BLASTX nr result

ID: Acanthopanax22_contig00000087 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Acanthopanax22_contig00000087
         (1531 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AAN83714.1|AE016771_225 Hypothetical protein c5293 [Escherich...   282   2e-90
emb|CCK49542.1| putative uncharacterized protein [Escherichia co...   282   2e-90
gb|AAN83711.1|AE016771_222 Hypothetical protein c5290 [Escherich...   239   6e-74
ref|WP_097765614.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
ref|WP_097503542.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
ref|WP_097494879.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
ref|WP_089635839.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
gb|OUZ60651.1| 50S ribosomal protein L9 [Shigella flexneri]           224   6e-68
ref|WP_085449512.1| MULTISPECIES: 50S ribosomal protein L9 [Esch...   224   6e-68
ref|WP_074514484.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   6e-68
ref|WP_072728077.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   6e-68
ref|WP_001196062.1| MULTISPECIES: 50S ribosomal protein L9 [Prot...   224   6e-68
ref|WP_001196060.1| 50S ribosomal protein L9 [Shigella dysenteri...   224   6e-68
ref|WP_050009916.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
ref|WP_024234165.1| 50S ribosomal protein L9 [Escherichia coli]       224   6e-68
ref|WP_016232414.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   6e-68
ref|WP_003582865.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   6e-68
ref|WP_001591419.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   6e-68
ref|WP_044810929.1| 30S ribosomal protein S6 [Escherichia coli]       223   8e-68
ref|WP_047088328.1| 50S ribosomal protein L9 [Escherichia coli] ...   224   9e-68

>gb|AAN83714.1|AE016771_225 Hypothetical protein c5293 [Escherichia coli CFT073]
          Length = 162

 Score =  282 bits (722), Expect = 2e-90
 Identities = 141/162 (87%), Positives = 142/162 (87%)
 Frame = +1

Query: 4   LNNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST 183
           +NNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST
Sbjct: 1   MNNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST 60

Query: 184 DGTEQFTFVASFRRDGNSFQCIDFLSAXXXXXXXXXXXXXXXXXXXXEEFNVFLGSWNSF 363
           DGTEQFTFVASFRRDGNSFQCIDFLSA                    EEFNVFLGSWNSF
Sbjct: 61  DGTEQFTFVASFRRDGNSFQCIDFLSASISCCQNFSQFSFQFSATCFEEFNVFLGSWNSF 120

Query: 364 TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY 489
           TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY
Sbjct: 121 TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY 162


>emb|CCK49542.1| putative uncharacterized protein [Escherichia coli chi7122]
 emb|CCJ46861.1| putative uncharacterized protein [Escherichia coli]
          Length = 162

 Score =  282 bits (722), Expect = 2e-90
 Identities = 141/162 (87%), Positives = 142/162 (87%)
 Frame = +1

Query: 4   LNNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST 183
           +NNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST
Sbjct: 1   MNNELFSYYVYDHFREYFAVNLEAHFVFASGTQNAVRQTNFALSHFNASCSYSVSDVAST 60

Query: 184 DGTEQFTFVASFRRDGNSFQCIDFLSAXXXXXXXXXXXXXXXXXXXXEEFNVFLGSWNSF 363
           DGTEQFTFVASFRRDGNSFQCIDFLSA                    EEFNVFLGSWNSF
Sbjct: 61  DGTEQFTFVASFRRDGNSFQCIDFLSASISSCQNFSQFSFQFSATCFEEFNVFLGSWNSF 120

Query: 364 TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY 489
           TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY
Sbjct: 121 TLRYQEVTSIARFNVYLITQATQVCYFIKQNNLHYLILSKSY 162


>gb|AAN83711.1|AE016771_222 Hypothetical protein c5290 [Escherichia coli CFT073]
          Length = 127

 Score =  239 bits (609), Expect = 6e-74
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 1174 VLGTHNHAADNGIVEAEGSFQLIDHFLRSFNIHQNVVCFVQFVDRVSQLTAAPVFQTVDL 1353
            +LGTHNHAADNGIVEAEGSFQLIDHFLRSFN+HQNVVCFVQFVDRVSQLTAAPVFQTVDL
Sbjct: 1    MLGTHNHAADNGIVEAEGSFQLIDHFLRSFNVHQNVVCFVQFVDRVSQLTAAPVFQTVDL 60

Query: 1354 AFCTSDGSSVALDHARNLFALVRMDHKNDFVMTHRIAPYGLFSLLSGSAESRGGKERVK 1530
            AFCTSDGSSVALDHARNLFALVRMDHKNDFVMTHRIAPYGLFSLLSGSAESRGGKERVK
Sbjct: 61   AFCTSDGSSVALDHARNLFALVRMDHKNDFVMTHRIAPYGLFSLLSGSAESRGGKERVK 119


