BK302_15740 [Escherichia coli]
gb|OJN46544.1| hypothetical protein BK301_10925 [Escherichia coli]
gb|OJN59903.1| hypothetical protein BK303_02860 [Escherichia coli]
gb|OJN62747.1| hypothetical protein BK305_03045 [Escherichia coli]
gb|OJN68091.1| hypothetical protein BK306_00485 [Escherichia coli]
gb|OJN68496.1| hypothetical protein BK304_09145 [Escherichia coli]
gb|OJN71706.1| hypothetical protein BK307_18880 [Escherichia coli]
gb|OJN80972.1| hypothetical protein BK309_02520 [Escherichia coli]
gb|OJN84475.1| hypothetical protein BK290_10780 [Escherichia coli]
gb|OJN89317.1| hypothetical protein BK310_11755 [Escherichia coli]
gb|OJN96141.1| hypothetical protein BK311_14715 [Escherichia coli]
gb|OJO00951.1| hypothetical protein BK308_06535 [Escherichia coli]
gb|OJO06624.1| hypothetical protein BK313_21810 [Escherichia coli]
gb|OJO07044.1| hypothetical protein BK312_04940 [Escherichia coli]
gb|OJO15848.1| hypothetical protein BK316_25315 [Escherichia coli]
gb|OJO16922.1| hypothetical protein BK315_18475 [Escherichia coli]
gb|OJO19485.1| hypothetical protein BK314_06285 [Escherichia coli]
gb|OJO30281.1| hypothetical protein BK317_16915 [Escherichia coli]
gb|OJO38866.1| hypothetical protein BK318_01585 [Escherichia coli]
gb|OJO39538.1| hypothetical protein BK319_13955 [Escherichia coli]
gb|OJO41409.1| hypothetical protein BK320_21435 [Escherichia coli]
gb|OJO49580.1| hypothetical protein BK322_19840 [Escherichia coli]
gb|OJO51972.1| hypothetical protein BK321_10000 [Escherichia coli]
gb|OJO57980.1| hypothetical protein BK323_18520 [Escherichia coli]
gb|OJO63568.1| hypothetical protein BK324_17635 [Escherichia coli]
gb|OJO67545.1| hypothetical protein BK325_13110 [Escherichia coli]
gb|OJO75024.1| hypothetical protein BK326_03485 [Escherichia coli]
gb|OJO76811.1| hypothetical protein BK327_19005 [Escherichia coli]
gb|OJO81969.1| hypothetical protein BK330_25350 [Escherichia coli]
gb|OJO85783.1| hypothetical protein BK329_19735 [Escherichia coli]
gb|OJO85922.1| hypothetical protein BK328_14905 [Escherichia coli]
gb|OJO99674.1| hypothetical protein BK331_05365 [Escherichia coli]
gb|OJP04415.1| hypothetical protein BK333_13380 [Escherichia coli]
gb|OJP10614.1| hypothetical protein BK332_00670 [Escherichia coli]
gb|OJP14674.1| hypothetical protein BK334_06860 [Escherichia coli]
gb|OJP18280.1| hypothetical protein BK336_13885 [Escherichia coli]
gb|OJP23449.1| hypothetical protein BK335_14495 [Escherichia coli]
gb|OJP29138.1| hypothetical protein BK337_12645 [Escherichia coli]
gb|OJP36947.1| hypothetical protein BK338_02250 [Escherichia coli]
gb|OJP39347.1| hypothetical protein BK339_06240 [Escherichia coli]
gb|OJP42542.1| hypothetical protein BK340_18420 [Escherichia coli]
gb|OJP48312.1| hypothetical protein BK342_08645 [Escherichia coli]
gb|OJP53680.1| hypothetical protein BK341_07445 [Escherichia coli]
gb|OJP57667.1| hypothetical protein BK343_14280 [Escherichia coli]
gb|OJP64206.1| hypothetical protein BK344_07915 [Escherichia coli]
gb|OJP69640.1| hypothetical protein BK346_14695 [Escherichia coli]
gb|OJP70167.1| hypothetical protein BK345_07915 [Escherichia coli]
gb|OJP75578.1| hypothetical protein BK347_17130 [Escherichia coli]
gb|OJP83242.1| hypothetical protein BK348_02860 [Escherichia coli]
gb|OJP88210.1| hypothetical protein BK349_16830 [Escherichia coli]
gb|OJP89196.1| hypothetical protein BK350_09765 [Escherichia coli]
gb|OJP98697.1| hypothetical protein BK351_09100 [Escherichia coli]
gb|OJP99457.1| hypothetical protein BK352_07280 [Escherichia coli]
gb|OJQ08144.1| hypothetical protein BK354_03405 [Escherichia coli]
gb|OJQ10825.1| hypothetical protein BK353_15635 [Escherichia coli]
gb|OJQ16360.1| hypothetical protein BK355_11990 [Escherichia coli]
gb|OJQ21101.1| hypothetical protein BK356_13320 [Escherichia coli]
gb|OJQ22177.1| hypothetical protein BK357_20140 [Escherichia coli]
gb|OJQ31147.1| hypothetical protein BK358_11095 [Escherichia coli]
gb|OJQ33249.1| hypothetical protein BK359_18770 [Escherichia coli]
gb|OJQ39875.1| hypothetical protein BK360_12705 [Escherichia coli]
gb|OJQ43689.1| hypothetical protein BK363_23765 [Escherichia coli]
gb|OJQ45281.1| hypothetical protein BK361_19080 [Escherichia coli]
gb|OJQ56903.1| hypothetical protein BK362_05100 [Escherichia coli]
gb|OJQ60129.1| hypothetical protein BK365_15245 [Escherichia coli]
gb|OJQ64874.1| hypothetical protein BK364_08100 [Escherichia coli]
gb|OJQ71200.1| hypothetical protein BK366_06650 [Escherichia coli]
gb|OJQ76012.1| hypothetical protein BK367_13245 [Escherichia coli]
gb|OJQ78097.1| hypothetical protein BK368_08935 [Escherichia coli]
gb|OJQ85556.1| hypothetical protein BK369_08830 [Escherichia coli]
gb|OJQ89765.1| hypothetical protein BK370_09805 [Escherichia coli]
gb|OJQ97943.1| hypothetical protein BK371_01285 [Escherichia coli]
gb|OJQ98441.1| hypothetical protein BK372_14420 [Escherichia coli]
gb|OJR16696.1| hypothetical protein BK375_09610 [Escherichia coli]
gb|OJR17109.1| hypothetical protein BK377_18835 [Escherichia coli]
gb|OJR20150.1| hypothetical protein BK376_18030 [Escherichia coli]
gb|OJR32088.1| hypothetical protein BK378_13260 [Escherichia coli]
gb|OJR40677.1| hypothetical protein BK380_02795 [Escherichia coli]
gb|OJR43382.1| hypothetical protein BK382_19935 [Escherichia coli]
gb|OJR52067.1| hypothetical protein BK381_03205 [Escherichia coli]
gb|OJR52938.1| hypothetical protein BK383_20735 [Escherichia coli]
gb|OJR63018.1| hypothetical protein BK385_03200 [Escherichia coli]
gb|OJR68360.1| hypothetical protein BK386_01435 [Escherichia coli]
gb|OJR73223.1| hypothetical protein BK384_03950 [Escherichia coli]
gb|OJR77436.1| hypothetical protein BK388_04065 [Escherichia coli]
gb|OJR78915.1| hypothetical protein BK389_22540 [Escherichia coli]
gb|OJR83919.1| hypothetical protein BK390_21585 [Escherichia coli]
gb|OJR93482.1| hypothetical protein BK387_10165 [Escherichia coli]
gb|OJR97620.1| hypothetical protein BK392_07265 [Escherichia coli]
gb|OJS00319.1| hypothetical protein BK391_16795 [Escherichia coli]
gb|OJS06182.1| hypothetical protein BK394_20055 [Escherichia coli]
gb|OJS08210.1| hypothetical protein BK393_08140 [Escherichia coli]
gb|OJS13333.1| hypothetical protein BK395_07040 [Escherichia coli]
gb|OJS21173.1| hypothetical protein BK396_21585 [Escherichia coli]
gb|OJS24252.1| hypothetical protein BK398_06330 [Escherichia coli]
gb|OJS30620.1| hypothetical protein BK397_05185 [Escherichia coli]
gb|OJS39855.1| hypothetical protein BK399_09180 [Escherichia coli]
gb|OJS44315.1| hypothetical protein BK402_18505 [Escherichia coli]
gb|OJS52486.1| hypothetical protein BK403_03300 [Escherichia coli]
gb|OJS55397.1| hypothetical protein BK404_21325 [Escherichia coli]
gb|OJS60397.1| hypothetical protein BK405_05020 [Escherichia coli]
gb|OJS67980.1| hypothetical protein BK407_08465 [Escherichia coli]
gb|OJS71408.1| hypothetical protein BK406_17310 [Escherichia coli]
gb|OJS76420.1| hypothetical protein BK408_16155 [Escherichia coli]
gb|OJS81140.1| hypothetical protein BK409_14845 [Escherichia coli]
gb|OJS91454.1| hypothetical protein BK400_00205 [Escherichia coli]
gb|APJ55885.1| hypothetical protein RC72_00925 [Escherichia coli]
gb|APJ63711.1| hypothetical protein RG25_18835 [Escherichia coli]
gb|APJ66551.1| hypothetical protein RG26_09610 [Escherichia coli]
gb|APJ70609.1| hypothetical protein RG27_02800 [Escherichia coli]
gb|APJ78847.1| hypothetical protein RG28_22400 [Escherichia coli]
gb|APJ84058.1| hypothetical protein RG30_21040 [Escherichia coli]
gb|APJ85345.1| hypothetical protein RG31_01935 [Escherichia coli]
gb|APJ89923.1| hypothetical protein RG32_02805 [Escherichia coli]
gb|APJ96458.1| hypothetical protein RG33_13085 [Escherichia coli]
gb|APK01747.1| hypothetical protein RG34_14190 [Escherichia coli]
gb|APK04552.1| hypothetical protein RG35_02315 [Escherichia coli]
gb|APK12760.1| hypothetical protein RG36_21810 [Escherichia coli]
gb|APK17405.1| hypothetical protein RG37_20000 [Escherichia coli]
gb|APK21135.1| hypothetical protein RG38_14905 [Escherichia coli]
gb|APK25324.1| hypothetical protein RG39_11705 [Escherichia coli]
gb|APK30188.1| hypothetical protein RG40_12975 [Escherichia coli]
gb|APK40980.1| hypothetical protein RG42_20830 [Escherichia coli]
gb|APK48634.1| hypothetical protein RG44_10530 [Escherichia coli]
gb|APK51732.1| hypothetical protein RG45_02675 [Escherichia coli]
gb|APK55760.1| hypothetical protein RG46_00895 [Escherichia coli]
gb|APK60839.1| hypothetical protein RG47_04505 [Escherichia coli]
gb|APK64955.1| hypothetical protein RG48_02225 [Escherichia coli]
gb|APK71983.1| hypothetical protein RG49_15905 [Escherichia coli]
gb|APK74839.1| hypothetical protein RG50_06815 [Escherichia coli]
gb|APK81720.1| hypothetical protein RG51_17610 [Escherichia coli]
gb|APK84483.1| hypothetical protein RG52_07885 [Escherichia coli]
gb|APK90665.1| hypothetical protein RG53_17020 [Escherichia coli]
gb|APK94378.1| hypothetical protein RG54_12480 [Escherichia coli]
gb|APK99150.1| hypothetical protein RG55_11980 [Escherichia coli]
gb|APL05173.1| hypothetical protein RG56_18550 [Escherichia coli]
gb|APL08407.1| hypothetical protein RG57_08785 [Escherichia coli]
gb|APL14956.1| hypothetical protein RG58_18530 [Escherichia coli]
gb|APL18584.1| hypothetical protein RG59_10850 [Escherichia coli]
gb|APL25288.1| hypothetical protein RG60_22260 [Escherichia coli]
gb|APL26493.1| hypothetical protein RG61_01285 [Escherichia coli]
gb|APL33528.1| hypothetical protein RG62_12370 [Escherichia coli]
gb|APL40178.1| hypothetical protein RG63_22480 [Escherichia coli]
gb|APL49608.1| hypothetical protein RG65_22060 [Escherichia coli]
gb|APL57444.1| hypothetical protein RG67_15300 [Escherichia coli]
gb|APL61696.1| hypothetical protein RG68_14410 [Escherichia coli]
gb|APL64257.1| hypothetical protein RG69_02065 [Escherichia coli]
gb|APL72204.1| hypothetical protein RG70_17515 [Escherichia coli]
gb|APL75450.1| hypothetical protein RG71_10500 [Escherichia coli]
gb|APL79753.1| hypothetical protein RG72_08145 [Escherichia coli]
gb|APL84813.1| hypothetical protein RG29_09580 [Escherichia coli]
gb|APL89130.1| hypothetical protein RG73_04580 [Escherichia coli]
gb|APL51631.1| hypothetical protein RG66_09070 [Escherichia coli]
gb|OKA62040.1| hypothetical protein BHL56_20660 [Escherichia coli]
gb|OKB73346.1| hypothetical protein BMT50_11480 [Escherichia coli]
gb|OKB84634.1| hypothetical protein BMT52_06815 [Escherichia coli]
gb|OKB91041.1| hypothetical protein BMT53_16815 [Escherichia coli]
gb|OKB93871.1| hypothetical protein BMT51_04890 [Escherichia coli]
gb|OKL97524.1| protein DcrB [Escherichia coli]
gb|OKO60444.1| hypothetical protein BSF34_19205 [Escherichia coli]
gb|OKP58745.1| hypothetical protein A8A03_22725 [Escherichia coli]
gb|OKS69720.1| hypothetical protein BTW13_08130 [Escherichia coli]
gb|OKS92958.1| hypothetical protein ACN56_11745 [Escherichia coli]
gb|OKS96108.1| hypothetical protein ACN54_23045 [Escherichia coli]
gb|OKT01130.1| hypothetical protein ACN58_08840 [Escherichia coli]
gb|OKT03358.1| hypothetical protein ACN55_25425 [Escherichia coli]
gb|OKT11145.1| hypothetical protein ACN61_21330 [Escherichia coli]
gb|OKT21427.1| hypothetical protein ACN57_19050 [Escherichia coli]
gb|OKT21605.1| hypothetical protein ACN59_05985 [Escherichia coli]
gb|OKT29542.1| hypothetical protein ACN62_18525 [Escherichia coli]
gb|OKT32287.1| hypothetical protein ACN66_08420 [Escherichia coli]
gb|OKT41012.1| hypothetical protein ACN63_12855 [Escherichia coli]
gb|OKT42825.1| hypothetical protein ACN60_17735 [Escherichia coli]
gb|OKT49481.1| hypothetical protein ACN65_07800 [Escherichia coli]
gb|OKT58325.1| hypothetical protein ACN64_01780 [Escherichia coli]
gb|OKT59721.1| hypothetical protein ACN73_13595 [Escherichia coli]
gb|OKT59832.1| hypothetical protein ACN68_30985 [Escherichia coli]
gb|OKT72623.1| hypothetical protein ACN71_04185 [Escherichia coli]
gb|OKT77019.1| hypothetical protein ACN67_04750 [Escherichia coli]
gb|OKT80456.1| hypothetical protein ACN69_19575 [Escherichia coli]
gb|OKT83190.1| hypothetical protein ACN70_21580 [Escherichia coli]
gb|OKT87769.1| hypothetical protein ACN75_18955 [Escherichia coli]
gb|OKT96229.1| hypothetical protein ACN72_17750 [Escherichia coli]
gb|OKT99210.1| hypothetical protein ACN74_23485 [Escherichia coli]
gb|OKU07790.1| hypothetical protein ACN77_24290 [Escherichia coli]
gb|OKU10744.1| hypothetical protein ACN80_02965 [Escherichia coli]
gb|OKU12974.1| hypothetical protein ACN81_27685 [Escherichia coli]
gb|OKU22053.1| hypothetical protein ACN76_08920 [Escherichia coli]
gb|OKU25712.1| hypothetical protein ACN78_14805 [Escherichia coli]
gb|OKU39470.1| hypothetical protein ACN79_13255 [Escherichia coli]
gb|OKU40079.1| hypothetical protein ACN84_08045 [Escherichia coli]
gb|OKU41461.1| hypothetical protein ACN83_14840 [Escherichia coli]
gb|OKU45332.1| hypothetical protein ACN86_27760 [Escherichia coli]
gb|OKU51756.1| hypothetical protein ACN82_21015 [Escherichia coli]
gb|OKU59920.1| hypothetical protein ACN85_16695 [Escherichia coli]
gb|OKU61945.1| hypothetical protein ACN88_19530 [Escherichia coli]
gb|OKU64492.1| hypothetical protein AWP45_27635 [Escherichia coli]
gb|OKU72482.1| hypothetical protein AWP48_22520 [Escherichia coli]
gb|OKU77676.1| hypothetical protein AWJ24_15080 [Escherichia coli]
gb|OKU83251.1| hypothetical protein AWP50_21260 [Escherichia coli]
gb|OKU90319.1| hypothetical protein AWP46_24845 [Escherichia coli]
gb|OKV00827.1| hypothetical protein AWP53_11390 [Escherichia coli]
gb|OKV01481.1| hypothetical protein ACN87_02825 [Escherichia coli]
gb|OKV06007.1| hypothetical protein AWP52_24905 [Escherichia coli]
gb|OKV06075.1| hypothetical protein AWP47_23645 [Escherichia coli]
gb|OKV09615.1| hypothetical protein AWP51_26095 [Escherichia coli]