>ref|WP_097765614.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 122/149 (81%), Positives = 122/149 (81%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                         LETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINVLETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_097503542.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAQ 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_097494879.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  ILAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_089635839.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAKKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>gb|OUZ60651.1| 50S ribosomal protein L9 [Shigella flexneri]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEVRRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_085449512.1| MULTISPECIES: 50S ribosomal protein L9 [Escherichia]
 gb|OSL94647.1| ribosomal protein L9 [Escherichia coli E1118]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLSAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_074514484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW69746.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANVRAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_072728077.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN37151.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO73361.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAKLEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_001196062.1| MULTISPECIES: 50S ribosomal protein L9 [Proteobacteria]
 ref|NP_313206.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. Sakai]
 ref|NP_418624.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. MG1655]
 ref|NP_710066.1| 50S ribosomal protein L9 [Shigella flexneri 2a str. 301]
 ref|YP_002410528.1| 50S ribosomal protein L9 [Escherichia coli IAI39]
 ref|YP_002415333.1| 50S ribosomal subunit protein L9 [Escherichia coli UMN026]
 ref|YP_006122614.1| 50S ribosomal protein L9 [Escherichia coli O83:H1 str. NRG 857C]
 ref|YP_006781180.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 2011C-3493]
 sp|P0A7R1.1|RL9_ECOLI RecName: Full=50S ribosomal protein L9; AltName: Full=Large
           ribosomal subunit protein bL9
 sp|P0A7R2.1|RL9_ECOL6 RecName: Full=50S ribosomal protein L9
 sp|P0A7R3.1|RL9_ECO57 RecName: Full=50S ribosomal protein L9
 sp|P0A7R4.1|RL9_SHIFL RecName: Full=50S ribosomal protein L9
 sp|Q0T9J0.1|RL9_ECOL5 RecName: Full=50S ribosomal protein L9
 sp|Q1R357.1|RL9_ECOUT RecName: Full=50S ribosomal protein L9
 sp|Q0SX83.1|RL9_SHIF8 RecName: Full=50S ribosomal protein L9
 sp|Q31TD4.1|RL9_SHIBS RecName: Full=50S ribosomal protein L9
 sp|Q3YUE4.1|RL9_SHISS RecName: Full=50S ribosomal protein L9
 sp|A1AJA7.1|RL9_ECOK1 RecName: Full=50S ribosomal protein L9
 sp|A7ZV74.1|RL9_ECO24 RecName: Full=50S ribosomal protein L9
 sp|A8A7U9.1|RL9_ECOHS RecName: Full=50S ribosomal protein L9
 sp|B1IT03.1|RL9_ECOLC RecName: Full=50S ribosomal protein L9
 sp|B7MLK8.1|RL9_ECO45 RecName: Full=50S ribosomal protein L9
 sp|B5Z2K8.1|RL9_ECO5E RecName: Full=50S ribosomal protein L9
 sp|B7NTQ8.1|RL9_ECO7I RecName: Full=50S ribosomal protein L9
 sp|B7M9G5.1|RL9_ECO8A RecName: Full=50S ribosomal protein L9
 sp|B1XDV3.1|RL9_ECODH RecName: Full=50S ribosomal protein L9
 sp|B7NGD7.1|RL9_ECOLU RecName: Full=50S ribosomal protein L9
 sp|B6I2A9.1|RL9_ECOSE RecName: Full=50S ribosomal protein L9
 sp|B1LR79.1|RL9_ECOSM RecName: Full=50S ribosomal protein L9
 sp|B7LLY5.1|RL9_ESCF3 RecName: Full=50S ribosomal protein L9
 sp|B2TY76.1|RL9_SHIB3 RecName: Full=50S ribosomal protein L9
 sp|B7UQL2.1|RL9_ECO27 RecName: Full=50S ribosomal protein L9
 sp|B7LCR4.1|RL9_ECO55 RecName: Full=50S ribosomal protein L9
 sp|B7MT77.1|RL9_ECO81 RecName: Full=50S ribosomal protein L9
 sp|C4ZR80.1|RL9_ECOBW RecName: Full=50S ribosomal protein L9
 pdb|1P85|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P86|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AWB|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|1VS6|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS8|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2GYA|F Chain F, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|F Chain F, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
 pdb|2I2T|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2V|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2J28|H Chain H, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2QOV|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QOX|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QOZ|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAO|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBA|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBC|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBE|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBG|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBI|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBK|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2VHM|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 pdb|2VHN|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 pdb|2RDO|H Chain H, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3DF2|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3DF4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3BBX|H Chain H, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3FIK|H Chain H, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 pdb|3E1B|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Pre-Accommodation State