gb|OKV21870.1| hypothetical protein AWP54_16090 [Escherichia coli]
gb|OKV38638.1| hypothetical protein AWP49_00415 [Escherichia coli]
gb|OKV38955.1| hypothetical protein AWP55_02025 [Escherichia coli]
gb|OKV40082.1| hypothetical protein AWP56_06895 [Escherichia coli]
gb|OKV40895.1| hypothetical protein AWP59_29180 [Escherichia coli]
gb|OKV45134.1| hypothetical protein AWP58_19955 [Escherichia coli]
gb|OKV52044.1| hypothetical protein AWP62_17060 [Escherichia coli]
gb|OKV59526.1| hypothetical protein AWP63_22800 [Escherichia coli]
gb|OKV61764.1| hypothetical protein AWP61_19515 [Escherichia coli]
gb|OKV65218.1| hypothetical protein AWP57_22525 [Escherichia coli]
gb|OKV78556.1| hypothetical protein AWP64_21640 [Escherichia coli]
gb|OKV84626.1| hypothetical protein AWP66_13460 [Escherichia coli]
gb|OKV92108.1| hypothetical protein AWP67_06905 [Escherichia coli]
gb|OKV99213.1| hypothetical protein AWP65_14075 [Escherichia coli]
gb|OKW02401.1| hypothetical protein AWP69_15030 [Escherichia coli]
gb|OKW07624.1| hypothetical protein AWP68_06755 [Escherichia coli]
gb|OKW14316.1| hypothetical protein AWP70_24120 [Escherichia coli]
gb|OKW16234.1| hypothetical protein AWP72_12270 [Escherichia coli]
gb|OKW23102.1| hypothetical protein AWP75_04600 [Escherichia coli]
gb|OKW27966.1| hypothetical protein AWP74_22180 [Escherichia coli]
gb|OKW33453.1| hypothetical protein AWP71_08470 [Escherichia coli]
gb|OKW44715.1| hypothetical protein AWP78_16225 [Escherichia coli]
gb|OKW46177.1| hypothetical protein AWP79_15100 [Escherichia coli]
gb|OKW59911.1| hypothetical protein AWP83_16265 [Escherichia coli]
gb|OKW73243.1| hypothetical protein AWP84_15570 [Escherichia coli]
gb|OKW73351.1| hypothetical protein AWP73_03970 [Escherichia coli]
gb|OKW77115.1| hypothetical protein AWP81_27770 [Escherichia coli]
gb|OKW81998.1| hypothetical protein AWP85_15135 [Escherichia coli]
gb|OKW90163.1| hypothetical protein AWP88_17585 [Escherichia coli]
gb|OKW97259.1| hypothetical protein AWP87_15560 [Escherichia coli]
gb|OKX02062.1| hypothetical protein AWP80_08560 [Escherichia coli]
gb|OKX06143.1| hypothetical protein AWP93_26785 [Escherichia coli]
gb|OKX13257.1| hypothetical protein AWP89_02480 [Escherichia coli]
gb|OKX17908.1| hypothetical protein AWP86_10750 [Escherichia coli]
gb|OKX18879.1| hypothetical protein AWP96_25510 [Escherichia coli]
gb|OKX23345.1| hypothetical protein AWP90_17645 [Escherichia coli]
gb|OKX30262.1| hypothetical protein AWP91_27910 [Escherichia coli]
gb|OKX36471.1| hypothetical protein AWP92_21780 [Escherichia coli]
gb|OKX37250.1| hypothetical protein AWQ00_16820 [Escherichia coli]
gb|OKX50642.1| hypothetical protein AWP97_15740 [Escherichia coli]
gb|OKX52049.1| hypothetical protein AWP99_17650 [Escherichia coli]
gb|OKX64506.1| hypothetical protein AWP98_19265 [Escherichia coli]
gb|OKX69292.1| hypothetical protein AWP94_00700 [Escherichia coli]
gb|OKX75054.1| hypothetical protein AWP95_04910 [Escherichia coli]
gb|APQ19666.1| hypothetical protein BTD92_00250 [Escherichia coli]
gb|OLL68051.1| hypothetical protein BSK24_09070 [Escherichia coli]
gb|APT00749.1| hypothetical protein BJJ90_01330 [Escherichia coli]
gb|OLN79467.1| hypothetical protein UG47_08135 [Escherichia coli]
gb|OLO94977.1| hypothetical protein BHG39_22860 [Escherichia coli]
gb|APT60508.1| protein DcrB [Escherichia coli]
gb|OLR85906.1| hypothetical protein BUE81_18435 [Escherichia coli]
gb|OLS69150.1| hypothetical protein BJD19_20145 [Escherichia coli]
gb|OLS75699.1| hypothetical protein BJG07_09735 [Escherichia coli]
gb|OLS76197.1| hypothetical protein BJG04_10385 [Escherichia coli]
gb|OLS82687.1| hypothetical protein BJG06_21010 [Escherichia coli]
gb|OLS89555.1| hypothetical protein BJG05_12320 [Escherichia coli]
gb|OLS95389.1| hypothetical protein BJG03_06485 [Escherichia coli]
gb|OLT03524.1| hypothetical protein BJG08_07300 [Escherichia coli]
gb|OLY57253.1| hypothetical protein BM748_007655 [Escherichia coli]
gb|OLY88614.1| hypothetical protein A8O33_11860 [Escherichia coli O157:H43]
gb|OMG96164.1| protein DcrB [Escherichia coli]
gb|OMH01562.1| protein DcrB [Escherichia coli]
gb|OMH02568.1| protein DcrB [Escherichia coli]
gb|APW92604.1| protein DcrB [Escherichia coli]
gb|OMI45220.1| hypothetical protein MP33_07190 [Escherichia coli N37058PS]
gb|OMI46787.1| hypothetical protein MP34_21820 [Escherichia coli N37122PS]
gb|OMI57683.1| hypothetical protein Q676_06165 [Escherichia coli N40607]
gb|OMI63258.1| hypothetical protein MP32_23565 [Escherichia coli N36410PS]
gb|OMI64267.1| hypothetical protein EP55_21245 [Escherichia coli N37139PS]
gb|OMI73696.1| hypothetical protein MP31_07690 [Escherichia coli N36254PS]
emb|SIX00361.1| Uncharacterised protein [Shigella sonnei]
emb|SIW91186.1| Uncharacterised protein [Shigella sonnei]
emb|SJC66060.1| Uncharacterised protein [Shigella sonnei]
emb|SJC06266.1| Uncharacterised protein [Shigella sonnei]
emb|SJB07294.1| Uncharacterised protein [Shigella sonnei]
emb|SJB91916.1| Uncharacterised protein [Shigella sonnei]
emb|SIW99785.1| Uncharacterised protein [Shigella sonnei]
emb|SJI38620.1| Uncharacterised protein [Shigella sonnei]
emb|SIX30494.1| Uncharacterised protein [Shigella sonnei]
emb|SJH24648.1| Uncharacterised protein [Shigella sonnei]
emb|SJC49871.1| Uncharacterised protein [Shigella sonnei]
emb|SJB21005.1| Uncharacterised protein [Shigella sonnei]
emb|SJC23232.1| Uncharacterised protein [Shigella sonnei]
emb|SJC23485.1| Uncharacterised protein [Shigella sonnei]
emb|SIW89291.1| Uncharacterised protein [Shigella sonnei]
emb|SJA87410.1| Uncharacterised protein [Shigella sonnei]
emb|SJB67276.1| Uncharacterised protein [Shigella sonnei]
emb|SJC02270.1| Uncharacterised protein [Shigella sonnei]
emb|SJB56089.1| Uncharacterised protein [Shigella sonnei]
emb|SJB16755.1| Uncharacterised protein [Shigella sonnei]
emb|SIX00496.1| Uncharacterised protein [Shigella sonnei]
emb|SJB68448.1| Uncharacterised protein [Shigella sonnei]
emb|SJA90586.1| Uncharacterised protein [Shigella sonnei]
emb|SIW83899.1| Uncharacterised protein [Shigella sonnei]
emb|SJI03962.1| Uncharacterised protein [Shigella sonnei]
emb|SIW84979.1| Uncharacterised protein [Shigella sonnei]
emb|SJH06649.1| Uncharacterised protein [Shigella sonnei]
emb|SJA48268.1| Uncharacterised protein [Shigella sonnei]
emb|SJH63743.1| Uncharacterised protein [Shigella sonnei]
emb|SJA82386.1| Uncharacterised protein [Shigella sonnei]
emb|SJH18776.1| Uncharacterised protein [Shigella sonnei]
emb|SIW79255.1| Uncharacterised protein [Shigella sonnei]
emb|SJH19907.1| Uncharacterised protein [Shigella sonnei]
emb|SJA85998.1| Uncharacterised protein [Shigella sonnei]
emb|SJA78303.1| Uncharacterised protein [Shigella sonnei]
emb|SJB11232.1| Uncharacterised protein [Shigella sonnei]
emb|SJB13631.1| Uncharacterised protein [Shigella sonnei]
emb|SJB22621.1| Uncharacterised protein [Shigella sonnei]
emb|SJB31639.1| Uncharacterised protein [Shigella sonnei]
emb|SJH93599.1| Uncharacterised protein [Shigella sonnei]
emb|SJB91998.1| Uncharacterised protein [Shigella sonnei]
emb|SJA76473.1| Uncharacterised protein [Shigella sonnei]
emb|SJH90776.1| Uncharacterised protein [Shigella sonnei]
emb|SIW87186.1| Uncharacterised protein [Shigella sonnei]
emb|SJB15865.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ01677.1| Uncharacterised protein [Shigella sonnei]
emb|SIW68558.1| Uncharacterised protein [Shigella sonnei]
emb|SIW74977.1| Uncharacterised protein [Shigella sonnei]
emb|SIW98197.1| Uncharacterised protein [Shigella sonnei]
emb|SIX11714.1| Uncharacterised protein [Shigella sonnei]
emb|SIW69733.1| Uncharacterised protein [Shigella sonnei]
emb|SJI78436.1| Uncharacterised protein [Shigella sonnei]
emb|SJH68982.1| Uncharacterised protein [Shigella sonnei]
emb|SIW76070.1| Uncharacterised protein [Shigella sonnei]
emb|SJA17973.1| Uncharacterised protein [Shigella sonnei]
emb|SJA28385.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ08827.1| Uncharacterised protein [Shigella sonnei]
emb|SJC64396.1| Uncharacterised protein [Shigella sonnei]
emb|SIX40437.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ78606.1| Uncharacterised protein [Shigella sonnei]
emb|SJG19783.1| Uncharacterised protein [Shigella sonnei]
emb|SJH64049.1| Uncharacterised protein [Shigella sonnei]
emb|SJF37422.1| Uncharacterised protein [Shigella sonnei]
emb|SJH68852.1| Uncharacterised protein [Shigella sonnei]
emb|SIW91876.1| Uncharacterised protein [Shigella sonnei]
emb|SJA76696.1| Uncharacterised protein [Shigella sonnei]
emb|SJH45159.1| Uncharacterised protein [Shigella sonnei]
emb|SJH65206.1| Uncharacterised protein [Shigella sonnei]
emb|SJG97028.1| Uncharacterised protein [Shigella sonnei]
emb|SIW68656.1| Uncharacterised protein [Shigella sonnei]
emb|SJA61526.1| Uncharacterised protein [Shigella sonnei]
emb|SJF99481.1| Uncharacterised protein [Shigella sonnei]
emb|SJH65447.1| Uncharacterised protein [Shigella sonnei]
emb|SJC45006.1| Uncharacterised protein [Shigella sonnei]
emb|SJC09942.1| Uncharacterised protein [Shigella sonnei]
emb|SJB06099.1| Uncharacterised protein [Shigella sonnei]
emb|SJG10737.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ99774.1| Uncharacterised protein [Shigella sonnei]
emb|SJG19810.1| Uncharacterised protein [Shigella sonnei]
emb|SJG64247.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ04830.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ71863.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ66434.1| Uncharacterised protein [Shigella sonnei]
emb|SIW64714.1| Uncharacterised protein [Shigella sonnei]
emb|SJF85357.1| Uncharacterised protein [Shigella sonnei]
emb|SJA04059.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ16357.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ79946.1| Uncharacterised protein [Shigella sonnei]
emb|SJG03360.1| Uncharacterised protein [Shigella sonnei]
emb|SJG53165.1| Uncharacterised protein [Shigella sonnei]
emb|SIY96682.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ29900.1| Uncharacterised protein [Shigella sonnei]
emb|SJK25877.1| Uncharacterised protein [Shigella sonnei]
emb|SJA10360.1| Uncharacterised protein [Shigella sonnei]
emb|SJA92240.1| Uncharacterised protein [Shigella sonnei]
emb|SIY80946.1| Uncharacterised protein [Shigella sonnei]
emb|SJA87605.1| Uncharacterised protein [Shigella sonnei]
emb|SJE93605.1| Uncharacterised protein [Shigella sonnei]
emb|SIW99977.1| Uncharacterised protein [Shigella sonnei]
emb|SIW85301.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ28932.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ89454.1| Uncharacterised protein [Shigella sonnei]
emb|SJH10019.1| Uncharacterised protein [Shigella sonnei]
emb|SJI05347.1| Uncharacterised protein [Shigella sonnei]
emb|SIW84463.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ85418.1| Uncharacterised protein [Shigella sonnei]
emb|SIW77037.1| Uncharacterised protein [Shigella sonnei]
emb|SJH90284.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ01921.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ32358.1| Uncharacterised protein [Shigella sonnei]
emb|SIW93152.1| Uncharacterised protein [Shigella sonnei]
emb|SJB05580.1| Uncharacterised protein [Shigella sonnei]
emb|SJG64964.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ01801.1| Uncharacterised protein [Shigella sonnei]
emb|SJG69725.1| Uncharacterised protein [Shigella sonnei]
emb|SJK27005.1| Uncharacterised protein [Shigella sonnei]
emb|SIY18914.1| Uncharacterised protein [Shigella sonnei]
emb|SIW75736.1| Uncharacterised protein [Shigella sonnei]
emb|SJH96712.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ75954.1| Uncharacterised protein [Shigella sonnei]
emb|SJK24479.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ82757.1| Uncharacterised protein [Shigella sonnei]
emb|SIY77071.1| Uncharacterised protein [Shigella sonnei]
emb|SIW97682.1| Uncharacterised protein [Shigella sonnei]
emb|SIY96017.1| Uncharacterised protein [Shigella sonnei]
emb|SJI59988.1| Uncharacterised protein [Shigella sonnei]
emb|SIX30142.1| Uncharacterised protein [Shigella sonnei]
emb|SJI34495.1| Uncharacterised protein [Shigella sonnei]
emb|SJI06155.1| Uncharacterised protein [Shigella sonnei]
emb|SJI08312.1| Uncharacterised protein [Shigella sonnei]
emb|SIW68311.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ28346.1| Uncharacterised protein [Shigella sonnei]
emb|SIY87751.1| Uncharacterised protein [Shigella sonnei]
emb|SJI15979.1| Uncharacterised protein [Shigella sonnei]
emb|SIW96229.1| Uncharacterised protein [Shigella sonnei]
emb|SJF63350.1| Uncharacterised protein [Shigella sonnei]
emb|SIY73721.1| Uncharacterised protein [Shigella sonnei]
emb|SJA92002.1| Uncharacterised protein [Shigella sonnei]
emb|SIY91083.1| Uncharacterised protein [Shigella sonnei]
emb|SJA83602.1| Uncharacterised protein [Shigella sonnei]
emb|SIX21838.1| Uncharacterised protein [Shigella sonnei]
emb|SJB92138.1| Uncharacterised protein [Shigella sonnei]
emb|SIY96526.1| Uncharacterised protein [Shigella sonnei]
emb|SJH94302.1| Uncharacterised protein [Shigella sonnei]
emb|SJG78241.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ33787.1| Uncharacterised protein [Shigella sonnei]
emb|SIW73411.1| Uncharacterised protein [Shigella sonnei]
emb|SJK08736.1| Uncharacterised protein [Shigella sonnei]
emb|SJH93336.1| Uncharacterised protein [Shigella sonnei]
emb|SIW67956.1| Uncharacterised protein [Shigella sonnei]
emb|SJI68833.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ25601.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ08977.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ10384.1| Uncharacterised protein [Shigella sonnei]
emb|SIW62866.1| Uncharacterised protein [Shigella sonnei]
emb|SIW78233.1| Uncharacterised protein [Shigella sonnei]