 pdb|3E1D|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Post-Accommodation State
 pdb|3I1N|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1P|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1R|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1T|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I20|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I22|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KCR|H Chain H, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 pdb|2WWQ|H Chain H, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|1VT2|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3ORB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 pdb|3OFQ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFR|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFZ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAS|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAT|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 pdb|3IZT|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 pdb|3IZU|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 pdb|3J01|H Chain H, Structure Of The Ribosome-secye Complex In The Membrane
           Environment
 pdb|3R8S|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3R8T|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3J0T|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0W|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0Y|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J11|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 3 Of The Six
           Classes)
 pdb|3J12|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J14|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J19|H Chain H, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (50s Subunit)
 pdb|4GAR|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAU|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|3J37|L Chain L, Tetracycline Resistance Protein Tet(o) Bound To The
           Ribosome
 pdb|3J4X|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Classic
           Pre- Translocation State (pre1b, 50s Subunit)
 pdb|3J50|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Pre- Translocation State (pre2, 50s
           Subunit)
 pdb|3J51|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Pre- Translocation State (pre3, 50s
           Subunit)
 pdb|3J52|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Classic
           Pre- Translocation State (pre1a, 50s Subunit)
 pdb|3J54|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Hybrid
           Pre- Translocation State (pre4, 50s Subunit)
 pdb|3J56|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Hybrid
           Pre- Translocation State (pre5a, 50s Subunit)
 pdb|3J58|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Hybrid
           Pre- Translocation State (pre5b, 50s Subunit)
 pdb|3J5A|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In Classic
           Post- Translocation State (post1, 50s Subunit)
 pdb|3J5C|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Post- Translocation State (post2a, 50s
           Subunit)
 pdb|3J5E|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Post- Translocation State (post2b, 50s
           Subunit)
 pdb|3J5G|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Post- Translocation State (post3a, 50s
           Subunit)
 pdb|3J5I|H Chain H, E. Coli 70s-fmetval-trnaval-trnafmet Complex In
           Intermediate Post- Translocation State (post3b, 50s
           Subunit)
 pdb|3J5K|H Chain H, E. Coli 70s-fmetval-trnaval Post-translocation Complex
           (post4, 50s Subunit)
 pdb|3J5U|I Chain I, Structure Of The Ribosome With Elongation Factor G Trapped
           In The Pre- Translocation State (pre-translocation
           70s*trna Structure, 50s Subunit)
 pdb|3J5W|I Chain I, Structure Of The Ribosome With Elongation Factor G Trapped
           In The Pre- Translocation State (pre-translocation
           70s*trna*ef-g Structure, 50s Subunit)
 pdb|4CSU|H Chain H, Cryo-em Structures Of The 50s Ribosome Subunit Bound With
           Obge
 pdb|4PEB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Quinupristin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Quinupristin Bound.
 pdb|4PEC|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Quinupristin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome With Quinupristin Bound.
 pdb|4TOM|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Linopristin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Linopristin Bound.
 pdb|4TOO|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Linopristin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome With Linopristin Bound.
 pdb|4TOV|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Flopristin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Flopristin Bound.
 pdb|4TOX|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Flopristin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome With Flopristin Bound.
 pdb|4TP1|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Dalfopristin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Dalfopristin Bound.
 pdb|4TP3|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Dalfopristin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome With Dalfopristin Bound.
 pdb|4TP5|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Virginiamycin M1. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Virginiamycin M1 Bound.
 pdb|4TP7|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Virginiamycin M1. This File Contains The 50s Subunit Of