emb|SJH70411.1| Uncharacterised protein [Shigella sonnei]
emb|SJI50899.1| Uncharacterised protein [Shigella sonnei]
emb|SJA72352.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ27619.1| Uncharacterised protein [Shigella sonnei]
emb|SJI68651.1| Uncharacterised protein [Shigella sonnei]
emb|SJG36829.1| Uncharacterised protein [Shigella sonnei]
emb|SJI72041.1| Uncharacterised protein [Shigella sonnei]
emb|SJA45683.1| Uncharacterised protein [Shigella sonnei]
emb|SJA64658.1| Uncharacterised protein [Shigella sonnei]
emb|SIW66933.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ01749.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ69521.1| Uncharacterised protein [Shigella sonnei]
emb|SIX22356.1| Uncharacterised protein [Shigella sonnei]
emb|SIW69804.1| Uncharacterised protein [Shigella sonnei]
emb|SJF99323.1| Uncharacterised protein [Shigella sonnei]
emb|SIW64131.1| Uncharacterised protein [Shigella sonnei]
emb|SJI38792.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ14112.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ34632.1| Uncharacterised protein [Shigella sonnei]
emb|SJG17741.1| Uncharacterised protein [Shigella sonnei]
emb|SJI35442.1| Uncharacterised protein [Shigella sonnei]
emb|SIY72110.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ86410.1| Uncharacterised protein [Shigella sonnei]
emb|SJH60187.1| Uncharacterised protein [Shigella sonnei]
emb|SJB54703.1| Uncharacterised protein [Shigella sonnei]
emb|SIY76544.1| Uncharacterised protein [Shigella sonnei]
emb|SIW64265.1| Uncharacterised protein [Shigella sonnei]
emb|SIW97540.1| Uncharacterised protein [Shigella sonnei]
emb|SJE41806.1| Uncharacterised protein [Shigella sonnei]
emb|SJI34016.1| Uncharacterised protein [Shigella sonnei]
emb|SIY86657.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ25238.1| Uncharacterised protein [Shigella sonnei]
emb|SJK05577.1| Uncharacterised protein [Shigella sonnei]
emb|SJE81580.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ81153.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ31849.1| Uncharacterised protein [Shigella sonnei]
emb|SJA35189.1| Uncharacterised protein [Shigella sonnei]
emb|SJI03526.1| Uncharacterised protein [Shigella sonnei]
emb|SJI54178.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ77077.1| Uncharacterised protein [Shigella sonnei]
emb|SIX31479.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ38530.1| Uncharacterised protein [Shigella sonnei]
emb|SIY93248.1| Uncharacterised protein [Shigella sonnei]
emb|SJG44989.1| Uncharacterised protein [Shigella sonnei]
emb|SJA05038.1| Uncharacterised protein [Shigella sonnei]
emb|SIY79133.1| Uncharacterised protein [Shigella sonnei]
emb|SJG18243.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ33379.1| Uncharacterised protein [Shigella sonnei]
emb|SJH72740.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ08859.1| Uncharacterised protein [Shigella sonnei]
emb|SJF70592.1| Uncharacterised protein [Shigella sonnei]
emb|SJA36735.1| Uncharacterised protein [Shigella sonnei]
emb|SJA83010.1| Uncharacterised protein [Shigella sonnei]
emb|SJA97187.1| Uncharacterised protein [Shigella sonnei]
emb|SJI79757.1| Uncharacterised protein [Shigella sonnei]
emb|SJE61385.1| Uncharacterised protein [Shigella sonnei]
emb|SJI32908.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ56241.1| Uncharacterised protein [Shigella sonnei]
emb|SJF58040.1| Uncharacterised protein [Shigella sonnei]
emb|SJF26492.1| Uncharacterised protein [Shigella sonnei]
emb|SJC79741.1| Uncharacterised protein [Shigella sonnei]
emb|SJE79215.1| Uncharacterised protein [Shigella sonnei]
emb|SJE84889.1| Uncharacterised protein [Shigella sonnei]
emb|SJF74003.1| Uncharacterised protein [Shigella sonnei]
emb|SJA21828.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ18818.1| Uncharacterised protein [Shigella sonnei]
emb|SJI40307.1| Uncharacterised protein [Shigella sonnei]
emb|SJB71256.1| Uncharacterised protein [Shigella sonnei]
emb|SJF26736.1| Uncharacterised protein [Shigella sonnei]
emb|SJE70499.1| Uncharacterised protein [Shigella sonnei]
emb|SJB73446.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ57835.1| Uncharacterised protein [Shigella sonnei]
emb|SJI74657.1| Uncharacterised protein [Shigella sonnei]
emb|SIZ11639.1| Uncharacterised protein [Shigella sonnei]
emb|SJF53005.1| Uncharacterised protein [Shigella sonnei]
emb|SJF76736.1| Uncharacterised protein [Shigella sonnei]
emb|SJE67041.1| Uncharacterised protein [Shigella sonnei]
emb|SJA87895.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ48694.1| Uncharacterised protein [Shigella sonnei]
emb|SIW72871.1| Uncharacterised protein [Shigella sonnei]
emb|SJG30440.1| Uncharacterised protein [Shigella sonnei]
emb|SJE04073.1| Uncharacterised protein [Shigella sonnei]
emb|SJE50678.1| Uncharacterised protein [Shigella sonnei]
emb|SJE74843.1| Uncharacterised protein [Shigella sonnei]
emb|SJF59820.1| Uncharacterised protein [Shigella sonnei]
emb|SJF25111.1| Uncharacterised protein [Shigella sonnei]
emb|SJA63444.1| Uncharacterised protein [Shigella sonnei]
emb|SJK24724.1| Uncharacterised protein [Shigella sonnei]
emb|SIX10104.1| Uncharacterised protein [Shigella sonnei]
emb|SJC97168.1| Uncharacterised protein [Shigella sonnei]
emb|SIW67476.1| Uncharacterised protein [Shigella sonnei]
emb|SJB44787.1| Uncharacterised protein [Shigella sonnei]
emb|SIX30321.1| Uncharacterised protein [Shigella sonnei]
emb|SJE82887.1| Uncharacterised protein [Shigella sonnei]
emb|SIX06390.1| Uncharacterised protein [Shigella sonnei]
emb|SJD17369.1| Uncharacterised protein [Shigella sonnei]
emb|SJF68781.1| Uncharacterised protein [Shigella sonnei]
emb|SJE60739.1| Uncharacterised protein [Shigella sonnei]
emb|SJF44850.1| Uncharacterised protein [Shigella sonnei]
emb|SJF91903.1| Uncharacterised protein [Shigella sonnei]
emb|SIY71433.1| Uncharacterised protein [Shigella sonnei]
emb|SJI02729.1| Uncharacterised protein [Shigella sonnei]
emb|SJF63339.1| Uncharacterised protein [Shigella sonnei]
emb|SJD57134.1| Uncharacterised protein [Shigella sonnei]
emb|SIY99394.1| Uncharacterised protein [Shigella sonnei]
emb|SJD14685.1| Uncharacterised protein [Shigella sonnei]
emb|SJF95491.1| Uncharacterised protein [Shigella sonnei]
emb|SJD33947.1| Uncharacterised protein [Shigella sonnei]
emb|SJF25422.1| Uncharacterised protein [Shigella sonnei]
emb|SJE39872.1| Uncharacterised protein [Shigella sonnei]
emb|SJD21391.1| Uncharacterised protein [Shigella sonnei]
emb|SJD26976.1| Uncharacterised protein [Shigella sonnei]
emb|SJE21927.1| Uncharacterised protein [Shigella sonnei]
emb|SJF77413.1| Uncharacterised protein [Shigella sonnei]
emb|SIW70151.1| Uncharacterised protein [Shigella sonnei]
emb|SJF31820.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ60030.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ62543.1| Uncharacterised protein [Shigella sonnei]
emb|SIY89010.1| Uncharacterised protein [Shigella sonnei]
emb|SJF45877.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ77115.1| Uncharacterised protein [Shigella sonnei]
emb|SJD16399.1| Uncharacterised protein [Shigella sonnei]
emb|SJD15851.1| Uncharacterised protein [Shigella sonnei]
emb|SJC95697.1| Uncharacterised protein [Shigella sonnei]
emb|SJD99435.1| Uncharacterised protein [Shigella sonnei]
emb|SJC74239.1| Uncharacterised protein [Shigella sonnei]
emb|SJC66083.1| Uncharacterised protein [Shigella sonnei]
emb|SJC39979.1| Uncharacterised protein [Shigella sonnei]
emb|SJC80903.1| Uncharacterised protein [Shigella sonnei]
emb|SJE15574.1| Uncharacterised protein [Shigella sonnei]
emb|SJC76086.1| Uncharacterised protein [Shigella sonnei]
emb|SJC79417.1| Uncharacterised protein [Shigella sonnei]
emb|SJD90465.1| Uncharacterised protein [Shigella sonnei]
emb|SJE76847.1| Uncharacterised protein [Shigella sonnei]
emb|SJE47422.1| Uncharacterised protein [Shigella sonnei]
emb|SJF26495.1| Uncharacterised protein [Shigella sonnei]
emb|SJD15991.1| Uncharacterised protein [Shigella sonnei]
emb|SJE02631.1| Uncharacterised protein [Shigella sonnei]
emb|SJC63207.1| Uncharacterised protein [Shigella sonnei]
emb|SJE12400.1| Uncharacterised protein [Shigella sonnei]
emb|SJD58781.1| Uncharacterised protein [Shigella sonnei]
emb|SJD93890.1| Uncharacterised protein [Shigella sonnei]
emb|SJE07948.1| Uncharacterised protein [Shigella sonnei]
emb|SJD96312.1| Uncharacterised protein [Shigella sonnei]
emb|SJC88571.1| Uncharacterised protein [Shigella sonnei]
emb|SJJ76868.1| Uncharacterised protein [Shigella sonnei]
emb|SJD34502.1| Uncharacterised protein [Shigella sonnei]
emb|SJC83958.1| Uncharacterised protein [Shigella sonnei]
emb|SJC86342.1| Uncharacterised protein [Shigella sonnei]
emb|SJC79129.1| Uncharacterised protein [Shigella sonnei]
emb|SJD97223.1| Uncharacterised protein [Shigella sonnei]
emb|SJC96725.1| Uncharacterised protein [Shigella sonnei]
emb|SJD67999.1| Uncharacterised protein [Shigella sonnei]
emb|SJE06166.1| Uncharacterised protein [Shigella sonnei]
gb|ONF84765.1| protein DcrB [Escherichia coli]
gb|ONG03382.1| protein DcrB [Escherichia coli]
gb|ONG20591.1| protein DcrB [Escherichia coli]
gb|ONG27068.1| protein DcrB [Escherichia coli]
gb|ONG29760.1| protein DcrB [Escherichia coli]
emb|SJK90378.1| periplasmic protein [Escherichia coli]
gb|ONK37418.1| protein DcrB [Escherichia coli]
gb|ONK43126.1| protein DcrB [Escherichia coli]
gb|ONK54699.1| hypothetical protein BET08_31715 [Escherichia coli]
emb|SJL92872.1| Uncharacterised protein [Shigella sonnei]
emb|SJL93871.1| Uncharacterised protein [Shigella sonnei]
emb|SJL89320.1| Uncharacterised protein [Shigella sonnei]
emb|SJL90732.1| Uncharacterised protein [Shigella sonnei]
emb|SJL93083.1| Uncharacterised protein [Shigella sonnei]
emb|SJL93251.1| Uncharacterised protein [Shigella sonnei]
gb|ONN29239.1| hypothetical protein AYC64_18850 [Escherichia coli]
emb|SJM20813.1| Uncharacterised protein [Shigella sonnei]
gb|OOC68863.1| protein DcrB [Escherichia coli]
gb|OOC85877.1| protein DcrB [Escherichia coli]
gb|OOD54462.1| protein DcrB [Escherichia coli]
gb|AQP93371.1| protein DcrB [Escherichia coli]
gb|OOG30006.1| protein DcrB [Escherichia coli]
gb|OOH57340.1| hypothetical protein BMT64_24585 [Escherichia coli]
gb|OOH69587.1| hypothetical protein BMU01_13910 [Escherichia coli]
gb|OOH95894.1| hypothetical protein BMT63_04030 [Escherichia coli]
gb|OOI23248.1| hypothetical protein BMT98_03130 [Escherichia coli]
gb|OOI39980.1| hypothetical protein BMT61_04525 [Escherichia coli]
gb|OOI43613.1| hypothetical protein BMT62_13590 [Escherichia coli]
gb|OOI48258.1| hypothetical protein BMU06_11845 [Escherichia coli]
gb|OOI59109.1| hypothetical protein BMT75_03485 [Escherichia coli]
gb|OOI62506.1| hypothetical protein BMT59_13040 [Escherichia coli]
gb|OOI68568.1| hypothetical protein BMT66_14515 [Escherichia coli]
gb|OOI72163.1| hypothetical protein BMU02_05860 [Escherichia coli]
gb|OOI78697.1| hypothetical protein BMU05_08930 [Escherichia coli]
gb|OOI92431.1| hypothetical protein BMT56_07930 [Escherichia coli]
gb|OOI98254.1| hypothetical protein BMT76_06650 [Escherichia coli]
gb|OOJ04331.1| hypothetical protein BMT94_18800 [Escherichia coli]
gb|OOJ04391.1| hypothetical protein BMT74_04700 [Escherichia coli]
gb|OOJ12636.1| hypothetical protein BMT73_03690 [Escherichia coli]
gb|OOJ20028.1| hypothetical protein BMU00_04355 [Escherichia coli]
gb|OOJ22759.1| hypothetical protein BMT97_05665 [Escherichia coli]
gb|OOJ37250.1| hypothetical protein BMT96_02725 [Escherichia coli]
gb|OOJ51143.1| hypothetical protein BMT77_06650 [Escherichia coli]
gb|OOJ52740.1| hypothetical protein BMT72_03480 [Escherichia coli]
gb|OOJ55667.1| hypothetical protein BMT70_18335 [Escherichia coli]
gb|OOJ66273.1| hypothetical protein BMT71_14570 [Escherichia coli]
gb|OOJ75401.1| hypothetical protein BMT68_09050 [Escherichia coli]
gb|OOJ82033.1| hypothetical protein BMT58_07175 [Escherichia coli]
gb|OOJ83995.1| hypothetical protein BMU04_17730 [Escherichia coli]
gb|OOJ90388.1| hypothetical protein BMU03_12140 [Escherichia coli]
gb|OOK03194.1| hypothetical protein BMT93_18815 [Escherichia coli]
gb|OOK14655.1| hypothetical protein BMT69_10570 [Escherichia coli]
gb|OOK31067.1| hypothetical protein BMT91_04000 [Escherichia coli]
gb|OOK36188.1| hypothetical protein BMT67_04070 [Escherichia coli]
gb|OOK37162.1| hypothetical protein BMT99_05890 [Escherichia coli]
gb|OOK50090.1| hypothetical protein BMT95_18465 [Escherichia coli]
gb|OOM85470.1| protein DcrB [Escherichia coli]
gb|OON73108.1| protein DcrB [Escherichia coli]
gb|AQU01227.1| protein DcrB [Escherichia coli]
gb|OOO83784.1| protein DcrB [Shigella sonnei]
gb|OOO85102.1| protein DcrB [Shigella boydii]
gb|OOP02219.1| protein DcrB [Shigella flexneri]
gb|OOP07885.1| protein DcrB [Shigella flexneri]
gb|OOP10558.1| protein DcrB [Shigella flexneri]
gb|OOP16653.1| protein DcrB [Shigella flexneri]
gb|OOP25891.1| protein DcrB [Shigella flexneri]
gb|OOP31615.1| protein DcrB [Shigella flexneri]
gb|OOP36280.1| protein DcrB [Shigella sonnei]
gb|OOP40706.1| protein DcrB [Shigella flexneri]
gb|AQV18565.1| protein DcrB [Escherichia coli]
gb|AQV29583.1| protein DcrB [Escherichia coli]
gb|AQV34870.1| protein DcrB [Escherichia coli]
gb|AQV53857.1| protein DcrB [Escherichia coli]
gb|AQV69158.1| protein DcrB [Escherichia coli]
gb|AQV81416.1| protein DcrB [Escherichia coli]
gb|AQV87923.1| protein DcrB [Escherichia coli]
gb|OOV70695.1| protein DcrB [Escherichia coli]
gb|OOW18978.1| protein DcrB [Escherichia coli]
gb|OOW22889.1| protein DcrB [Escherichia coli]
gb|OOW30793.1| protein DcrB [Escherichia coli]
gb|AQW75144.1| protein DcrB [Escherichia coli M8]
gb|OPH66210.1| protein DcrB [Escherichia coli O157:H7]
gb|OPH70688.1| protein DcrB [Escherichia coli O157:H7]