           The Second 70s Ribosome With Virginiamycin M1 Bound.
 pdb|4TP9|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Dalfopristin And Quinupristin. This File Contains The
           50s Subunit Of The First 70s Ribosome With Dalfopristin
           And Quinupristin Bound.
 pdb|4TPB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Dalfopristin And Quinupristin. This File Contains The
           50s Subunit Of The Second 70s Ribosome With Dalfopristin
           And Quinupristin Bound.
 pdb|4TPD|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Flopristin And Linopristin. This File Contains The 50s
           Subunit Of The First 70s Ribosome With Flopristin And
           Linopristin Bound.
 pdb|4TPF|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Flopristin And Linopristin. This File Contains The 50s
           Subunit Of The Second 70s Ribosome With Flopristin And
           Linopristin Bound.
 pdb|3J7Z|H Chain H, Structure Of The E. Coli 50s Subunit With Ermcl Nascent
           Chain
 pdb|4WAP|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Negamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome.
 pdb|4WAR|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Negamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3J8G|H Chain H, Electron Cryo-microscopy Structure Of Enga Bound With The
           50s Ribosomal Subunit
 pdb|5AKA|H Chain H, EM structure of ribosome-SRP-FtsY complex in closed state
 pdb|5ADY|H Chain H, Cryo-em Structures Of The 50s Ribosome Subunit Bound With
           Hflx
 pdb|5GAD|H Chain H, Rnc-srp-sr Complex Early State
 pdb|5GAE|H Chain H, Rnc In Complex With A Translocating Secyeg
 pdb|5GAG|H Chain H, Rnc In Complex With Srp-sr In The Closed State
 pdb|5GAH|H Chain H, Rnc In Complex With Srp With Detached Ng Domain
 pdb|5GAF|H Chain H, Rnc In Complex With Srp
 pdb|5O2R|H Chain H, Cryo-EM structure of the proline-rich antimicrobial
           peptide Api137 bound to the terminating ribosome
 pdb|5NP6|FF Chain f, 70S structure prior to bypassing
 pdb|5NCO|H Chain H, Quaternary complex between SRP, SR, and SecYEG bound to
           the translating ribosome
 pdb|5IQR|G Chain G, Structure of RelA bound to the 70S ribosome
 pdb|5AFI|H Chain H, 2.9A Structure of E. coli ribosome-EF-TU complex by
           cs-corrected cryo-EM
 gb|AAG59399.1|AE005652_16 50S ribosomal subunit protein L9 [Escherichia coli O157:H7 str.
           EDL933]
 gb|AAN83715.1|AE016771_226 50S ribosomal protein L9 [Escherichia coli CFT073]
 emb|CAA27655.1| unnamed protein product [Escherichia coli]
 gb|AAA97099.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. MG1655]
 gb|AAC77160.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. MG1655]
 dbj|BAB38602.1| 50S ribosomal subunit protein L9 [Escherichia coli O157:H7 str.
           Sakai]
 gb|AAN45773.1| 50S ribosomal subunit protein L9 [Shigella flexneri 2a str. 301]
 gb|AAP19557.1| 50S ribosomal subunit protein L9 [Shigella flexneri 2a str. 2457T]
 gb|AAZ90868.1| 50S ribosomal subunit protein L9 [Shigella sonnei Ss046]
 gb|ABB68674.1| 50S ribosomal subunit protein L9 [Shigella boydii Sb227]
 dbj|BAE78204.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. W3110]
 gb|ABE10207.1| 50S ribosomal subunit protein L9 [Escherichia coli UTI89]
 gb|ABG72389.1| 50S ribosomal protein L9 [Escherichia coli 536]
 gb|ABF06332.1| 50S ribosomal subunit protein L9 [Shigella flexneri 5 str. 8401]
 gb|ABJ03747.1| 50S ribosomal subunit protein L9 [Escherichia coli APEC O1]
 gb|ABV08603.1| ribosomal protein L9 [Escherichia coli HS]
 gb|ABV16983.1| ribosomal protein L9 [Escherichia coli O139:H28 str. E24377A]
 gb|ACA79414.1| ribosomal protein L9 [Escherichia coli ATCC 8739]
 gb|ACB05190.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. DH10B]
 gb|EDS93329.1| ribosomal protein L9 [Escherichia albertii TW07627]
 gb|ACB16569.1| ribosomal protein L9 [Escherichia coli SMS-3-5]
 gb|ACD08488.1| ribosomal protein L9 [Shigella boydii CDC 3083-94]
 gb|EDU34086.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4196]
 gb|EDU52623.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4113]
 gb|EDU66574.1| ribosomal protein L9 [Escherichia coli 53638]
 gb|EDU70700.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4076]
 gb|EDU76223.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4401]
 gb|EDU82597.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4486]
 gb|EDU87293.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4501]
 gb|EDU93218.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC869]
 gb|EDU94471.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC508]
 gb|EDV64073.1| ribosomal protein L9 [Escherichia coli B7A]
 gb|EDV68620.1| ribosomal protein L9 [Escherichia coli F11]
 gb|EDV80985.1| ribosomal protein L9 [Escherichia coli E22]
 gb|EDV86279.1| ribosomal protein L9 [Escherichia coli E110019]
 gb|EDX31513.1| ribosomal protein L9 [Escherichia coli B171]
 gb|EDX37563.1| ribosomal protein L9 [Escherichia coli 101-1]
 gb|EDZ77650.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4206]
 gb|EDZ82231.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4045]
 gb|EDZ87202.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4042]
 gb|ACI39651.1| ribosomal protein L9 [Escherichia coli O157:H7 str. EC4115]
 gb|ACI73296.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ACI73297.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ACI73298.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ACI73299.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ACI73300.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 dbj|BAG80026.1| 50S ribosomal protein L9 [Escherichia coli SE11]
 emb|CAS12074.1| 50S ribosomal subunit protein L9 [Escherichia coli O127:H6 str.
           E2348/69]
 gb|EEC30411.1| ribosomal protein L9 [Escherichia coli O157:H7 str. TW14588]
 emb|CAV01704.1| 50S ribosomal subunit protein L9 [Escherichia coli 55989]
 emb|CAQ91675.1| 50S ribosomal subunit protein L9 [Escherichia fergusonii ATCC
           35469]
 emb|CAR01178.1| 50S ribosomal subunit protein L9 [Escherichia coli IAI1]
 emb|CAR05938.1| 50S ribosomal subunit protein L9 [Escherichia coli S88]
 emb|CAR20765.1| 50S ribosomal subunit protein L9 [Escherichia coli IAI39]
 emb|CAR11153.2| 50S ribosomal subunit protein L9 [Escherichia coli ED1a]
 emb|CAR15849.1| 50S ribosomal subunit protein L9 [Escherichia coli UMN026]
 emb|CAP78718.1| 50S ribosomal protein L9 [Escherichia coli LF82]
 gb|EEH72331.1| 50S ribosomal protein L9 [Escherichia sp. 1_1_43]
 gb|EEH88042.1| 50S ribosomal protein L9 [Escherichia sp. 3_2_53FAA]
 gb|EEJ46792.1| ribosomal protein L9 [Escherichia coli 83972]
 gb|ACR61878.1| 50S ribosomal subunit protein L9 [Escherichia coli BW2952]
 emb|CAQ34549.1| 50S ribosomal subunit protein L9, subunit of 50S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gb|ACT30818.1| ribosomal protein L9 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gb|ACT41704.1| 50S ribosomal protein L9 [Escherichia coli B str. REL606]
 gb|ACT45859.1| 50S ribosomal subunit protein L9 [Escherichia coli BL21(DE3)]
 gb|ACT74983.1| 50S ribosomal subunit protein L9 [Escherichia coli O157:H7 str.
           TW14359]
 dbj|BAI28506.1| 50S ribosomal subunit protein L9 [Escherichia coli O26:H11 str.
           11368]
 dbj|BAI33676.1| 50S ribosomal subunit protein L9 [Escherichia coli O103:H2 str.
           12009]
 dbj|BAI38740.1| 50S ribosomal subunit protein L9 [Escherichia coli O111:H- str.
           11128]
 gb|ACX41392.1| ribosomal protein L9 [Escherichia coli DH1]
 dbj|BAI57629.1| 50S ribosomal protein L9 [Escherichia coli SE15]
 gb|ADA76650.1| 50S ribosomal protein L9 [Shigella flexneri 2002017]
 emb|CBG37505.1| 50S ribosomal subunit protein L9 [Escherichia coli 042]
 gb|ADD59449.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. CB9615]
 gb|EFE60406.1| 50S ribosomal protein L9 [Escherichia coli B088]
 gb|EFF02757.1| 50S ribosomal protein L9 [Escherichia coli FVEC1412]
 gb|EFF03422.1| 50S ribosomal protein L9 [Escherichia coli B185]
 gb|EFF14661.1| 50S ribosomal protein L9 [Escherichia coli B354]
 gb|ADE91559.1| ribosomal protein L9 [Escherichia coli IHE3034]
 gb|EFI22192.1| 50S ribosomal protein L9 [Escherichia coli FVEC1302]
 gb|EFI87147.1| ribosomal protein L9 [Escherichia coli MS 196-1]
 gb|EFJ58392.1| ribosomal protein L9 [Escherichia coli MS 185-1]
 gb|EFJ67627.1| ribosomal protein L9 [Escherichia coli MS 175-1]
 gb|EFJ72583.1| ribosomal protein L9 [Escherichia coli MS 198-1]
 gb|EFJ80059.1| ribosomal protein L9 [Escherichia coli MS 69-1]
 gb|EFJ85738.1| ribosomal protein L9 [Escherichia coli MS 84-1]
 gb|EFJ91247.1| ribosomal protein L9 [Escherichia coli MS 45-1]
 gb|EFJ97777.1| ribosomal protein L9 [Escherichia coli MS 115-1]
 gb|EFK04519.1| ribosomal protein L9 [Escherichia coli MS 182-1]
 gb|EFK15038.1| ribosomal protein L9 [Escherichia coli MS 116-1]
 gb|EFK18071.1| ribosomal protein L9 [Escherichia coli MS 21-1]
 gb|EFK27463.1| ribosomal protein L9 [Escherichia coli MS 187-1]
 gb|EFK47255.1| ribosomal protein L9 [Escherichia coli MS 119-7]
 gb|EFK51787.1| ribosomal protein L9 [Escherichia coli MS 107-1]
 gb|EFK69905.1| ribosomal protein L9 [Escherichia coli MS 124-1]
 gb|EFK75081.1| ribosomal protein L9 [Escherichia coli MS 78-1]
 gb|EFK90004.1| ribosomal protein L9 [Escherichia coli MS 146-1]
 gb|EFM51699.1| 50S ribosomal protein L9 [Escherichia coli NC101]
 gb|EFN36180.1| ribosomal protein L9 [Escherichia coli W]
 gb|ADN49145.1| 50S ribosomal subunit protein L9 [Escherichia coli ABU 83972]
 gb|ADN73579.1| 50S ribosomal protein L9 [Escherichia coli UM146]
 gb|EFO56690.1| ribosomal protein L9 [Escherichia coli MS 145-7]
 emb|CBJ04058.1| 50S ribosomal subunit protein L9 [Escherichia coli ETEC H10407]
 gb|EFP98779.1| ribosomal protein L9 [Escherichia coli 1827-70]
 gb|EFR17013.1| ribosomal protein L9 [Escherichia coli 2362-75]
 gb|ADR29680.1| 50S ribosomal protein L9 [Escherichia coli O83:H1 str. NRG 857C]
 gb|EFS10783.1| ribosomal protein L9 [Shigella flexneri 2a str. 2457T]
 gb|ADT77844.1| 50S ribosomal subunit protein L9 [Escherichia coli W]
 dbj|BAJ45916.1| 50S ribosomal protein L9 [Escherichia coli DH1]
 gb|EFU35516.1| ribosomal protein L9 [Escherichia coli MS 85-1]
 gb|EFU47882.1| ribosomal protein L9 [Escherichia coli MS 110-3]
 gb|EFU52867.1| ribosomal protein L9 [Escherichia coli MS 153-1]
 gb|EFU58337.1| ribosomal protein L9 [Escherichia coli MS 16-3]
 gb|EFU98217.1| ribosomal protein L9 [Escherichia coli 3431]
 gb|EFW51427.1| LSU ribosomal protein L9p [Shigella dysenteriae CDC 74-1112]
 gb|EFW52558.1| LSU ribosomal protein L9p [Shigella boydii ATCC 9905]
 gb|EFW62042.1| LSU ribosomal protein L9p [Shigella flexneri CDC 796-83]
 gb|EFW65318.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. EC1212]
 gb|EFW68319.1| LSU ribosomal protein L9p [Escherichia coli WV_060327]
 gb|EFW75255.1| LSU ribosomal protein L9p [Escherichia coli EC4100B]
 gb|EFX08607.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. G5101]
 gb|EFX13395.1| 50S ribosomal protein L9 [Escherichia coli O157:H- str. 493-89]