gb|OPH75017.1| protein DcrB [Escherichia coli O157:H7]
gb|AQZ28691.1| hypothetical protein USML2_06050 [Escherichia coli]
gb|AQZ75365.1| periplasmic protein DcrB [Escherichia coli]
gb|AQZ84329.1| protein DcrB [Escherichia coli]
gb|ARA00443.1| protein DcrB [Escherichia coli]
gb|ARA09843.1| protein DcrB [Escherichia coli]
gb|ARA18220.1| protein DcrB [Escherichia coli]
gb|ARA31255.1| protein DcrB [Escherichia coli]
gb|ARA37344.1| protein DcrB [Escherichia coli]
gb|OQK69532.1| protein DcrB [Shigella sonnei]
gb|ARD53245.1| hypothetical protein BHT24_18995 [Escherichia coli]
gb|ARD78769.1| hypothetical protein AYL54_14075 [Escherichia coli]
gb|ARD82638.1| hypothetical protein AYR48_14070 [Escherichia coli]
gb|ARE45750.1| protein DcrB [Escherichia coli C]
dbj|BAX18010.1| hypothetical protein MRY15117_c36000 [Escherichia coli]
dbj|BAX22886.1| hypothetical protein MRY15131_c35440 [Escherichia coli]
gb|ORD27157.1| protein DcrB [Escherichia coli]
gb|ORD36481.1| protein DcrB [Escherichia coli]
gb|ORD38600.1| protein DcrB [Escherichia coli]
gb|ORD53246.1| protein DcrB [Escherichia coli]
gb|ORD68928.1| protein DcrB [Escherichia coli]
gb|ORD72713.1| protein DcrB [Escherichia coli]
gb|ORD86467.1| protein DcrB [Escherichia coli]
gb|ORD88486.1| protein DcrB [Escherichia coli]
gb|ORE73636.1| protein DcrB [Escherichia coli]
gb|ORE74155.1| protein DcrB [Escherichia coli]
gb|ARH99092.1| putative lipoprotein [Escherichia coli]
gb|ORJ74322.1| protein DcrB [Escherichia coli]
gb|ORR79475.1| protein DcrB [Escherichia coli]
gb|ORR79629.1| protein DcrB [Escherichia coli]
gb|ORR87919.1| protein DcrB [Escherichia coli]
gb|ORR91458.1| protein DcrB [Escherichia coli]
gb|ORR91986.1| protein DcrB [Escherichia coli]
gb|ORS02467.1| protein DcrB [Escherichia coli]
gb|ORS06608.1| protein DcrB [Escherichia coli]
gb|ORS12536.1| protein DcrB [Escherichia coli]
gb|ORS15512.1| protein DcrB [Escherichia coli]
gb|ORS18686.1| protein DcrB [Escherichia coli]
gb|ORS19516.1| protein DcrB [Escherichia coli]
gb|ORS29322.1| protein DcrB [Escherichia coli]
gb|ORS32555.1| protein DcrB [Escherichia coli]
gb|ORS39035.1| protein DcrB [Escherichia coli]
gb|ORS43288.1| protein DcrB [Escherichia coli]
gb|ORS49804.1| protein DcrB [Escherichia coli]
gb|ORS55515.1| protein DcrB [Escherichia coli]
gb|ORS58292.1| protein DcrB [Escherichia coli]
gb|ORS59288.1| protein DcrB [Escherichia coli]
gb|ORS67598.1| protein DcrB [Escherichia coli]
gb|ORS72807.1| protein DcrB [Escherichia coli]
gb|ORS72974.1| protein DcrB [Escherichia coli]
gb|ORS81935.1| protein DcrB [Escherichia coli]
gb|ORS88316.1| protein DcrB [Escherichia coli]
gb|ORS99011.1| protein DcrB [Escherichia coli]
gb|ORS99722.1| protein DcrB [Escherichia coli]
gb|ORT03827.1| protein DcrB [Escherichia coli]
gb|ORT16767.1| protein DcrB [Escherichia coli]
gb|ORT28082.1| protein DcrB [Escherichia coli]
gb|ORT31409.1| protein DcrB [Escherichia coli]
gb|ORT37702.1| protein DcrB [Escherichia coli]
gb|ORT42808.1| protein DcrB [Escherichia coli]
emb|SMB21980.1| DcrB protein precursor [Escherichia coli]
emb|SMB21979.1| DcrB protein precursor [Escherichia coli]
gb|OSB88220.1| protein DcrB [Escherichia coli]
gb|OSB94101.1| protein DcrB [Escherichia coli]
gb|OSC08742.1| protein DcrB [Escherichia coli]
gb|OSC20105.1| protein DcrB [Escherichia coli]
emb|SMH28230.1| protein of unknown function [Escherichia coli]
gb|ARJ94357.1| protein DcrB [Escherichia coli]
gb|OSK02173.1| periplasmic protein [Escherichia coli SHECO001]
gb|OSK10657.1| protein DcrB [Escherichia coli FVEC1465]
gb|OSK23316.1| protein DcrB [Escherichia coli TA144]
gb|OSK24402.1| protein DcrB [Escherichia coli B574]
gb|OSK34442.1| protein DcrB [Escherichia coli E267]
gb|OSK59742.1| protein DcrB [Escherichia coli E560]
gb|OSK61434.1| protein DcrB [Escherichia coli B921]
gb|OSK64831.1| protein DcrB [Escherichia coli E1114]
gb|OSK83408.1| protein DcrB [Escherichia coli B367]
gb|OSK96275.1| protein DcrB [Escherichia coli E1002]
gb|OSL16573.1| protein DcrB [Escherichia coli B175]
gb|OSL22082.1| protein DcrB [Escherichia coli TA255]
gb|OSL68695.1| protein DcrB [Escherichia coli TA054]
gb|OSL69147.1| protein DcrB [Escherichia coli TA008]
gb|OSL81971.1| protein DcrB [Escherichia coli TA249]
gb|OSL88328.1| protein DcrB [Escherichia coli E704]
gb|OSL88624.1| protein DcrB [Escherichia coli T426]
gb|OSL98281.1| protein DcrB [Escherichia coli R424]
gb|OSM87819.1| periplasmic protein [Escherichia coli SHECO003]
gb|OSM92333.1| periplasmic protein [Escherichia coli SHECO002]
gb|OSP29963.1| protein DcrB [Escherichia coli]
gb|ARM41141.1| hypothetical protein AWH44_11295 [Escherichia coli]
gb|OSQ38213.1| protein DcrB [Escherichia coli]
gb|ARM77901.1| protein DcrB [Escherichia coli]
gb|ARQ24333.1| hypothetical protein BMI82_11475 [Escherichia coli]
gb|OTA09990.1| hypothetical protein BCR79_02565 [Escherichia coli]
gb|OTB32868.1| protein DcrB [Escherichia coli]
gb|OTB35249.1| protein DcrB [Escherichia coli]
gb|OTB45564.1| protein DcrB [Escherichia coli]
gb|OTB50091.1| protein DcrB [Escherichia coli]
gb|OTB54618.1| protein DcrB [Escherichia coli]
gb|OTB60884.1| protein DcrB [Escherichia coli]
gb|OTB62073.1| protein DcrB [Escherichia coli]
gb|OTB66834.1| protein DcrB [Escherichia coli]
gb|OTB78514.1| protein DcrB [Escherichia coli]
gb|OTB82727.1| protein DcrB [Escherichia coli]
gb|OTB90453.1| protein DcrB [Escherichia coli]
gb|OTB98604.1| protein DcrB [Escherichia coli]
gb|OTB99433.1| protein DcrB [Escherichia coli]
gb|OTC04886.1| protein DcrB [Escherichia coli]
gb|OTC11873.1| protein DcrB [Escherichia coli]
gb|OTC12749.1| protein DcrB [Escherichia coli]
gb|OTC20680.1| protein DcrB [Escherichia coli]
gb|OTC28783.1| protein DcrB [Escherichia coli]
gb|OTC31614.1| protein DcrB [Escherichia coli]
gb|OTC40777.1| protein DcrB [Escherichia coli]
gb|OTC42965.1| protein DcrB [Escherichia coli]
gb|OTC48011.1| protein DcrB [Escherichia coli]
gb|OTC52667.1| protein DcrB [Escherichia coli]
gb|OTC59374.1| protein DcrB [Escherichia coli]
gb|OTC66062.1| protein DcrB [Escherichia coli]
gb|OTC68781.1| protein DcrB [Escherichia coli]
gb|OTC77594.1| protein DcrB [Escherichia coli]
gb|OTC81190.1| protein DcrB [Escherichia coli]
gb|OTC87273.1| protein DcrB [Escherichia coli]
gb|OTC93324.1| protein DcrB [Escherichia coli]
gb|OTC99582.1| protein DcrB [Escherichia coli]
gb|OTD04367.1| protein DcrB [Escherichia coli]
gb|OTD10891.1| protein DcrB [Escherichia coli]
gb|OTD20538.1| protein DcrB [Escherichia coli]
gb|OTD22075.1| protein DcrB [Escherichia coli]
gb|OTD27642.1| protein DcrB [Escherichia coli]
gb|OTD35988.1| protein DcrB [Escherichia coli]
gb|OTD41296.1| protein DcrB [Escherichia coli]
gb|OTD45881.1| protein DcrB [Escherichia coli]
gb|OTD48075.1| protein DcrB [Escherichia coli]
gb|OTD49891.1| protein DcrB [Escherichia coli]
gb|OTD61282.1| protein DcrB [Escherichia coli]
gb|OTD63080.1| protein DcrB [Escherichia coli]
gb|OTD71038.1| protein DcrB [Escherichia coli]
gb|OTD74703.1| protein DcrB [Escherichia coli]
gb|OTD83136.1| protein DcrB [Escherichia coli]
gb|OTD86104.1| protein DcrB [Escherichia coli]
gb|OTD95289.1| protein DcrB [Escherichia coli]
gb|OTD97050.1| protein DcrB [Escherichia coli]
gb|OTE05685.1| protein DcrB [Escherichia coli]
gb|OTE14045.1| protein DcrB [Escherichia coli]
gb|OTE15209.1| protein DcrB [Escherichia coli]
gb|OTE25555.1| protein DcrB [Escherichia coli]
gb|OTE29026.1| protein DcrB [Escherichia coli]
gb|OTE33561.1| protein DcrB [Escherichia coli]
gb|OTE38511.1| protein DcrB [Escherichia coli]
gb|OTE42615.1| protein DcrB [Escherichia coli]
gb|OTE49000.1| protein DcrB [Escherichia coli]
gb|OTE56152.1| protein DcrB [Escherichia coli]
gb|OTE58147.1| protein DcrB [Escherichia coli]
gb|OTE66573.1| protein DcrB [Escherichia coli]
gb|OTE71385.1| protein DcrB [Escherichia coli]
gb|OTE78617.1| protein DcrB [Escherichia coli]
gb|OTE81121.1| protein DcrB [Escherichia coli]
gb|OTE85514.1| protein DcrB [Escherichia coli]
gb|OTE90573.1| protein DcrB [Escherichia coli]
gb|ARR33201.1| protein DcrB [Escherichia coli]
gb|ARR41099.1| protein DcrB [Shigella sonnei]
gb|ARR58160.1| protein DcrB [Escherichia coli]
gb|OTU92153.1| hypothetical protein BA733_07620 [Escherichia coli]
gb|OTV01739.1| hypothetical protein BA735_05770 [Escherichia coli]
gb|OTV06968.1| hypothetical protein BA734_02485 [Escherichia coli]
gb|OTV09864.1| hypothetical protein BA736_07035 [Escherichia coli]
gb|OTV15048.1| hypothetical protein BA738_06555 [Escherichia coli]
gb|OTV15478.1| hypothetical protein BA737_05180 [Escherichia coli]
gb|OTV36295.1| hypothetical protein BA732_09050 [Escherichia coli]
gb|OTV37806.1| hypothetical protein BA731_05350 [Escherichia coli]
gb|OUD18032.1| protein DcrB [Escherichia coli M4]
gb|ARS05722.1| protein DcrB [Shigella sonnei]
gb|OUF52647.1| protein DcrB [Escherichia coli]
gb|OUF64577.1| protein DcrB [Escherichia coli]
gb|OUF67825.1| protein DcrB [Escherichia coli]
gb|OUF70890.1| protein DcrB [Escherichia coli]
gb|OUF85834.1| protein DcrB [Escherichia coli]
gb|OUF94041.1| protein DcrB [Escherichia coli]
gb|OUF98472.1| protein DcrB [Escherichia coli]
gb|OUG05392.1| protein DcrB [Escherichia coli]
gb|OUG11944.1| protein DcrB [Escherichia coli]
gb|OUJ55279.1| protein DcrB [Escherichia coli]
gb|OUJ81328.1| protein DcrB [Shigella flexneri]
gb|OUJ89830.1| protein DcrB [Escherichia coli]
gb|OUK54733.1| protein DcrB [Escherichia coli]
gb|OUK56601.1| protein DcrB [Escherichia coli]
gb|OUK71227.1| protein DcrB [Escherichia coli]
gb|OUK88789.1| protein DcrB [Escherichia coli]
gb|OUK95725.1| protein DcrB [Escherichia coli]
gb|OUL02265.1| protein DcrB [Escherichia coli]
gb|OUL16805.1| protein DcrB [Escherichia coli]
gb|ART18808.1| hypothetical protein EC95JB1_02852 [Escherichia coli]
gb|ART26588.1| hypothetical protein EC95NR1_02852 [Escherichia coli]
gb|OUP33812.1| protein DcrB [Escherichia coli]
gb|ARV29486.1| hypothetical protein BS635_06380 [Escherichia coli]
gb|ARV34362.1| hypothetical protein BUQ71_06965 [Escherichia coli]
gb|ARV48753.1| protein DcrB [Escherichia coli]
gb|ARV55258.1| protein DcrB [Escherichia coli]
gb|OUZ49752.1| protein DcrB [Shigella flexneri]
gb|OUZ51011.1| protein DcrB [Shigella flexneri]
gb|OUZ54373.1| protein DcrB [Shigella flexneri]
gb|OUZ61831.1| protein DcrB [Shigella sonnei]
gb|OUZ64573.1| protein DcrB [Shigella flexneri]
gb|OUZ68458.1| protein DcrB [Shigella sonnei]
gb|OUZ74658.1| protein DcrB [Shigella flexneri]
gb|OUZ77693.1| protein DcrB [Shigella flexneri]
gb|OUZ91637.1| protein DcrB [Shigella flexneri]
gb|OUZ95461.1| protein DcrB [Shigella sonnei]
gb|OUZ98641.1| protein DcrB [Shigella sonnei]
gb|OVA44869.1| hypothetical protein UP79_06625 [Escherichia coli]
gb|OVA49293.1| hypothetical protein UP76_06995 [Escherichia coli]
gb|OVA51497.1| hypothetical protein UP77_08395 [Escherichia coli]
gb|OVA59155.1| hypothetical protein UP83_08580 [Escherichia coli]
gb|OVA62730.1| hypothetical protein UP86_11830 [Escherichia coli]
gb|OVA67924.1| hypothetical protein UP92_07325 [Escherichia coli]
gb|OVA73902.1| hypothetical protein UP94_07650 [Escherichia coli]
gb|OVA83027.1| hypothetical protein UQ00_10265 [Escherichia coli]
gb|OVA83332.1| hypothetical protein UP98_01515 [Escherichia coli]
gb|OVA90044.1| hypothetical protein UQ01_07875 [Escherichia coli]
gb|OVA97832.1| hypothetical protein UQ04_15210 [Escherichia coli]
gb|OVA99177.1| hypothetical protein UQ02_00680 [Escherichia coli]
gb|OVB08009.1| hypothetical protein UQ05_02970 [Escherichia coli]
gb|OVB16538.1| hypothetical protein UQ06_06480 [Escherichia coli]
gb|OVB17009.1| hypothetical protein UQ07_00680 [Escherichia coli]
gb|OVB24601.1| hypothetical protein UQ11_03955 [Escherichia coli]
gb|OVB26676.1| hypothetical protein UQ16_15710 [Escherichia coli]
gb|OVB32222.1| hypothetical protein UQ12_10760 [Escherichia coli]
gb|OVB40244.1| hypothetical protein UQ20_04485 [Escherichia coli]
gb|OVB43871.1| hypothetical protein UQ26_14170 [Escherichia coli]
gb|OVB50132.1| hypothetical protein UQ27_03905 [Escherichia coli]
gb|OVB54285.1| hypothetical protein UQ38_10485 [Escherichia coli]
gb|OVB58413.1| hypothetical protein UQ42_18910 [Escherichia coli]
gb|OVB65577.1| hypothetical protein UQ43_06780 [Escherichia coli]
gb|OVB73104.1| hypothetical protein UP72_00520 [Escherichia coli]
gb|OVB79253.1| hypothetical protein UP74_00880 [Escherichia coli]
gb|OVB80110.1| hypothetical protein UP75_15300 [Escherichia coli]
gb|OVB88513.1| hypothetical protein UP73_02635 [Escherichia coli]
gb|OVB93029.1| hypothetical protein UP78_07290 [Escherichia coli]
gb|OVB99009.1| hypothetical protein UP80_04675 [Escherichia coli]
gb|OVC02399.1| hypothetical protein UP81_12565 [Escherichia coli]
gb|OVC08378.1| hypothetical protein UP82_11790 [Escherichia coli]
gb|OVC13446.1| hypothetical protein UP84_12080 [Escherichia coli]
gb|OVC21828.1| hypothetical protein UP85_02855 [Escherichia coli]
gb|OVC25851.1| hypothetical protein UP87_06220 [Escherichia coli]
gb|OVC31526.1| hypothetical protein UP88_00615 [Escherichia coli]
gb|OVC34823.1| hypothetical protein UP89_14330 [Escherichia coli]
gb|OVC44175.1| hypothetical protein UP90_03150 [Escherichia coli]
gb|OVC47886.1| hypothetical protein UP91_00940 [Escherichia coli]
gb|OVC50667.1| hypothetical protein UP93_13580 [Escherichia coli]
gb|OVC59031.1| hypothetical protein UP95_06960 [Escherichia coli]
gb|OVC60269.1| hypothetical protein UP96_14925 [Escherichia coli]
gb|OVC67198.1| hypothetical protein UP97_12975 [Escherichia coli]
gb|OVC76306.1| hypothetical protein UP99_03880 [Escherichia coli]
gb|OVC80890.1| hypothetical protein UQ03_00785 [Escherichia coli]
gb|OVC85753.1| hypothetical protein UQ08_01285 [Escherichia coli]
gb|OVC91642.1| hypothetical protein UQ09_12250 [Escherichia coli]
gb|OVC94725.1| hypothetical protein UQ10_06845 [Escherichia coli]