 gb|EFX18172.1| 50S ribosomal protein L9 [Escherichia coli O157:H- str. H 2687]
 gb|EFX23005.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. 3256-97]
 gb|EFX28012.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. USDA 5905]
 gb|EFX32857.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. LSU-61]
 gb|EFZ42142.1| ribosomal protein L9 [Escherichia coli EPECa14]
 gb|EFZ47866.1| ribosomal protein L9 [Escherichia coli E128010]
 gb|EFZ52444.1| ribosomal protein L9 [Shigella sonnei 53G]
 gb|EFZ57287.1| ribosomal protein L9 [Escherichia coli LT-68]
 gb|EFZ61631.1| ribosomal protein L9 [Escherichia coli OK1180]
 gb|EFZ67718.1| ribosomal protein L9 [Escherichia coli OK1357]
 gb|EFZ75197.1| ribosomal protein L9 [Escherichia coli RN587/1]
 gb|ADX52672.1| ribosomal protein L9 [Escherichia coli KO11FL]
 gb|EGB31676.1| ribosomal protein L9 [Escherichia coli E1520]
 gb|EGB36316.1| ribosomal protein L9 [Escherichia coli E482]
 gb|EGB42089.1| ribosomal protein L9 [Escherichia coli H120]
 gb|EGB46606.1| ribosomal protein L9 [Escherichia coli H252]
 gb|EGB51254.1| ribosomal protein L9 [Escherichia coli H263]
 gb|EGB55888.1| ribosomal protein L9 [Escherichia coli H489]
 gb|EGB61044.1| ribosomal protein L9 [Escherichia coli M863]
 gb|EGB65801.1| ribosomal protein L9 [Escherichia coli TA007]
 gb|EGB70556.1| ribosomal protein L9 [Escherichia coli TW10509]
 gb|EGB74486.1| ribosomal protein L9 [Escherichia coli MS 57-2]
 gb|EGB88600.1| ribosomal protein L9 [Escherichia coli MS 117-3]
 gb|EGC06178.1| ribosomal protein L9 [Escherichia fergusonii B253]
 gb|EGC12661.1| ribosomal protein L9 [Escherichia coli E1167]
 gb|EGC97596.1| 50S ribosomal protein L9 [Escherichia fergusonii ECD227]
 gb|EGD69211.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. 1125]
 gb|EGD70409.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. 1044]
 gb|EGE61862.1| ribosomal protein L9 [Escherichia coli STEC_7v]
 gb|EGH37063.1| LSU ribosomal protein L9p [Escherichia coli AA86]
 gb|EGI08168.1| ribosomal protein L9 [Escherichia coli H736]
 gb|EGI12880.1| ribosomal protein L9 [Escherichia coli M605]
 gb|EGI18475.1| ribosomal protein L9 [Escherichia coli M718]
 gb|EGI23859.1| ribosomal protein L9 [Escherichia coli TA206]
 gb|EGI28912.1| ribosomal protein L9 [Escherichia coli TA143]
 gb|EGI33627.1| ribosomal protein L9 [Escherichia coli TA271]
 gb|EGI42556.1| ribosomal protein L9 [Escherichia coli TA280]
 gb|EGI43132.1| ribosomal protein L9 [Escherichia coli H591]
 gb|EGI52603.1| ribosomal protein L9 [Escherichia coli H299]
 gb|EGI88435.1| ribosomal protein L9 [Shigella boydii 5216-82]
 gb|EGI88863.1| ribosomal protein L9 [Shigella dysenteriae 155-74]
 gb|EGI92345.1| ribosomal protein L9 [Shigella boydii 3594-74]
 gb|EGJ06686.1| ribosomal protein L9 [Escherichia coli D9]
 gb|AEE59618.1| ribosomal protein L9 RplI [Escherichia coli UMNK88]
 gb|EGJ79502.1| ribosomal protein L9 [Shigella flexneri K-671]
 gb|EGJ79767.1| ribosomal protein L9 [Shigella flexneri 4343-70]
 gb|EGJ92198.1| ribosomal protein L9 [Shigella flexneri 2747-71]
 gb|EGJ93497.1| ribosomal protein L9 [Shigella flexneri 2930-71]
 gb|EGK27180.1| ribosomal protein L9 [Shigella flexneri VA-6]
 gb|EGK28620.1| ribosomal protein L9 [Shigella flexneri K-218]
 gb|EGK30598.1| ribosomal protein L9 [Shigella flexneri K-272]
 gb|EGK32002.1| ribosomal protein L9 [Shigella flexneri K-227]
 gb|EGK41691.1| ribosomal protein L9 [Shigella flexneri K-304]
 gb|EGM59141.1| ribosomal protein L9 [Shigella flexneri SFJ17B]
 gb|AEJ59609.1| ribosomal protein L9 [Escherichia coli UMNF18]
 gb|EGR60804.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 01-09591]
 gb|EGR71725.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. LB226692]
 gb|EGT67594.1| hypothetical protein C22711_1623 [Escherichia coli O104:H4 str.
           C227-11]
 gb|EGU27880.1| 50S ribosomal protein L9 [Escherichia coli XH140A]
 gb|EGU98241.1| ribosomal protein L9 [Escherichia coli MS 79-10]
 gb|EGV48124.1| 50S ribosomal protein L9 [Escherichia coli XH001]
 gb|EGW63425.1| ribosomal protein L9 [Escherichia coli 2534-86]
 gb|EGW64564.1| ribosomal protein L9 [Escherichia coli STEC_B2F1]
 gb|EGW75186.1| ribosomal protein L9 [Escherichia coli STEC_C165-02]
 gb|EGW77798.1| ribosomal protein L9 [Escherichia coli STEC_94C]
 gb|EGW79057.1| ribosomal protein L9 [Escherichia coli 3030-1]
 gb|EGW88045.1| ribosomal protein L9 [Escherichia coli STEC_EH250]
 gb|EGW98648.1| ribosomal protein L9 [Escherichia coli STEC_DG131-3]
 gb|EGW99870.1| ribosomal protein L9 [Escherichia coli STEC_MHI813]
 gb|EGX00576.1| ribosomal protein L9 [Escherichia coli G58-1]
 gb|EGX01392.1| ribosomal protein L9 [Escherichia coli STEC_H.1.8]
 gb|EGX18872.1| ribosomal protein L9 [Escherichia coli TX1999]
 gb|EGX21518.1| ribosomal protein L9 [Escherichia coli STEC_S1191]
 gb|AEQ15607.1| 50S ribosomal subunit protein L9 [Escherichia coli O7:K1 str. CE10]
 gb|EHF19938.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. C227-11]
 gb|EHF21172.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 04-8351]
 gb|EHF26610.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. C236-11]
 gb|EHF36892.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 09-7901]
 gb|EHF43747.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4404]
 gb|EHF44939.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-3677]
 gb|EHF47162.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4522]
 gb|EHF51083.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4623]
 gb|EHF63137.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4632 C1]