gb|OVD03160.1| hypothetical protein UQ13_02675 [Escherichia coli]
gb|OVD06468.1| hypothetical protein UQ15_13745 [Escherichia coli]
gb|OVD13152.1| hypothetical protein UQ14_01530 [Escherichia coli]
gb|OVD22039.1| hypothetical protein UQ18_11080 [Escherichia coli]
gb|OVD23326.1| hypothetical protein UQ17_01985 [Escherichia coli]
gb|OVD28559.1| hypothetical protein UQ19_03410 [Escherichia coli]
gb|OVD35264.1| hypothetical protein UQ21_08165 [Escherichia coli]
gb|OVD40754.1| hypothetical protein UQ22_05505 [Escherichia coli]
gb|OVD44393.1| hypothetical protein UQ23_05525 [Escherichia coli]
gb|OVD51925.1| hypothetical protein UQ24_09565 [Escherichia coli]
gb|OVD55749.1| hypothetical protein UQ25_08510 [Escherichia coli]
gb|OVD61018.1| hypothetical protein UQ28_04495 [Escherichia coli]
gb|OVD69148.1| hypothetical protein UQ29_02260 [Escherichia coli]
gb|OVD71259.1| hypothetical protein UQ30_06910 [Escherichia coli]
gb|OVD76924.1| hypothetical protein UQ31_06945 [Escherichia coli]
gb|OVD84287.1| hypothetical protein UQ32_08685 [Escherichia coli]
gb|OVD87946.1| hypothetical protein UQ33_03340 [Escherichia coli]
gb|OVD92995.1| hypothetical protein UQ34_07040 [Escherichia coli]
gb|OVD98490.1| hypothetical protein UQ36_20455 [Escherichia coli]
gb|OVE08524.1| hypothetical protein UQ35_00300 [Escherichia coli]
gb|OVE19346.1| hypothetical protein UQ39_20300 [Escherichia coli]
gb|OVE31932.1| hypothetical protein UQ44_01320 [Escherichia coli]
gb|OVE32917.1| hypothetical protein UQ45_05770 [Escherichia coli]
gb|ARW89813.1| protein DcrB [Escherichia coli]
gb|ARW90823.1| protein DcrB [Escherichia coli]
gb|ARX16715.1| protein DcrB [Escherichia coli]
gb|ARX28569.1| protein DcrB [Escherichia coli]
gb|ARX54639.1| protein DcrB [Escherichia coli]
gb|OVJ48923.1| protein DcrB [Escherichia coli]
gb|OVY45149.1| protein DcrB [Escherichia coli]
gb|OWC03894.1| hypothetical protein A8M82_08225 [Escherichia coli]
gb|OWC13047.1| hypothetical protein A8G20_00895 [Escherichia coli]
gb|OWC17937.1| hypothetical protein A8G06_00270 [Escherichia coli]
gb|OWC27026.1| hypothetical protein A8G14_07195 [Escherichia coli]
gb|OWC29316.1| hypothetical protein A8G09_02685 [Escherichia coli]
gb|OWC31022.1| hypothetical protein A8G19_06220 [Escherichia coli]
gb|OWC35537.1| hypothetical protein A8F96_06465 [Escherichia coli]
gb|OWC43478.1| hypothetical protein A8F92_13880 [Escherichia coli]
gb|OWC45996.1| hypothetical protein A8G17_04250 [Escherichia coli]
gb|OWC57427.1| hypothetical protein A8F90_05730 [Escherichia coli]
gb|OWC59628.1| hypothetical protein A8F93_19750 [Escherichia coli]
gb|OWC62581.1| hypothetical protein A8F89_01015 [Escherichia coli]
gb|OWC68465.1| hypothetical protein A8F87_03575 [Escherichia coli]
gb|OWC69224.1| hypothetical protein A8F88_02170 [Escherichia coli]
gb|OWC76963.1| hypothetical protein A8F85_14795 [Escherichia coli]
gb|OWC84183.1| hypothetical protein A8F86_12035 [Escherichia coli]
gb|OWC86780.1| hypothetical protein A8F83_14065 [Escherichia coli]
gb|OWC94501.1| hypothetical protein A8F84_04455 [Escherichia coli]
gb|OWC98276.1| hypothetical protein A8F80_17615 [Escherichia coli]
gb|OWD06219.1| hypothetical protein A8F82_22275 [Escherichia coli]
gb|OWD06711.1| hypothetical protein A8F81_01930 [Escherichia coli]
gb|OWD13188.1| hypothetical protein A8C76_19850 [Escherichia coli]
gb|OWD14245.1| hypothetical protein A8C72_09420 [Escherichia coli]
gb|OWD16284.1| hypothetical protein A8C74_22360 [Escherichia coli]
gb|OWD22146.1| hypothetical protein A8C63_17870 [Escherichia coli]
gb|OWD31486.1| hypothetical protein A8C78_09675 [Escherichia coli]
gb|OWD39775.1| hypothetical protein A8C67_02250 [Escherichia coli]
gb|OWD43512.1| hypothetical protein A8C64_11695 [Escherichia coli]
gb|OWD44039.1| hypothetical protein A8C66_18240 [Escherichia coli]
gb|OWD53455.1| hypothetical protein A8C60_06690 [Escherichia coli]
gb|OWD55364.1| hypothetical protein A8C62_00470 [Escherichia coli]
gb|OWD58397.1| hypothetical protein A8C65_02865 [Escherichia coli]
gb|OWD59737.1| hypothetical protein A8C70_21910 [Escherichia coli]
gb|OWD63039.1| hypothetical protein A8C69_23085 [Escherichia coli]
gb|OWD74113.1| hypothetical protein A8C71_07005 [Escherichia coli]
gb|OWD75445.1| hypothetical protein A8C68_19690 [Escherichia coli]
gb|OWD77706.1| hypothetical protein A8M40_13500 [Escherichia coli]
gb|OWD91363.1| hypothetical protein A8M39_14415 [Escherichia coli]
gb|OWD93816.1| hypothetical protein A8M48_21875 [Escherichia coli]
gb|OWD99155.1| hypothetical protein A8M47_15535 [Escherichia coli]
gb|OWE07389.1| hypothetical protein A8M44_14705 [Escherichia coli]
gb|OWE09637.1| hypothetical protein A8M49_00520 [Escherichia coli]
gb|OWE11468.1| hypothetical protein A8M43_04400 [Escherichia coli]
gb|OWE14449.1| hypothetical protein A8M41_17195 [Escherichia coli]
gb|OWE24238.1| hypothetical protein A8M46_08635 [Escherichia coli]
gb|OWE27695.1| hypothetical protein A8M45_01530 [Escherichia coli]
gb|OWE32854.1| hypothetical protein A8M52_07935 [Escherichia coli]
gb|OWE33658.1| hypothetical protein A8M42_00205 [Escherichia coli]
gb|OWE42697.1| hypothetical protein A8G07_07175 [Escherichia coli]
gb|OWE74953.1| hypothetical protein A8M68_08240 [Escherichia coli]
gb|OWF02491.1| hypothetical protein A8M70_06675 [Escherichia coli]
gb|OWF04278.1| hypothetical protein A8M62_17465 [Escherichia coli]
gb|OWF13512.1| hypothetical protein A8M71_18695 [Escherichia coli]
gb|OWF18854.1| hypothetical protein A8M78_00305 [Escherichia coli]
gb|OWF27582.1| hypothetical protein A8M76_08425 [Escherichia coli]
gb|ARZ84196.1| protein DcrB [Escherichia coli]
gb|ARZ87781.1| protein DcrB [Escherichia coli]
gb|OWG43605.1| protein DcrB [Escherichia coli]
gb|OWG49289.1| protein DcrB [Escherichia coli]
gb|OWG58567.1| protein DcrB [Escherichia coli]
gb|OWG63039.1| protein DcrB [Escherichia coli]
gb|OWG67886.1| protein DcrB [Escherichia coli]
gb|OWG72363.1| protein DcrB [Escherichia coli]
gb|OWG78505.1| protein DcrB [Escherichia coli]
gb|OWG82513.1| protein DcrB [Escherichia coli]
gb|OWG87436.1| protein DcrB [Escherichia coli]
gb|OWG89855.1| protein DcrB [Escherichia coli]
gb|OWG95559.1| protein DcrB [Escherichia coli]
gb|OWH03024.1| protein DcrB [Escherichia coli]
gb|OWH05851.1| protein DcrB [Escherichia coli]
gb|OWH12242.1| protein DcrB [Escherichia coli]
gb|OWH14837.1| protein DcrB [Escherichia coli]
gb|OWH16057.1| protein DcrB [Escherichia coli]
gb|OWH25214.1| protein DcrB [Escherichia coli]
gb|ASA59420.1| protein DcrB [Escherichia coli]
gb|ASA63840.1| protein DcrB [Escherichia coli]
gb|ASB78441.1| protein DcrB [Escherichia coli]
gb|OWQ01163.1| protein DcrB [Escherichia coli]
gb|OWR19259.1| protein DcrB [Shigella boydii]
gb|OWR39551.1| protein DcrB [Escherichia coli]
gb|OWS81497.1| protein DcrB [Escherichia coli]
gb|OWS87160.1| protein DcrB [Escherichia coli]
gb|ASE48281.1| protein DcrB [Escherichia coli O157]
gb|ASF04299.1| protein DcrB [Escherichia coli O104:H4]
gb|ASG47780.1| protein DcrB [Escherichia coli]
gb|OWW48382.1| protein DcrB [Escherichia coli]
gb|OWW53248.1| protein DcrB [Escherichia coli]
gb|OWX89831.1| protein DcrB [Escherichia coli]
gb|OWY56479.1| protein DcrB [Escherichia coli]
gb|ASI14602.1| protein DcrB [Escherichia coli]
gb|ASI48613.1| DcrB protein precursor [Escherichia coli]
gb|ASJ45362.1| hypothetical protein A0U97_22635 [Escherichia coli]
gb|ASL29871.1| protein DcrB [Escherichia coli]
gb|ASL57088.1| DcrB protein precursor [Escherichia coli]
gb|OXJ67509.1| protein DcrB [Escherichia coli]
gb|OXJ71359.1| protein DcrB [Escherichia coli]
gb|OXJ85357.1| protein DcrB [Escherichia coli]
gb|OXK07287.1| protein DcrB [Escherichia coli]
gb|OXK11617.1| protein DcrB [Escherichia coli]
gb|OXK20104.1| protein DcrB [Escherichia coli]
gb|OXK31351.1| protein DcrB [Escherichia coli]
gb|OXK34484.1| protein DcrB [Escherichia coli]
gb|OXK41512.1| protein DcrB [Escherichia coli]
gb|OXK45588.1| protein DcrB [Escherichia coli]
gb|OXK55809.1| protein DcrB [Escherichia coli]
gb|OXK58882.1| protein DcrB [Escherichia coli]
gb|OXK66283.1| protein DcrB [Escherichia coli]
gb|OXK85827.1| protein DcrB [Escherichia coli]
gb|OXK96610.1| protein DcrB [Escherichia coli]
gb|OXL03111.1| protein DcrB [Escherichia coli]
gb|ASN31992.1| protein DcrB [Shigella sonnei]
gb|ASN35599.1| protein DcrB [Shigella sonnei]
gb|ASN42150.1| protein DcrB [Shigella sonnei]
gb|OXL49941.1| protein DcrB [Escherichia coli]
gb|OXL52486.1| hypothetical protein RO13_22775 [Escherichia coli]
gb|OXL58313.1| hypothetical protein OA49_11955 [Escherichia coli]
gb|OXL76515.1| hypothetical protein OA47_02605 [Escherichia coli]
gb|OXL78072.1| hypothetical protein OA51_15700 [Escherichia coli]
gb|ASO02560.1| protein DcrB [Escherichia coli]
gb|ASO77125.1| hypothetical protein AKN40_0289 [Escherichia coli]
gb|ASO85370.1| hypothetical protein AKN41_3782 [Escherichia coli]
gb|ASO94920.1| hypothetical protein AKO64_3803 [Escherichia coli]
gb|ASQ54927.1| protein DcrB [Shigella flexneri 4c]
gb|ASQ58739.1| protein DcrB [Shigella flexneri 4c]
gb|ASQ61504.1| protein DcrB [Shigella flexneri 1a]
gb|ASQ69067.1| Unassigned protein [Escherichia coli NCCP15648]
gb|ASQ80425.1| protein DcrB [Shigella flexneri 1a]
gb|OXV15612.1| protein DcrB [Escherichia coli]
gb|OXV18778.1| protein DcrB [Escherichia coli]
gb|OXV32732.1| protein DcrB [Escherichia coli]
gb|OXV36567.1| protein DcrB [Escherichia coli]
gb|OXV39067.1| protein DcrB [Escherichia coli]
gb|OXW61048.1| protein DcrB [Shigella flexneri]
gb|OXW65603.1| protein DcrB [Shigella flexneri]
gb|OXW68244.1| protein DcrB [Shigella sonnei]
gb|OXW74815.1| protein DcrB [Shigella flexneri]
gb|OXW78648.1| protein DcrB [Shigella flexneri]
gb|OXW82241.1| protein DcrB [Shigella sonnei]
gb|OXW87975.1| protein DcrB [Shigella flexneri]
gb|OXW96116.1| protein DcrB [Shigella flexneri]
gb|OXX01911.1| protein DcrB [Shigella sonnei]
gb|OXX06316.1| protein DcrB [Shigella sonnei]
gb|OXX10334.1| protein DcrB [Shigella sonnei]
gb|OXX14969.1| protein DcrB [Shigella flexneri]
gb|OXX18419.1| protein DcrB [Shigella sonnei]
gb|OXZ49034.1| protein DcrB [Escherichia coli]
gb|OXZ54209.1| protein DcrB [Escherichia coli]
gb|OXZ75263.1| protein DcrB [Escherichia coli]
gb|OXZ76289.1| protein DcrB [Escherichia coli]
gb|OXZ83623.1| protein DcrB [Escherichia coli]
gb|OXZ84584.1| protein DcrB [Escherichia coli]
gb|OXZ89716.1| protein DcrB [Escherichia coli]
gb|OXZ96452.1| protein DcrB [Escherichia coli]
gb|OXZ97026.1| protein DcrB [Escherichia coli]
gb|OYA11579.1| protein DcrB [Escherichia coli]
gb|OYA15221.1| protein DcrB [Escherichia coli]
gb|OYA24484.1| protein DcrB [Escherichia coli]
gb|OYB12498.1| protein DcrB [Escherichia coli]
gb|OYB51487.1| protein DcrB [Escherichia coli]
gb|OYC15499.1| protein DcrB [Escherichia coli]
gb|OYC31378.1| protein DcrB [Escherichia coli]
gb|OYC49412.1| protein DcrB [Escherichia coli]
gb|OYC55670.1| protein DcrB [Escherichia coli]
gb|OYC60601.1| protein DcrB [Escherichia coli]
gb|OYC68483.1| protein DcrB [Escherichia coli]
gb|OYC83948.1| protein DcrB [Escherichia coli]
gb|OYD28884.1| protein DcrB [Escherichia coli]
gb|OYE11402.1| protein DcrB [Shigella sonnei]
gb|OYE14216.1| protein DcrB [Shigella sonnei]
gb|OYE48732.1| protein DcrB [Shigella sonnei]
gb|OYE51989.1| protein DcrB [Shigella sonnei]
gb|OYE71902.1| protein DcrB [Shigella sonnei]
gb|OYF33887.1| protein DcrB [Shigella sonnei]
gb|OYF68752.1| protein DcrB [Shigella sonnei]
gb|OYF68886.1| protein DcrB [Shigella sonnei]
gb|OYF80975.1| protein DcrB [Shigella sonnei]
gb|OYG66668.1| protein DcrB [Escherichia coli]
gb|OYG68255.1| protein DcrB [Shigella sonnei]
gb|OYG80064.1| protein DcrB [Shigella sonnei]
gb|OYG80680.1| protein DcrB [Shigella sonnei]
gb|OYG88086.1| protein DcrB [Shigella sonnei]
gb|OYG94745.1| protein DcrB [Shigella sonnei]
gb|OYG96947.1| protein DcrB [Shigella sonnei]
gb|OYI12612.1| protein DcrB [Shigella sonnei]
gb|OYI13332.1| protein DcrB [Shigella sonnei]
gb|OYI18411.1| protein DcrB [Shigella sonnei]
gb|OYI41335.1| protein DcrB [Shigella sonnei]
gb|OYI42210.1| protein DcrB [Shigella boydii]
gb|OYI47901.1| protein DcrB [Shigella sonnei]
gb|OYI48412.1| protein DcrB [Shigella sonnei]
gb|OYI53168.1| protein DcrB [Shigella sonnei]
gb|OYI60853.1| protein DcrB [Shigella sonnei]
gb|OYI70908.1| protein DcrB [Shigella sonnei]
gb|OYI79759.1| protein DcrB [Shigella boydii]
gb|OYI84956.1| protein DcrB [Shigella sonnei]
gb|OYI88104.1| protein DcrB [Shigella sonnei]
gb|OYI99499.1| protein DcrB [Shigella boydii]
gb|OYJ22338.1| protein DcrB [Shigella sonnei]
gb|OYJ28782.1| protein DcrB [Shigella sonnei]
gb|OYJ36478.1| protein DcrB [Shigella boydii]
gb|OYJ43546.1| protein DcrB [Shigella boydii]
gb|OYJ49092.1| protein DcrB [Shigella sonnei]
gb|OYJ51596.1| protein DcrB [Shigella sonnei]
gb|OYJ70032.1| protein DcrB [Shigella sonnei]
gb|OYJ82383.1| protein DcrB [Shigella sonnei]
gb|OYK29718.1| protein DcrB [Shigella sonnei]
gb|OYK30176.1| protein DcrB [Shigella sonnei]
gb|OYK54934.1| protein DcrB [Shigella sonnei]
gb|OYK60464.1| protein DcrB [Shigella sonnei]
gb|OYK70080.1| protein DcrB [Shigella sonnei]
gb|OYK75296.1| protein DcrB [Shigella boydii]
gb|OYL24132.1| protein DcrB [Shigella sonnei]
gb|OYL31585.1| protein DcrB [Shigella sonnei]
gb|OYL43294.1| protein DcrB [Shigella boydii]
gb|OYL45509.1| protein DcrB [Shigella sonnei]
gb|OYL53912.1| protein DcrB [Shigella sonnei]
gb|OYL58170.1| protein DcrB [Shigella sonnei]
gb|OYL68520.1| protein DcrB [Escherichia coli]
gb|OYL94639.1| protein DcrB [Shigella sonnei]
gb|OYN30239.1| protein DcrB [Shigella boydii]
gb|OYN45204.1| protein DcrB [Escherichia coli]
gb|OYN48893.1| protein DcrB [Escherichia coli]
gb|OYN65860.1| protein DcrB [Escherichia coli]
gb|AST64115.1| protein DcrB [Escherichia coli]
gb|OYQ54798.1| protein DcrB [Shigella sonnei]
emb|SNW07987.1| periplasmic protein DcrB [Escherichia coli]
gb|OZC28552.1| hypothetical protein AYO35_02235 [Escherichia coli]
gb|OZG34835.1| protein DcrB [Escherichia coli O157:H7]
gb|OZM85820.1| protein DcrB [Escherichia coli]
gb|OZM92679.1| protein DcrB [Escherichia coli]
gb|OZM96064.1| protein DcrB [Escherichia coli]
gb|OZN01434.1| protein DcrB [Escherichia coli]
gb|OZN06774.1| protein DcrB [Escherichia coli]
gb|OZO53984.1| protein DcrB [Escherichia coli]
gb|OZO59109.1| protein DcrB [Escherichia coli]
gb|OZO63975.1| protein DcrB [Escherichia coli]
gb|OZO69423.1| protein DcrB [Escherichia coli]
gb|OZO73797.1| protein DcrB [Escherichia coli]
gb|OZO78933.1| protein DcrB [Escherichia coli]
gb|OZO84112.1| protein DcrB [Escherichia coli]
gb|OZO89099.1| protein DcrB [Escherichia coli]
gb|OZO93638.1| protein DcrB [Escherichia coli]
gb|OZO98693.1| protein DcrB [Escherichia coli]
gb|OZP03207.1| protein DcrB [Escherichia coli]
gb|OZP09397.1| protein DcrB [Escherichia coli]
gb|OZP13330.1| protein DcrB [Escherichia coli]
gb|OZP18437.1| protein DcrB [Escherichia coli]
gb|OZP23329.1| protein DcrB [Escherichia coli]
gb|OZP28074.1| protein DcrB [Escherichia coli]
gb|OZP33097.1| protein DcrB [Escherichia coli]
gb|OZR92903.1| protein DcrB [Escherichia coli]
gb|OZR98446.1| protein DcrB [Escherichia coli]
gb|OZS02660.1| protein DcrB [Escherichia coli]
gb|OZS08052.1| protein DcrB [Escherichia coli]
gb|OZS12999.1| protein DcrB [Escherichia coli]
gb|OZX70571.1| protein DcrB [Escherichia coli]
gb|OZX77789.1| protein DcrB [Escherichia coli]
gb|OZX91606.1| protein DcrB [Escherichia coli]
gb|OZY01929.1| protein DcrB [Escherichia coli]
gb|OZY10824.1| protein DcrB [Escherichia coli]
gb|PAB67397.1| protein DcrB [Escherichia coli]
gb|PAB81545.1| protein DcrB [Escherichia coli]
gb|PAB87081.1| protein DcrB [Escherichia coli]
gb|PAB96449.1| protein DcrB [Escherichia coli]
gb|PAB97915.1| protein DcrB [Escherichia coli]
gb|PAC00442.1| protein DcrB [Escherichia coli]
gb|PAC10781.1| protein DcrB [Escherichia coli]
gb|PAL30812.1| protein DcrB [Escherichia coli]
gb|PAL35038.1| protein DcrB [Escherichia coli]
gb|PAL39277.1| protein DcrB [Escherichia coli]
gb|PAL42711.1| protein DcrB [Escherichia coli]
gb|PAL46285.1| protein DcrB [Escherichia coli]
gb|PAQ17895.1| protein DcrB [Escherichia coli]
gb|PAQ26858.1| protein DcrB [Escherichia coli]
gb|PAQ30387.1| protein DcrB [Escherichia coli]
gb|PAQ31360.1| protein DcrB [Escherichia coli]
gb|PAQ34335.1| protein DcrB [Escherichia coli]
gb|PAQ43760.1| protein DcrB [Escherichia coli]
gb|PAQ46877.1| protein DcrB [Escherichia coli]
gb|PAQ51149.1| protein DcrB [Escherichia coli]
gb|PAQ54988.1| protein DcrB [Escherichia coli]
gb|PAQ64638.1| protein DcrB [Escherichia coli]
gb|PAQ75332.1| protein DcrB [Escherichia coli]
gb|PAQ77488.1| protein DcrB [Escherichia coli]
gb|PAQ83495.1| protein DcrB [Escherichia coli]
gb|PAQ86571.1| protein DcrB [Escherichia coli]
gb|PAQ94908.1| protein DcrB [Escherichia coli]
gb|PAQ96728.1| protein DcrB [Escherichia coli]
gb|PAR02545.1| protein DcrB [Escherichia coli]
gb|PAS49793.1| protein DcrB [Escherichia coli]
gb|PAS54035.1| protein DcrB [Escherichia coli]
gb|PAS60749.1| protein DcrB [Escherichia coli]
gb|PAS72668.1| protein DcrB [Escherichia coli]
gb|PAS77697.1| protein DcrB [Escherichia coli]
gb|PAS79361.1| protein DcrB [Escherichia coli]
gb|PAS84126.1| protein DcrB [Escherichia coli]
emb|CTP96225.1| DcrB protein precursor [Escherichia coli]
gb|ASX03995.1| protein DcrB [Escherichia coli]
gb|PAT78416.1| hypothetical protein BTP98_24420 [Escherichia coli]
gb|PAT83927.1| hypothetical protein BTP99_06190 [Escherichia coli]
gb|PAT85272.1| hypothetical protein BTQ00_14000 [Escherichia coli]
gb|PAT96245.1| hypothetical protein BTQ01_14210 [Escherichia coli]
gb|PAU02664.1| hypothetical protein BTQ03_20750 [Escherichia coli]
gb|PAU05787.1| hypothetical protein BTQ02_00535 [Escherichia coli]
gb|PAU14595.1| hypothetical protein BTQ05_19390 [Escherichia coli]
gb|PAU16743.1| hypothetical protein BTQ04_06975 [Escherichia coli]
gb|PAU23171.1| hypothetical protein BTQ06_13030 [Escherichia coli]
gb|PAU26656.1| hypothetical protein BTQ07_17370 [Escherichia coli]
gb|PAU33814.1| hypothetical protein BTQ08_08545 [Escherichia coli]
gb|PAX42686.1| protein DcrB [Escherichia coli]
gb|ASZ43434.1| protein DcrB [Escherichia coli]
gb|ASZ47926.1| protein DcrB [Escherichia coli]
gb|PAY72721.1| protein DcrB [Shigella flexneri]
gb|PAY79264.1| protein DcrB [Shigella boydii]
gb|PAY88379.1| protein DcrB [Shigella boydii]
gb|PAY89554.1| protein DcrB [Shigella flexneri]
gb|PAY92517.1| protein DcrB [Shigella flexneri]
gb|PAY96784.1| protein DcrB [Shigella boydii]
gb|PAZ24512.1| protein DcrB [Escherichia coli]
gb|PAZ30607.1| protein DcrB [Escherichia coli]
gb|PAZ35362.1| protein DcrB [Escherichia coli]
gb|PAZ35951.1| protein DcrB [Escherichia coli]
gb|PAZ44230.1| protein DcrB [Escherichia coli]
gb|PAZ51342.1| protein DcrB [Escherichia coli]
gb|PAZ55291.1| protein DcrB [Escherichia coli]
gb|PAZ60367.1| protein DcrB [Escherichia coli]
gb|PAZ62078.1| protein DcrB [Escherichia coli]
gb|PAZ72596.1| protein DcrB [Escherichia coli]
gb|PAZ77429.1| protein DcrB [Escherichia coli]
gb|PAZ81556.1| protein DcrB [Escherichia coli]
gb|PAZ84771.1| protein DcrB [Escherichia coli]
gb|PAZ89836.1| protein DcrB [Escherichia coli]
gb|PAZ97330.1| protein DcrB [Escherichia coli]
gb|ATB10383.1| protein DcrB [Escherichia coli]
gb|ATB15616.1| protein DcrB [Escherichia coli]
gb|PBK06833.1| protein DcrB [Escherichia coli]
gb|PBK15758.1| protein DcrB [Escherichia coli]
gb|PBK20332.1| protein DcrB [Escherichia coli]
gb|PBK21915.1| protein DcrB [Escherichia coli]
gb|PBK39000.1| protein DcrB [Escherichia coli]
gb|ATB71290.1| protein DcrB [Escherichia coli]
gb|ATB81196.1| protein DcrB [Escherichia coli]
gb|ATB86180.1| protein DcrB [Escherichia coli]
gb|ATB91120.1| protein DcrB [Escherichia coli]
gb|ATB96226.1| protein DcrB [Escherichia coli]
gb|ATC00923.1| protein DcrB [Escherichia coli]
gb|ATC09602.1| protein DcrB [Escherichia coli]
gb|ATC10619.1| protein DcrB [Escherichia coli]
gb|PBN52742.1| protein DcrB [Escherichia coli]
gb|PBN56105.1| protein DcrB [Escherichia coli]
gb|PBN61788.1| protein DcrB [Escherichia coli]
gb|PBN74775.1| protein DcrB [Escherichia coli]
gb|PBN75109.1| protein DcrB [Escherichia coli]
gb|PBN85646.1| protein DcrB [Escherichia coli]
gb|PBN86420.1| protein DcrB [Escherichia coli]
gb|PBN92149.1| protein DcrB [Escherichia coli]
gb|PBO09830.1| protein DcrB [Shigella sonnei]
gb|PBO43238.1| protein DcrB [Escherichia coli]
gb|PBO55103.1| protein DcrB [Escherichia coli]
gb|PBO55826.1| protein DcrB [Escherichia coli]
gb|PBO61772.1| protein DcrB [Escherichia coli]
gb|PBO64333.1| protein DcrB [Escherichia coli]
gb|PBO65839.1| protein DcrB [Escherichia coli]
gb|PBO74735.1| protein DcrB [Escherichia coli]
gb|PBO76646.1| protein DcrB [Escherichia coli]
gb|PBO90245.1| protein DcrB [Shigella sonnei]
gb|PBO91600.1| protein DcrB [Shigella boydii]
gb|PBP07134.1| protein DcrB [Shigella sonnei]
gb|PBP10765.1| protein DcrB [Shigella sonnei]
gb|PBQ39371.1| protein DcrB [Escherichia coli]
gb|PBQ42106.1| protein DcrB [Escherichia coli]
gb|PBQ47391.1| protein DcrB [Escherichia coli]
gb|PBQ53864.1| protein DcrB [Escherichia coli]
gb|PBQ55919.1| protein DcrB [Escherichia coli]
gb|PBQ66765.1| protein DcrB [Escherichia coli]
gb|PBQ73533.1| protein DcrB [Escherichia coli]
gb|PBQ92129.1| protein DcrB [Escherichia coli]
gb|PBQ97462.1| protein DcrB [Escherichia coli]
gb|PBR08991.1| protein DcrB [Escherichia coli]
gb|PBR11112.1| protein DcrB [Escherichia coli]
gb|PBR15730.1| protein DcrB [Escherichia coli]
gb|PBR36127.1| protein DcrB [Escherichia coli]
gb|PBR41845.1| protein DcrB [Escherichia coli]
gb|PBR46520.1| protein DcrB [Escherichia coli]
gb|PBR56903.1| protein DcrB [Escherichia coli]
gb|PBR61288.1| protein DcrB [Escherichia coli]
gb|PBR66619.1| protein DcrB [Escherichia coli]
gb|PBR71171.1| protein DcrB [Escherichia coli]
gb|PBR94350.1| protein DcrB [Escherichia coli]
gb|PBR98509.1| protein DcrB [Escherichia coli]
gb|PBS01967.1| protein DcrB [Escherichia coli]
gb|PBS21969.1| protein DcrB [Escherichia coli]
gb|PBS26946.1| protein DcrB [Escherichia coli]
gb|PBS31883.1| protein DcrB [Escherichia coli]
gb|PBS36489.1| protein DcrB [Escherichia coli]
gb|PBS43140.1| protein DcrB [Escherichia coli]
gb|PBS48457.1| protein DcrB [Escherichia coli]
gb|PBS89585.1| protein DcrB [Escherichia coli]
gb|PBS97101.1| protein DcrB [Escherichia coli]
gb|PBS99286.1| protein DcrB [Escherichia coli]
gb|PBT06569.1| protein DcrB [Escherichia coli]
gb|PBT09095.1| protein DcrB [Escherichia coli]
gb|PBT16927.1| protein DcrB [Escherichia coli]
gb|PBT21033.1| protein DcrB [Escherichia coli]
gb|PBT23014.1| protein DcrB [Escherichia coli]
gb|PBT28482.1| protein DcrB [Escherichia coli]
gb|PBT33386.1| protein DcrB [Escherichia coli]
gb|PBT39202.1| protein DcrB [Escherichia coli]
gb|PBT40479.1| protein DcrB [Escherichia coli]
gb|PBT47890.1| protein DcrB [Escherichia coli]
gb|PBT55957.1| protein DcrB [Escherichia coli]
gb|PBT58006.1| protein DcrB [Escherichia coli]
gb|PBT61716.1| protein DcrB [Escherichia coli]
gb|PBT65657.1| protein DcrB [Escherichia coli]
gb|PBT71161.1| protein DcrB [Escherichia coli]
gb|PBT76690.1| protein DcrB [Escherichia coli]
gb|PBT83409.1| protein DcrB [Escherichia coli]
gb|PBT84356.1| protein DcrB [Escherichia coli]
gb|PBT88803.1| protein DcrB [Escherichia coli]
gb|PBT96106.1| protein DcrB [Escherichia coli]
gb|PBT98742.1| protein DcrB [Escherichia coli]
gb|PBU03356.1| protein DcrB [Escherichia coli]
gb|PBU12130.1| protein DcrB [Escherichia coli]
gb|PBU22781.1| protein DcrB [Escherichia coli]
gb|PBU27431.1| protein DcrB [Escherichia coli]
gb|PBU32396.1| protein DcrB [Escherichia coli]
gb|PBU37626.1| protein DcrB [Escherichia coli]
gb|PBU44387.1| protein DcrB [Escherichia coli]
gb|PBU47824.1| protein DcrB [Escherichia coli]
gb|PBU53325.1| protein DcrB [Escherichia coli]
gb|PBU56904.1| protein DcrB [Escherichia coli]
gb|PBU62050.1| protein DcrB [Escherichia coli]
gb|PBU66588.1| protein DcrB [Escherichia coli]
gb|PBU73108.1| protein DcrB [Escherichia coli]
gb|PBU79427.1| protein DcrB [Escherichia coli]
gb|PBU84019.1| protein DcrB [Escherichia coli]
gb|PBU89200.1| protein DcrB [Escherichia coli]
gb|PBU92012.1| protein DcrB [Escherichia coli]
gb|PCD50847.1| protein DcrB [Escherichia coli]
gb|PCD53530.1| protein DcrB [Escherichia coli]
gb|PCD71648.1| protein DcrB [Escherichia coli]
gb|PCG23593.1| protein DcrB [Escherichia coli]
gb|PCG29366.1| protein DcrB [Escherichia coli]
gb|PCG33840.1| protein DcrB [Escherichia coli]
gb|PCG39325.1| protein DcrB [Escherichia coli]
gb|PCG44057.1| protein DcrB [Escherichia coli]
gb|PCG49631.1| protein DcrB [Escherichia coli]
gb|PCG54959.1| protein DcrB [Escherichia coli]
gb|ATG08572.1| protein DcrB [Escherichia coli]
gb|ATG12273.1| protein DcrB [Escherichia coli]
gb|ATG64007.1| protein DcrB [Escherichia coli O104:H21 str. CFSAN002236]
gb|PCM06418.1| hypothetical protein BH693_21960 [Escherichia coli]
gb|PCM17180.1| hypothetical protein BH691_10225 [Escherichia coli]
gb|PCM27463.1| hypothetical protein BH689_10605 [Escherichia coli]
gb|PCM32736.1| protein DcrB [Escherichia coli]
gb|PCM33781.1| hypothetical protein BH690_09825 [Escherichia coli]
gb|PCO32815.1| protein DcrB [Escherichia coli]
gb|PCO56815.1| protein DcrB [Escherichia coli]
gb|PCO96737.1| protein DcrB [Escherichia coli]
gb|PCQ52529.1| protein DcrB [Escherichia coli]
gb|PCR59738.1| protein DcrB [Escherichia coli]
gb|PCS33311.1| protein DcrB [Escherichia coli]
gb|PCS38070.1| protein DcrB [Escherichia coli]
gb|PCS48720.1| protein DcrB [Escherichia coli]
gb|PCS56987.1| protein DcrB [Escherichia coli]
gb|PCS62355.1| protein DcrB [Escherichia coli]
gb|PCS65466.1| protein DcrB [Escherichia coli]
gb|PCS80258.1| protein DcrB [Escherichia coli]
gb|PCS86152.1| protein DcrB [Escherichia coli]
gb|PCS91767.1| protein DcrB [Escherichia coli]
gb|PCS98791.1| protein DcrB [Escherichia coli]
gb|PCS99429.1| protein DcrB [Escherichia coli]
gb|PCT13165.1| protein DcrB [Escherichia coli]
gb|PCT16133.1| protein DcrB [Escherichia coli]
gb|PCT21456.1| protein DcrB [Escherichia coli]
gb|PCT27119.1| protein DcrB [Escherichia coli]
gb|PCT31008.1| protein DcrB [Escherichia coli]
gb|PCT40995.1| protein DcrB [Escherichia coli]
gb|ATH69640.1| protein DcrB [Shigella flexneri 1c]
gb|ATH90695.1| protein DcrB [Shigella sonnei]
gb|ATI06844.1| protein DcrB [Escherichia coli M12]
gb|PDM45879.1| protein DcrB [Escherichia coli]
gb|PDN02205.1| protein DcrB [Escherichia coli]
gb|PDN90714.1| protein DcrB [Escherichia coli]
gb|PDN94377.1| protein DcrB [Escherichia coli]
gb|PDN97550.1| protein DcrB [Escherichia coli]
gb|PDO05615.1| protein DcrB [Escherichia coli]
gb|PDO14040.1| protein DcrB [Escherichia coli]
gb|PDO21175.1| protein DcrB [Escherichia coli]
gb|PDO24996.1| protein DcrB [Escherichia coli]
gb|PDO33001.1| protein DcrB [Escherichia coli]
gb|PDO33260.1| protein DcrB [Escherichia coli]
gb|PDO39124.1| protein DcrB [Escherichia coli]
gb|PDO43508.1| protein DcrB [Escherichia coli]
gb|PDO48333.1| protein DcrB [Escherichia coli]
gb|PDO53499.1| protein DcrB [Escherichia coli]
gb|PDO58950.1| protein DcrB [Escherichia coli]
gb|PDO65755.1| protein DcrB [Escherichia coli]
gb|PDO70048.1| protein DcrB [Escherichia coli]
gb|PDS10341.1| protein DcrB [Escherichia coli]
gb|PDS13331.1| protein DcrB [Escherichia coli]
gb|PDS19771.1| protein DcrB [Escherichia coli]
gb|PDT96186.1| protein DcrB [Escherichia coli]
gb|PDU01575.1| protein DcrB [Escherichia coli]
gb|PDU07097.1| protein DcrB [Escherichia coli]
gb|PDU12185.1| protein DcrB [Escherichia coli]
gb|PDU14614.1| protein DcrB [Escherichia coli]
gb|PDU23079.1| protein DcrB [Escherichia coli]
gb|PDU28124.1| protein DcrB [Escherichia coli]