 gb|EHF66542.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4632 C2]
 gb|EHF68652.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4632 C3]
 gb|EHF70631.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4632 C4]
 gb|EHF79285.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-4632 C5]
 gb|AER87306.1| 50S ribosomal protein L9 [Escherichia coli str. 'clone D i2']
 gb|AER92225.1| 50S ribosomal protein L9 [Escherichia coli str. 'clone D i14']
 dbj|BAL40757.1| 50S ribosomal subunit protein L9 [Escherichia coli str. K-12
           substr. MDS42]
 gb|EHN81838.1| 50S ribosomal protein L9 [Escherichia coli TA124]
 gb|EHN86227.1| 50S ribosomal protein L9 [Escherichia coli H494]
 gb|EHN96041.1| 50S ribosomal protein L9 [Escherichia coli H397]
 gb|EHO01389.1| 50S ribosomal protein L9 [Escherichia coli B093]
 gb|EHO03161.1| 50S ribosomal protein L9 [Escherichia coli E101]
 gb|EHP67221.1| 50S ribosomal protein L9 [Escherichia coli 4_1_47FAA]
 gb|AEZ43361.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. RM12579]
 gb|EHU02854.1| ribosomal protein L9 [Escherichia coli DEC1C]
 gb|EHU03207.1| ribosomal protein L9 [Escherichia coli DEC1A]
 gb|EHU05157.1| ribosomal protein L9 [Escherichia coli DEC1B]
 gb|EHU19824.1| ribosomal protein L9 [Escherichia coli DEC1E]
 gb|EHU21074.1| ribosomal protein L9 [Escherichia coli DEC2A]
 gb|EHU29708.1| ribosomal protein L9 [Escherichia coli DEC1D]
 gb|EHU34199.1| ribosomal protein L9 [Escherichia coli DEC2B]
 gb|EHU35380.1| ribosomal protein L9 [Escherichia coli DEC2C]
 gb|EHU37541.1| ribosomal protein L9 [Escherichia coli DEC2D]
 gb|EHU48940.1| ribosomal protein L9 [Escherichia coli DEC2E]
 gb|EHU52013.1| ribosomal protein L9 [Escherichia coli DEC3A]
 gb|EHU52940.1| ribosomal protein L9 [Escherichia coli DEC3B]
 gb|EHU65537.1| ribosomal protein L9 [Escherichia coli DEC3C]
 gb|EHU68765.1| ribosomal protein L9 [Escherichia coli DEC3D]
 gb|EHU70269.1| ribosomal protein L9 [Escherichia coli DEC3E]
 gb|EHU80329.1| ribosomal protein L9 [Escherichia coli DEC3F]
 gb|EHU86572.1| ribosomal protein L9 [Escherichia coli DEC4A]
 gb|EHU89418.1| ribosomal protein L9 [Escherichia coli DEC4B]
 gb|EHU99543.1| ribosomal protein L9 [Escherichia coli DEC4D]
 gb|EHV00222.1| ribosomal protein L9 [Escherichia coli DEC4C]
 gb|EHV06623.1| ribosomal protein L9 [Escherichia coli DEC4E]
 gb|EHV16490.1| ribosomal protein L9 [Escherichia coli DEC4F]
 gb|EHV19748.1| ribosomal protein L9 [Escherichia coli DEC5A]
 gb|EHV24311.1| ribosomal protein L9 [Escherichia coli DEC5B]
 gb|EHV31519.1| ribosomal protein L9 [Escherichia coli DEC5C]
 gb|EHV41759.1| ribosomal protein L9 [Escherichia coli DEC5E]
 gb|EHV46503.1| ribosomal protein L9 [Escherichia coli DEC5D]
 gb|EHV50273.1| ribosomal protein L9 [Escherichia coli DEC6B]
 gb|EHV51021.1| ribosomal protein L9 [Escherichia coli DEC6A]
 gb|EHV53192.1| ribosomal protein L9 [Escherichia coli DEC6C]
 gb|EHV65781.1| ribosomal protein L9 [Escherichia coli DEC6D]
 gb|EHV67933.1| ribosomal protein L9 [Escherichia coli DEC6E]
 gb|EHV71126.1| ribosomal protein L9 [Escherichia coli DEC7A]
 gb|EHV83299.1| ribosomal protein L9 [Escherichia coli DEC7C]
 gb|EHV85414.1| ribosomal protein L9 [Escherichia coli DEC7D]
 gb|EHV89488.1| ribosomal protein L9 [Escherichia coli DEC7B]
 gb|EHV95961.1| ribosomal protein L9 [Escherichia coli DEC7E]
 gb|EHW03943.1| ribosomal protein L9 [Escherichia coli DEC8A]
 gb|EHW03990.1| ribosomal protein L9 [Escherichia coli DEC8B]
 gb|EHW08405.1| ribosomal protein L9 [Escherichia coli DEC8C]
 gb|EHW18570.1| ribosomal protein L9 [Escherichia coli DEC8D]
 gb|EHW21232.1| ribosomal protein L9 [Escherichia coli DEC8E]
 gb|EHW28505.1| ribosomal protein L9 [Escherichia coli DEC9A]
 gb|EHW33871.1| ribosomal protein L9 [Escherichia coli DEC9B]
 gb|EHW39246.1| ribosomal protein L9 [Escherichia coli DEC9C]
 gb|EHW47572.1| ribosomal protein L9 [Escherichia coli DEC9D]
 gb|EHW49148.1| ribosomal protein L9 [Escherichia coli DEC9E]
 gb|EHW56516.1| ribosomal protein L9 [Escherichia coli DEC10A]
 gb|EHW61543.1| ribosomal protein L9 [Escherichia coli DEC10B]
 gb|EHW67463.1| ribosomal protein L9 [Escherichia coli DEC10C]
 gb|EHW72871.1| ribosomal protein L9 [Escherichia coli DEC10D]
 gb|EHW84012.1| ribosomal protein L9 [Escherichia coli DEC10E]
 gb|EHW84638.1| ribosomal protein L9 [Escherichia coli DEC11A]
 gb|EHW98312.1| ribosomal protein L9 [Escherichia coli DEC11B]
 gb|EHX02242.1| ribosomal protein L9 [Escherichia coli DEC10F]
 gb|EHX03961.1| ribosomal protein L9 [Escherichia coli DEC11D]
 gb|EHX05797.1| ribosomal protein L9 [Escherichia coli DEC11C]
 gb|EHX14551.1| ribosomal protein L9 [Escherichia coli DEC11E]
 gb|EHX20311.1| ribosomal protein L9 [Escherichia coli DEC12B]
 gb|EHX23976.1| ribosomal protein L9 [Escherichia coli DEC12A]
 gb|EHX24846.1| ribosomal protein L9 [Escherichia coli DEC12C]
 gb|EHX38430.1| ribosomal protein L9 [Escherichia coli DEC12D]
 gb|EHX41539.1| ribosomal protein L9 [Escherichia coli DEC12E]
 gb|EHX41825.1| ribosomal protein L9 [Escherichia coli DEC13A]
 gb|EHX54677.1| ribosomal protein L9 [Escherichia coli DEC13C]
 gb|EHX55018.1| ribosomal protein L9 [Escherichia coli DEC13B]
 gb|EHX56841.1| ribosomal protein L9 [Escherichia coli DEC13D]
 gb|EHX67836.1| ribosomal protein L9 [Escherichia coli DEC13E]
 gb|EHX71627.1| ribosomal protein L9 [Escherichia coli DEC14A]
 gb|EHX72933.1| ribosomal protein L9 [Escherichia coli DEC14B]
 gb|EHX82835.1| ribosomal protein L9 [Escherichia coli DEC14C]
 gb|EHX85841.1| ribosomal protein L9 [Escherichia coli DEC14D]