gb|PDU33739.1| protein DcrB [Escherichia coli]
gb|PDU38944.1| protein DcrB [Escherichia coli]
gb|PDU46537.1| protein DcrB [Escherichia coli]
gb|PDU52287.1| protein DcrB [Escherichia coli]
gb|PDU58713.1| protein DcrB [Escherichia coli]
gb|PDU62642.1| protein DcrB [Escherichia coli]
gb|PDU67748.1| protein DcrB [Escherichia coli]
gb|PDU73570.1| protein DcrB [Escherichia coli]
gb|PDU78880.1| protein DcrB [Escherichia coli]
gb|PDU84703.1| protein DcrB [Escherichia coli]
gb|PDU87528.1| protein DcrB [Escherichia coli]
gb|PDU97607.1| protein DcrB [Escherichia coli]
gb|PDU99141.1| protein DcrB [Escherichia coli]
gb|PDV07590.1| protein DcrB [Escherichia coli]
gb|PDV12766.1| protein DcrB [Escherichia coli]
gb|PDV18483.1| protein DcrB [Escherichia coli]
gb|PDV28192.1| protein DcrB [Escherichia coli]
gb|PDV34163.1| protein DcrB [Escherichia coli]
gb|PDV40586.1| protein DcrB [Escherichia coli]
gb|PDV43443.1| protein DcrB [Escherichia coli]
gb|PDV51635.1| protein DcrB [Escherichia coli]
gb|PDV54894.1| protein DcrB [Escherichia coli]
gb|PDV58399.1| protein DcrB [Escherichia coli]
gb|PDV66265.1| protein DcrB [Escherichia coli]
gb|PDV71624.1| protein DcrB [Escherichia coli]
gb|PDV92464.1| protein DcrB [Escherichia coli]
gb|PEH63517.1| protein DcrB [Escherichia coli]
gb|PEH94076.1| protein DcrB [Escherichia coli]
gb|PEI00477.1| protein DcrB [Escherichia coli]
gb|PEI18865.1| protein DcrB [Escherichia coli]
gb|PGF65495.1| protein DcrB [Escherichia coli]
gb|PGF65760.1| protein DcrB [Escherichia coli]
gb|PGF72586.1| hypothetical protein BMR20_07465 [Escherichia coli]
gb|PGF79316.1| hypothetical protein BMR21_21470 [Escherichia coli]
gb|PGG00426.1| hypothetical protein BMR26_07905 [Escherichia coli]
gb|PGG03159.1| hypothetical protein BMR32_09005 [Escherichia coli]
gb|PGG05442.1| hypothetical protein BMR25_03965 [Escherichia coli]
gb|PGG12627.1| hypothetical protein BMR30_07490 [Escherichia coli]
gb|PGG13589.1| hypothetical protein BMR29_13350 [Escherichia coli]
gb|PGG21429.1| hypothetical protein BMR28_15695 [Escherichia coli]
gb|PGG29334.1| hypothetical protein BMR27_02400 [Escherichia coli]
gb|PGG45929.1| hypothetical protein BMR16_17940 [Escherichia coli]
gb|PGG56973.1| hypothetical protein BMR13_06460 [Escherichia coli]
gb|PGG59336.1| hypothetical protein BMR33_20040 [Escherichia coli]
gb|PGG62962.1| hypothetical protein BMR15_17260 [Escherichia coli]
gb|PGG71073.1| hypothetical protein BMR17_06985 [Escherichia coli]
gb|PHG88106.1| protein DcrB [Escherichia coli]
gb|PHH32147.1| protein DcrB [Escherichia coli]
gb|ATM10310.1| protein DcrB [Escherichia coli]
gb|ATM83075.1| protein DcrB [Escherichia coli]
gb|PHK62809.1| protein DcrB [Escherichia coli]
gb|PHK71616.1| protein DcrB [Escherichia coli]
gb|PHL24949.1| protein DcrB [Escherichia coli]
gb|PHL34782.1| protein DcrB [Escherichia coli]
gb|PHL41494.1| protein DcrB [Escherichia coli]
gb|PHL44007.1| protein DcrB [Escherichia coli]
gb|PHL54125.1| protein DcrB [Escherichia coli]
gb|PHL59964.1| protein DcrB [Escherichia coli]
gb|PHL73754.1| protein DcrB [Escherichia coli]
gb|PHL94637.1| protein DcrB [Escherichia coli]
gb|PHL98281.1| protein DcrB [Escherichia coli]
gb|ATO77830.1| hypothetical protein I51_17495 [Escherichia coli O91 str. RM7190]
gb|PHU45577.1| protein DcrB [Shigella flexneri]
gb|PHU50045.1| protein DcrB [Shigella flexneri]
gb|PHU54556.1| protein DcrB [Shigella flexneri]
gb|PHU59048.1| protein DcrB [Shigella flexneri]
gb|PHU63626.1| protein DcrB [Shigella sonnei]
gb|PHU68316.1| protein DcrB [Shigella sonnei]
gb|PHU71858.1| protein DcrB [Shigella boydii]
gb|PHU76828.1| protein DcrB [Shigella sonnei]
gb|PHU81147.1| protein DcrB [Shigella sonnei]
gb|PHU84945.1| protein DcrB [Shigella boydii]
gb|PHU89811.1| protein DcrB [Shigella sonnei]
gb|PHU93922.1| protein DcrB [Shigella boydii]
gb|ATP24544.1| protein DcrB [Escherichia coli]
gb|PHW97386.1| protein DcrB [Escherichia coli]
gb|PHX00655.1| protein DcrB [Escherichia coli]
gb|PIM17770.1| protein DcrB [Escherichia coli]
gb|PIM32388.1| protein DcrB [Escherichia coli]
gb|PIM44098.1| protein DcrB [Escherichia coli]
gb|PIM59680.1| protein DcrB [Escherichia coli]
gb|PIM64482.1| protein DcrB [Escherichia coli]
gb|ATU33243.1| protein DcrB [Escherichia coli]
gb|PIS72548.1| hypothetical protein L241_26820 [Escherichia coli O55:H7 str. USDA
5905]
gb|ATW95924.1| protein DcrB [Escherichia coli]
gb|ATX10353.1| protein DcrB [Escherichia coli]
gb|ATX16777.1| protein DcrB [Escherichia coli]
gb|ATX18050.1| protein DcrB [Escherichia coli]
gb|ATX40837.1| protein DcrB [Escherichia coli]
gb|ATX48299.1| protein DcrB [Escherichia coli]
gb|ATX52916.1| protein DcrB [Escherichia coli]
gb|ATX57077.1| protein DcrB [Escherichia coli]
gb|PJF59248.1| protein DcrB [Escherichia coli]
gb|PJF61938.1| protein DcrB [Escherichia coli]
gb|PJF64590.1| protein DcrB [Escherichia coli]
gb|PJF69132.1| protein DcrB [Escherichia coli]
gb|PJF73838.1| protein DcrB [Escherichia coli]
gb|PJF82897.1| protein DcrB [Escherichia coli]
gb|PJF83428.1| protein DcrB [Escherichia coli]
gb|PJG10461.1| protein DcrB [Escherichia coli]
gb|PJG14527.1| protein DcrB [Escherichia coli]
gb|PJG16146.1| protein DcrB [Escherichia coli]
gb|PJG21114.1| protein DcrB [Escherichia coli]
gb|PJG27474.1| protein DcrB [Escherichia coli]
gb|PJG33342.1| protein DcrB [Escherichia coli]
gb|PJG74329.1| protein DcrB [Escherichia coli]
gb|ATY25550.1| protein DcrB [Escherichia coli]
gb|PJH96786.1| protein DcrB [Escherichia coli]
gb|PJN77554.1| protein DcrB [Escherichia coli]
gb|ATZ40088.1| protein DcrB [Escherichia coli]
gb|PJR32826.1| hypothetical protein H260_22255 [Escherichia coli O157:H7 str.
TW14313]
gb|PJR38688.1| hypothetical protein H474_20940 [Escherichia coli O55:H7 str.
TB182A]
gb|PJR44246.1| hypothetical protein H644_22980 [Escherichia coli O157:H7 str.
EC1825]
gb|PJW27678.1| protein DcrB [Escherichia coli]
gb|PJW30511.1| protein DcrB [Escherichia coli]
gb|PJW36831.1| protein DcrB [Escherichia coli]
gb|PJW69623.1| protein DcrB [Escherichia coli]
gb|PJW74692.1| protein DcrB [Escherichia coli]
gb|PJW99702.1| protein DcrB [Escherichia coli]
gb|PJX04224.1| protein DcrB [Escherichia coli]
gb|ATZ32949.1| hypothetical protein CV83915_02639 [Escherichia coli]
gb|PJX81296.1| protein DcrB [Escherichia coli]
gb|PJX85423.1| protein DcrB [Escherichia coli]
gb|PJX90851.1| protein DcrB [Escherichia coli]
gb|PJX95900.1| protein DcrB [Escherichia coli]
gb|PJY02794.1| protein DcrB [Escherichia coli]
gb|PJY07910.1| protein DcrB [Escherichia coli]
gb|PJY14396.1| protein DcrB [Escherichia coli]
gb|PJY28599.1| protein DcrB [Escherichia coli]
gb|PJY34446.1| protein DcrB [Escherichia coli]
gb|PJY41499.1| protein DcrB [Escherichia coli]
gb|PJY47458.1| protein DcrB [Escherichia coli]
gb|PJY49970.1| protein DcrB [Escherichia coli]
gb|PJY55447.1| protein DcrB [Escherichia coli]
gb|PJY63164.1| protein DcrB [Escherichia coli]
gb|PJY90114.1| protein DcrB [Shigella sonnei]
emb|SMZ43272.1| DcrB protein precursor [Escherichia coli]
gb|AUA41287.1| protein DcrB [Escherichia coli]
gb|AUA44099.1| protein DcrB [Escherichia coli]
gb|PKD54408.1| protein DcrB [Escherichia coli]
gb|PKD59600.1| protein DcrB [Escherichia coli]
gb|PKD67330.1| protein DcrB [Escherichia coli]
gb|PKD69151.1| protein DcrB [Escherichia coli]
gb|PKD75622.1| protein DcrB [Escherichia coli]
gb|PKD80298.1| protein DcrB [Escherichia coli]
gb|PKD89849.1| protein DcrB [Escherichia coli]
gb|PKD93132.1| protein DcrB [Escherichia coli]
gb|PKE05659.1| protein DcrB [Escherichia coli]
gb|PKE09772.1| protein DcrB [Escherichia coli]
gb|PKE79292.1| protein DcrB [Escherichia coli]
gb|PKE80489.1| protein DcrB [Escherichia coli]
gb|PKE90290.1| protein DcrB [Escherichia coli]
gb|PKE95356.1| protein DcrB [Escherichia coli]
gb|PKF02231.1| protein DcrB [Escherichia coli]
gb|PKF04771.1| protein DcrB [Escherichia coli]
gb|PKF17924.1| protein DcrB [Escherichia coli]
gb|PKF58261.1| protein DcrB [Escherichia coli]
gb|PKG07484.1| protein DcrB [Escherichia coli]
gb|PKJ00464.1| protein DcrB [Escherichia coli]
gb|PKJ09047.1| protein DcrB [Escherichia coli]
gb|PKJ12426.1| protein DcrB [Escherichia coli]
gb|PKJ19962.1| protein DcrB [Escherichia coli]
gb|PKJ24469.1| protein DcrB [Escherichia coli]
gb|PKJ28182.1| protein DcrB [Escherichia coli]
gb|PKJ33774.1| protein DcrB [Escherichia coli]
gb|PKJ39874.1| protein DcrB [Escherichia coli]
gb|PKJ44061.1| protein DcrB [Escherichia coli]
gb|PKJ48094.1| protein DcrB [Escherichia coli]
gb|AUF78230.1| protein DcrB [Escherichia coli O121:H19]
gb|AUG18173.1| protein DcrB [Escherichia coli str. K-12 substr. MG1655]
gb|PKQ96734.1| protein DcrB [Escherichia coli]
gb|PKR63916.1| protein DcrB [Escherichia coli]
gb|PKR67275.1| protein DcrB [Escherichia coli]
gb|PKR74377.1| protein DcrB [Escherichia coli]
gb|PLA84283.1| protein DcrB [Escherichia coli]
gb|PLB00092.1| protein DcrB [Escherichia coli]
gb|PLB57704.1| protein DcrB [Escherichia coli]
gb|PLB64588.1| protein DcrB [Escherichia coli]
gb|PLB71418.1| protein DcrB [Escherichia coli]
gb|PLB79094.1| protein DcrB [Escherichia coli]
gb|AUJ89227.1| protein DcrB [Escherichia coli]
gb|AUJ97886.1| protein DcrB [Escherichia coli]
gb|AUJ99205.1| protein DcrB [Escherichia coli]
gb|AUK09575.1| protein DcrB [Escherichia coli]
gb|AUK14833.1| protein DcrB [Escherichia coli]
gb|AUK19970.1| protein DcrB [Escherichia coli]
gb|PLK13229.1| protein DcrB [Escherichia coli]
gb|PLR12645.1| protein DcrB [Escherichia coli]
gb|AUL61673.1| protein DcrB [Escherichia coli]
gb|AUL68221.1| protein DcrB [Escherichia coli]
gb|AUL83055.1| protein DcrB [Escherichia coli]
gb|AUL92307.1| protein DcrB [Escherichia coli]
gb|AUM20583.1| protein DcrB [Escherichia coli]
gb|AUN45775.1| protein DcrB [Escherichia coli]
gb|PMB62724.1| protein DcrB [Escherichia coli]
gb|PMD83504.1| hypothetical protein A8A11_12010 [Escherichia coli]
gb|PMD95267.1| hypothetical protein A8A04_21755 [Escherichia coli]
gb|PMD95949.1| hypothetical protein A8A05_12595 [Escherichia coli]
gb|PME04101.1| hypothetical protein A8A06_15800 [Escherichia coli]
emb|SOQ98079.1| periplasmic protein [Escherichia coli]
emb|SOQ86808.1| periplasmic protein [Escherichia coli]
emb|SOR02804.1| periplasmic protein [Escherichia coli]
emb|SOQ88365.1| periplasmic protein [Escherichia coli]
emb|SOQ64643.1| periplasmic protein [Escherichia coli]
emb|SOQ65674.1| periplasmic protein [Escherichia coli]
emb|SOQ78340.1| periplasmic protein [Escherichia coli]
emb|SOQ81686.1| periplasmic protein [Escherichia coli]
emb|SOQ75616.1| periplasmic protein [Escherichia coli]
emb|SOR05507.1| periplasmic protein [Escherichia coli]
gb|AUO34316.1| protein DcrB [Escherichia coli]
gb|AUO40168.1| protein DcrB [Escherichia coli]
gb|AUO55473.1| protein DcrB [Escherichia coli]
gb|PNB98849.1| protein DcrB [Escherichia coli]
gb|PNC02513.1| protein DcrB [Escherichia coli]
gb|PND43685.1| protein DcrB [Escherichia coli]
gb|PNL70758.1| protein DcrB [Escherichia coli O157]
gb|PNM75558.1| protein DcrB [Shigella sonnei]
gb|PNO48300.1| protein DcrB [Shigella sonnei]
gb|PNO96344.1| protein DcrB [Escherichia coli]
gb|AUP44834.1| hypothetical protein CV83906_2238 [Escherichia coli]
gb|AUS36397.1| protein DcrB [Escherichia coli]
gb|PNR05075.1| protein DcrB [Escherichia coli]
gb|PNR10629.1| protein DcrB [Escherichia coli]
gb|PNR13346.1| protein DcrB [Escherichia coli]
gb|PNS27177.1| protein DcrB [Escherichia coli]
gb|AUT07256.1| protein DcrB [Escherichia coli]
gb|PNY43112.1| protein DcrB [Escherichia coli]
gb|PNY52916.1| protein DcrB [Escherichia coli]
gb|PNY55461.1| protein DcrB [Escherichia coli]
gb|AUV22099.1| protein DcrB [Escherichia coli]
gb|AUV32085.1| protein DcrB [Escherichia coli]
gb|POF68319.1| protein DcrB [Escherichia coli]
gb|POF69707.1| protein DcrB [Escherichia coli]
gb|POF75953.1| protein DcrB [Escherichia coli]
gb|POF83027.1| protein DcrB [Escherichia coli]
gb|AUU30056.1| protein DcrB [Shigella flexneri]
gb|POH47828.1| protein DcrB [Escherichia coli]
gb|POH92730.1| protein DcrB [Escherichia coli]
gb|POH93631.1| protein DcrB [Escherichia coli]
gb|POH95789.1| protein DcrB [Escherichia coli]
gb|POI08262.1| protein DcrB [Escherichia coli]
gb|POI09905.1| protein DcrB [Escherichia coli]
gb|AUX00530.1| DcrB protein precursor [Escherichia coli]
gb|POO36615.1| protein DcrB [Escherichia coli]
gb|POO41544.1| protein DcrB [Escherichia coli]
gb|POO48082.1| protein DcrB [Escherichia coli]
gb|AUY03640.1| protein DcrB [Escherichia coli]
gb|POR90403.1| protein DcrB [Shigella flexneri]
gb|POR96096.1| protein DcrB [Shigella flexneri]
gb|POS21906.1| hypothetical protein BJN38_07520 [Escherichia coli]
gb|POS22171.1| hypothetical protein BJN43_12055 [Escherichia coli]
gb|POS29121.1| hypothetical protein BJN46_12170 [Escherichia coli]
gb|POS35722.1| hypothetical protein BJP21_05590 [Escherichia coli]
gb|POS47704.1| hypothetical protein BJP17_05065 [Escherichia coli]
gb|POS49291.1| hypothetical protein BJP18_06685 [Escherichia coli]
gb|POS57492.1| hypothetical protein BJP19_05915 [Escherichia coli]
gb|POS60501.1| hypothetical protein BJP20_03840 [Escherichia coli]
gb|POT03403.1| protein DcrB [Escherichia coli]
gb|POT06149.1| protein DcrB [Escherichia coli]
gb|POT07673.1| protein DcrB [Escherichia coli]
gb|POT14489.1| protein DcrB [Escherichia coli]
gb|POT17417.1| protein DcrB [Escherichia coli]
gb|POT19057.1| protein DcrB [Escherichia coli]
gb|POV26213.1| protein DcrB [Escherichia coli]
gb|POZ13434.1| protein DcrB [Escherichia coli]
gb|AVB43769.1| protein DcrB [Escherichia coli]
gb|AVD30699.1| protein DcrB [Escherichia coli]
gb|PPE08036.1| protein DcrB [Escherichia coli]
gb|PPE14503.1| protein DcrB [Escherichia coli]
gb|PPE21718.1| protein DcrB [Escherichia coli]
gb|PPE28292.1| protein DcrB [Escherichia coli]
gb|PPE90803.1| protein DcrB [Escherichia coli]
gb|AVE95737.1| protein DcrB [Escherichia coli]
gb|PPV43244.1| protein DcrB [Escherichia coli]
gb|PPV46861.1| protein DcrB [Escherichia coli]
gb|PPV55466.1| protein DcrB [Escherichia coli]
gb|PPV59639.1| protein DcrB [Escherichia coli]
gb|PPV70502.1| protein DcrB [Escherichia coli]
gb|PPV71798.1| protein DcrB [Escherichia coli]
gb|PPV85067.1| protein DcrB [Escherichia coli]
gb|PPV86964.1| protein DcrB [Escherichia coli]
gb|PPV92976.1| protein DcrB [Escherichia coli]
gb|PPW00700.1| protein DcrB [Escherichia coli]
gb|PPW01719.1| protein DcrB [Escherichia coli]
gb|PPW13283.1| protein DcrB [Escherichia coli]
gb|PPW14262.1| protein DcrB [Escherichia coli]
gb|PPW24880.1| protein DcrB [Escherichia coli]
gb|PPW30127.1| protein DcrB [Escherichia coli]
gb|PPW33157.1| protein DcrB [Escherichia coli]
gb|PPW37573.1| protein DcrB [Escherichia coli]
gb|PPW40191.1| protein DcrB [Escherichia coli]
gb|PPW46800.1| protein DcrB [Escherichia coli]
gb|PPW53362.1| protein DcrB [Escherichia coli]
gb|PPW59863.1| protein DcrB [Escherichia coli]
gb|PPW62794.1| protein DcrB [Escherichia coli]
gb|PPW72832.1| protein DcrB [Escherichia coli]
gb|PPW75373.1| protein DcrB [Escherichia coli]
gb|PPW82503.1| protein DcrB [Escherichia coli]
gb|PPW85080.1| protein DcrB [Escherichia coli]
gb|PPW89822.1| protein DcrB [Escherichia coli]
gb|PPW94683.1| protein DcrB [Escherichia coli]
gb|PPX01680.1| protein DcrB [Escherichia coli]
gb|PPX08938.1| protein DcrB [Escherichia coli]
gb|PPX11623.1| protein DcrB [Escherichia coli]
gb|PPX11921.1| protein DcrB [Escherichia coli]
gb|PPX24700.1| protein DcrB [Escherichia coli]
gb|PPX25673.1| protein DcrB [Escherichia coli]
gb|PPX33224.1| protein DcrB [Escherichia coli]
gb|PPX38785.1| protein DcrB [Escherichia coli]
gb|PPX40158.1| protein DcrB [Escherichia coli]
gb|PPX45695.1| protein DcrB [Escherichia coli]
gb|PPX52626.1| protein DcrB [Escherichia coli]
gb|PPX59645.1| protein DcrB [Escherichia coli]
gb|PPX63974.1| protein DcrB [Escherichia coli]
gb|PPY60024.1| protein DcrB [Escherichia coli]
gb|PPY66313.1| protein DcrB [Escherichia coli]
gb|PPY72749.1| protein DcrB [Escherichia coli]
gb|PPY75658.1| protein DcrB [Escherichia coli]
gb|PPY81224.1| protein DcrB [Escherichia coli]
gb|PPY88215.1| protein DcrB [Escherichia coli]
gb|PPY90097.1| protein DcrB [Escherichia coli]
gb|PPY98832.1| protein DcrB [Escherichia coli]
gb|PPY99012.1| protein DcrB [Escherichia coli]
gb|PPZ06068.1| protein DcrB [Escherichia coli]
gb|PPZ10715.1| protein DcrB [Escherichia coli]
gb|PPZ11910.1| protein DcrB [Escherichia coli]
gb|PPZ20052.1| protein DcrB [Escherichia coli]
gb|PPZ27152.1| protein DcrB [Escherichia coli]
gb|PPZ30114.1| protein DcrB [Escherichia coli]
gb|PPZ36929.1| protein DcrB [Escherichia coli]
gb|PPZ42126.1| protein DcrB [Escherichia coli]
gb|PPZ53091.1| protein DcrB [Escherichia coli]
gb|PPZ97758.1| protein DcrB [Escherichia coli]
gb|PQA06926.1| protein DcrB [Escherichia coli]
gb|PQA07118.1| protein DcrB [Escherichia coli]
gb|PQA09114.1| protein DcrB [Escherichia coli]
gb|PQA20177.1| protein DcrB [Escherichia coli]
gb|PQA22441.1| protein DcrB [Escherichia coli]
gb|PQA27901.1| protein DcrB [Escherichia coli]
gb|PQA33304.1| protein DcrB [Escherichia coli]
gb|PQA39580.1| protein DcrB [Escherichia coli]
gb|PQA43308.1| protein DcrB [Escherichia coli]
gb|PQA46919.1| protein DcrB [Escherichia coli]
gb|PQA53622.1| protein DcrB [Escherichia coli]
gb|PQA62273.1| protein DcrB [Escherichia coli]
gb|PQA68580.1| protein DcrB [Escherichia coli]
gb|PQH08539.1| protein DcrB [Escherichia coli]
gb|PQK18644.1| protein DcrB [Escherichia coli]
gb|PQK28045.1| protein DcrB [Escherichia coli]
gb|PQK32602.1| protein DcrB [Escherichia coli]
gb|PQK37188.1| protein DcrB [Escherichia coli]
gb|PQK38935.1| protein DcrB [Escherichia coli]
gb|PQK49286.1| protein DcrB [Escherichia coli]
gb|PQK52091.1| protein DcrB [Escherichia coli]
gb|PQK56418.1| protein DcrB [Escherichia coli]
gb|PQK64644.1| protein DcrB [Escherichia coli]
gb|PQK65327.1| protein DcrB [Escherichia coli]
gb|AVI53628.1| protein DcrB [Escherichia coli str. K-12 substr. MG1655]
gb|AVJ15168.1| protein DcrB [Escherichia coli]
gb|PQM84160.1| protein DcrB [Shigella flexneri]
gb|PQM93440.1| protein DcrB [Shigella flexneri]
gb|PQM96995.1| protein DcrB [Shigella flexneri]
gb|PQN06506.1| protein DcrB [Shigella flexneri]
gb|PQN17474.1| protein DcrB [Shigella dysenteriae]
gb|PQN18690.1| protein DcrB [Shigella flexneri]
gb|PQN22027.1| protein DcrB [Shigella flexneri]
gb|PQN22858.1| protein DcrB [Shigella boydii]
gb|PQN30193.1| protein DcrB [Shigella flexneri]
gb|PQN37897.1| protein DcrB [Shigella flexneri]
gb|PQN41498.1| protein DcrB [Shigella flexneri]
gb|PQN52167.1| protein DcrB [Shigella dysenteriae]
gb|PQN55289.1| protein DcrB [Shigella boydii]
gb|PQN57787.1| protein DcrB [Shigella flexneri]
gb|PQN59420.1| protein DcrB [Shigella dysenteriae]
gb|PQN68254.1| protein DcrB [Shigella flexneri]
gb|PQN70394.1| protein DcrB [Shigella flexneri]
gb|PQN72931.1| protein DcrB [Shigella flexneri]
gb|PQN84185.1| protein DcrB [Shigella flexneri]
gb|PQN85894.1| protein DcrB [Shigella flexneri]
gb|PQN93623.1| protein DcrB [Shigella flexneri]
gb|PQN94893.1| protein DcrB [Shigella flexneri]
gb|PQN96225.1| protein DcrB [Shigella flexneri]
gb|PQO06765.1| protein DcrB [Shigella flexneri]
gb|PQO17362.1| protein DcrB [Shigella flexneri]
gb|PQO67882.1| protein DcrB [Escherichia coli]
gb|PQO72680.1| protein DcrB [Escherichia coli]
gb|PQO76768.1| protein DcrB [Escherichia coli]
gb|PQO81858.1| protein DcrB [Escherichia coli]
gb|PQO88297.1| protein DcrB [Escherichia coli]
gb|PQO93400.1| protein DcrB [Escherichia coli]
gb|PQP10205.1| protein DcrB [Escherichia coli]
gb|AVJ72162.1| protein DcrB [Escherichia coli]
gb|AVJ76646.1| protein DcrB [Escherichia coli]
gb|PQV28718.1| protein DcrB [Escherichia coli]
gb|PQV37433.1| protein DcrB [Escherichia coli]
gb|PRB36531.1| protein DcrB [Escherichia coli]
gb|PRC24441.1| protein DcrB [Escherichia coli]
gb|AVL31438.1| protein DcrB [Escherichia coli O104:H4]
gb|AVM04682.1| protein DcrB [Escherichia coli]
gb|PRO96530.1| protein DcrB [Escherichia coli]
gb|PRO99073.1| protein DcrB [Escherichia coli]
gb|PRP09247.1| protein DcrB [Escherichia coli]
gb|PRP13094.1| protein DcrB [Escherichia coli]
gb|PRP17681.1| protein DcrB [Escherichia coli]
gb|PRP21984.1| protein DcrB [Escherichia coli]
gb|PRP29664.1| protein DcrB [Escherichia coli]
gb|PRP30065.1| protein DcrB [Escherichia coli]
gb|PRP36851.1| protein DcrB [Escherichia coli]
gb|PRP37929.1| protein DcrB [Escherichia coli]
gb|PRP47046.1| protein DcrB [Escherichia coli]
gb|AVN11989.1| protein DcrB [Escherichia coli]
gb|AVL08419.1| protein DcrB [Escherichia coli]
gb|PRT58661.1| protein DcrB [Escherichia coli]
gb|PRW36839.1| protein DcrB [Escherichia coli]
gb|PRW53282.1| protein DcrB [Escherichia coli]
gb|PSF26889.1| protein DcrB [Escherichia coli]
gb|PSF27989.1| protein DcrB [Escherichia coli]
gb|PSF40811.1| protein DcrB [Escherichia coli]
gb|PSF45609.1| protein DcrB [Escherichia coli]
gb|PSF49536.1| protein DcrB [Escherichia coli]
gb|PSF57431.1| protein DcrB [Escherichia coli]
gb|PSF58465.1| protein DcrB [Escherichia coli]
gb|PSF64196.1| protein DcrB [Escherichia coli]
gb|PSF74043.1| protein DcrB [Escherichia coli]
gb|PSF86566.1| protein DcrB [Escherichia coli]
gb|PSF91663.1| protein DcrB [Escherichia coli]
gb|PSG09874.1| protein DcrB [Escherichia coli]
gb|PSG20498.1| protein DcrB [Escherichia coli]
gb|PSG23821.1| protein DcrB [Escherichia coli]
gb|PSG29345.1| protein DcrB [Escherichia coli]
gb|PSG33668.1| protein DcrB [Escherichia coli]
gb|PSG43883.1| protein DcrB [Escherichia coli]
gb|PSG54349.1| protein DcrB [Escherichia coli]
gb|PSG57720.1| protein DcrB [Escherichia coli]
gb|PSG69992.1| protein DcrB [Escherichia coli]
gb|PSG75289.1| protein DcrB [Escherichia coli]
gb|AVP31637.1| protein DcrB [Escherichia coli]
Length = 185
Score = 346 bits (887), Expect = e-119
Identities = 177/177 (100%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_001679728.1| MULTISPECIES: protein DcrB [Enterobacteriaceae]
gb|EMU58351.1| protein dcrB [Escherichia coli MP021552.7]
gb|EMU58584.1| protein dcrB [Escherichia coli MP021552.11]
gb|EMU67285.1| protein dcrB [Escherichia coli MP021552.12]
gb|EMV16869.1| protein dcrB [Escherichia coli C-34666]
gb|EMX35561.1| protein dcrB [Escherichia coli MP021552.8]
gb|KDG75150.1| protein dcrB [Escherichia coli UCI 53]
gb|KKO23854.1| hypothetical protein XA41_22990 [Escherichia coli]
gb|KKO28234.1| hypothetical protein XA43_05890 [Escherichia coli]
gb|KKO32230.1| hypothetical protein XA40_02850 [Escherichia coli]
gb|KKO37806.1| hypothetical protein XA44_16220 [Escherichia coli]
gb|ALN47522.1| hypothetical protein ASE18_16150 [Escherichia coli]
gb|KSW94122.1| hypothetical protein APT75_23915 [Escherichia coli]
gb|KSY82262.1| hypothetical protein APU13_13390 [Escherichia coli]
gb|KSY88185.1| hypothetical protein APU12_15105 [Escherichia coli]
gb|KUT87589.1| hypothetical protein AWF08_14975 [Escherichia coli]
gb|OAC11816.1| putative lipoprotein [Escherichia coli]
gb|OJF85416.1| hypothetical protein AQF51_09465 [Escherichia coli]
gb|OJR34738.1| hypothetical protein BK379_06215 [Escherichia coli]
gb|OJS36834.1| hypothetical protein BK401_14035 [Escherichia coli]
gb|OJZ38193.1| hypothetical protein BSO19_02775 [Escherichia coli]
gb|AQV40454.1| protein DcrB [Escherichia coli]
gb|OXJ49963.1| protein DcrB [Escherichia coli]
gb|OXJ50267.1| protein DcrB [Escherichia coli]
gb|OXJ58306.1| protein DcrB [Escherichia coli]
gb|OXJ61469.1| protein DcrB [Escherichia coli]
gb|OXJ75691.1| protein DcrB [Escherichia coli]
gb|OXJ91606.1| protein DcrB [Escherichia coli]
gb|OXK14990.1| protein DcrB [Escherichia coli]
gb|OXK21490.1| protein DcrB [Escherichia coli]
gb|OXK96409.1| protein DcrB [Escherichia coli]
gb|OYE76346.1| protein DcrB [Shigella sonnei]
gb|OYG14293.1| protein DcrB [Shigella sonnei]
gb|OYK49279.1| protein DcrB [Shigella sonnei]
gb|OYL18568.1| protein DcrB [Shigella sonnei]
gb|PAY67394.1| protein DcrB [Shigella flexneri]
gb|PCQ94124.1| protein DcrB [Escherichia coli]
gb|ATM26701.1| protein DcrB [Escherichia coli]
gb|ATX33838.1| protein DcrB [Escherichia coli]
gb|PJW41332.1| protein DcrB [Escherichia coli]
gb|AUY27523.1| Protein DcrB [Escherichia coli]
gb|PPW11490.1| protein DcrB [Escherichia coli]
gb|AVM99401.1| protein DcrB [Escherichia coli]
gb|PSF72427.1| protein DcrB [Escherichia coli]
gb|PSF78035.1| protein DcrB [Escherichia coli]
gb|PSG01105.1| protein DcrB [Escherichia coli]
gb|PSG05200.1| protein DcrB [Escherichia coli]
gb|PSG14447.1| protein DcrB [Escherichia coli]
gb|PSG47844.1| protein DcrB [Escherichia coli]
gb|PSG80973.1| protein DcrB [Escherichia coli]
Length = 185
Score = 346 bits (887), Expect = e-119
Identities = 177/177 (100%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_039065249.1| DUF1795 domain-containing protein [Shigella boydii]
Length = 189
Score = 346 bits (887), Expect = e-119
Identities = 177/177 (100%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_044806638.1| hypothetical protein [Escherichia coli]
Length = 185
Score = 345 bits (886), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNP+NLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPINLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_032215610.1| protein DcrB [Escherichia coli]
gb|KEM11368.1| protein dcrB [Escherichia coli 6-319-05_S1_C2]
gb|KEM24827.1| protein dcrB [Escherichia coli 6-319-05_S1_C3]
gb|KEM99662.1| protein dcrB [Escherichia coli 6-319-05_S1_C1]
Length = 185
Score = 345 bits (886), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVI+IMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIIIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_032265821.1| protein DcrB [Escherichia coli]
gb|KDU40675.1| protein dcrB [Escherichia coli 3-073-06_S4_C1]
gb|KDZ85721.1| protein dcrB [Escherichia coli 3-073-06_S4_C3]
gb|KEN21446.1| protein dcrB [Escherichia coli 7-233-03_S3_C2]
Length = 185
Score = 345 bits (886), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMH+WSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHIWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>gb|EFP72389.1| hypothetical protein SD1617_2271 [Shigella dysenteriae 1617]
Length = 185
Score = 345 bits (886), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLL+MGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLIMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_100209778.1| DUF1795 domain-containing protein [Escherichia coli]
gb|PJF90998.1| hypothetical protein CVE15_06940 [Escherichia coli]
gb|PJF94983.1| hypothetical protein CVE17_10045 [Escherichia coli]
gb|PJF98368.1| hypothetical protein CVE18_16390 [Escherichia coli]
gb|PJG05258.1| hypothetical protein CVE19_03600 [Escherichia coli]
Length = 185
Score = 345 bits (884), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNAT+QGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATSQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177
>ref|WP_097733733.1| DUF1795 domain-containing protein [Escherichia coli]
Length = 185
Score = 345 bits (884), Expect = e-119
Identities = 176/177 (99%), Positives = 177/177 (100%)
Frame = +3
Query: 81 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 260
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
Sbjct: 1 MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD 60
Query: 261 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK 440
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRL+DQQRSRDPQLQVVTNK
Sbjct: 61 QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLQDQQRSRDPQLQVVTNK 120
Query: 441 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 611
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN
Sbjct: 121 AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAEN 177