 gb|EHX92537.1| ribosomal protein L9 [Escherichia coli DEC15A]
 gb|EHX98815.1| ribosomal protein L9 [Escherichia coli DEC15B]
 gb|EHY01640.1| ribosomal protein L9 [Escherichia coli DEC15C]
 gb|EHY09449.1| ribosomal protein L9 [Escherichia coli DEC15D]
 gb|EHY14605.1| ribosomal protein L9 [Escherichia coli DEC15E]
 gb|EIA34020.1| 50S ribosomal protein L9 [Escherichia coli SCI-07]
 gb|AFH19490.1| 50S ribosomal protein L9 [Escherichia coli KO11FL]
 gb|AFH14082.1| 50S ribosomal protein L9 [Escherichia coli W]
 gb|EID64556.1| 50S ribosomal protein L9 [Shigella flexneri 5a str. M90T]
 gb|EID69116.1| 50S ribosomal protein L9 [Escherichia coli W26]
 gb|EIE35145.1| 50S ribosomal protein L9 [Escherichia coli J53]
 gb|EIE57701.1| 50S ribosomal protein L9 [Escherichia coli AI27]
 gb|EIF18736.1| 50S ribosomal protein L9 [Escherichia coli O32:H37 str. P4]
 gb|EIF87532.1| 50S ribosomal protein L9 [Escherichia coli M919]
 gb|EIG42989.1| 50S ribosomal protein L9 [Escherichia coli B799]
 gb|EIG50922.1| 50S ribosomal protein L9 [Escherichia coli H730]
 gb|EIG72647.1| 50S ribosomal protein L9 [Escherichia sp. 4_1_40B]
 gb|EIG79721.1| ribosomal protein L9 [Escherichia coli 1.2741]
 gb|EIG90759.1| ribosomal protein L9 [Escherichia coli 97.0246]
 gb|EIH01603.1| ribosomal protein L9 [Escherichia coli 5.0588]
 gb|EIH13188.1| ribosomal protein L9 [Escherichia coli 97.0259]
 gb|EIH23030.1| ribosomal protein L9 [Escherichia coli 1.2264]
 gb|EIH32741.1| ribosomal protein L9 [Escherichia coli 96.0497]
 gb|EIH46840.1| ribosomal protein L9 [Escherichia coli 99.0741]
 gb|EIH54597.1| ribosomal protein L9 [Escherichia coli 3.2608]
 gb|EIH66152.1| ribosomal protein L9 [Escherichia coli 93.0624]
 gb|EIH80921.1| ribosomal protein L9 [Escherichia coli 4.0522]
 gb|EIH91090.1| ribosomal protein L9 [Escherichia coli JB1-95]
 gb|EIH98061.1| ribosomal protein L9 [Escherichia coli 96.154]
 gb|EII10010.1| ribosomal protein L9 [Escherichia coli 5.0959]
 gb|EII21459.1| ribosomal protein L9 [Escherichia coli 9.0111]
 gb|EII33830.1| ribosomal protein L9 [Escherichia coli 4.0967]
 gb|EII47674.1| ribosomal protein L9 [Escherichia coli 2.3916]
 gb|EII55258.1| ribosomal protein L9 [Escherichia coli 3.3884]
 gb|EII65810.1| ribosomal protein L9 [Escherichia coli 2.4168]
 gb|EII75312.1| ribosomal protein L9 [Escherichia coli 3.2303]
 gb|EII88456.1| ribosomal protein L9 [Escherichia coli 3003]
 gb|EII94375.1| ribosomal protein L9 [Escherichia coli TW07793]
 gb|EIJ01646.1| ribosomal protein L9 [Escherichia coli B41]
 gb|EIJ14198.1| ribosomal protein L9 [Escherichia coli 900105 (10e)]
 gb|AFJ31915.1| 50S ribosomal protein L9 [Escherichia coli Xuzhou21]
 gb|EIL06816.1| 50S ribosomal protein L9 [Escherichia coli O103:H25 str. CVM9340]
 gb|EIL09590.1| 50S ribosomal protein L9 [Escherichia coli O103:H2 str. CVM9450]
 gb|EIL13959.1| 50S ribosomal protein L9 [Escherichia coli O111:H11 str. CVM9534]
 gb|EIL17552.1| 50S ribosomal protein L9 [Escherichia coli O111:H11 str. CVM9545]
 gb|EIL25553.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. CVM9570]
 gb|EIL26254.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. CVM9574]
 gb|EIL38831.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM10026]
 gb|EIL39040.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM9942]
 gb|EIL49612.1| 50S ribosomal protein L9 [Escherichia coli KD2]
 gb|EIL51884.1| 50S ribosomal protein L9 [Escherichia coli KD1]
 gb|EIL58358.1| 50S ribosomal protein L9 [Escherichia coli 541-15]
 gb|EIL63288.1| 50S ribosomal protein L9 [Escherichia coli 541-1]
 gb|EIL64366.1| 50S ribosomal protein L9 [Escherichia coli 576-1]
 gb|EIL70779.1| 50S ribosomal protein L9 [Escherichia coli 75]
 gb|EIL75219.1| 50S ribosomal protein L9 [Escherichia coli CUMT8]
 gb|EIL81946.1| 50S ribosomal protein L9 [Escherichia coli HM605]
 gb|EIN15827.1| ribosomal protein L9 [Escherichia coli FRIK1996]
 gb|EIN16345.1| ribosomal protein L9 [Escherichia coli FDA505]
 gb|EIN16854.1| ribosomal protein L9 [Escherichia coli FDA517]
 gb|EIN33164.1| ribosomal protein L9 [Escherichia coli FRIK1985]
 gb|EIN33943.1| ribosomal protein L9 [Escherichia coli 93-001]
 gb|EIN35690.1| ribosomal protein L9 [Escherichia coli FRIK1990]
 gb|EIN49407.1| ribosomal protein L9 [Escherichia coli PA3]
 gb|EIN52660.1| ribosomal protein L9 [Escherichia coli PA5]
 gb|EIN55818.1| ribosomal protein L9 [Escherichia coli PA9]
 gb|EIN65900.1| ribosomal protein L9 [Escherichia coli PA10]
 gb|EIN69972.1| ribosomal protein L9 [Escherichia coli PA14]
 gb|EIN71019.1| ribosomal protein L9 [Escherichia coli PA15]
 gb|EIN83805.1| ribosomal protein L9 [Escherichia coli PA22]
 gb|EIN88805.1| ribosomal protein L9 [Escherichia coli PA24]
 gb|EIN90027.1| ribosomal protein L9 [Escherichia coli PA25]
 gb|EIN95923.1| ribosomal protein L9 [Escherichia coli PA28]
 gb|EIO07240.1| ribosomal protein L9 [Escherichia coli PA31]
 gb|EIO07666.1| ribosomal protein L9 [Escherichia coli PA32]
 gb|EIO11450.1| ribosomal protein L9 [Escherichia coli PA33]
 gb|EIO24700.1| ribosomal protein L9 [Escherichia coli PA40]
 gb|EIO25232.1| ribosomal protein L9 [Escherichia coli PA39]
 gb|EIO30184.1| ribosomal protein L9 [Escherichia coli PA41]
 gb|EIO33140.1| ribosomal protein L9 [Escherichia coli PA42]
 gb|EIO46333.1| ribosomal protein L9 [Escherichia coli TW06591]
 gb|EIO51734.1| ribosomal protein L9 [Escherichia coli TW07945]
 gb|EIO59842.1| ribosomal protein L9 [Escherichia coli TW11039]
 gb|EIO63252.1| ribosomal protein L9 [Escherichia coli TW10246]
 gb|EIO66086.1| ribosomal protein L9 [Escherichia coli TW09098]
 gb|EIO71044.1| ribosomal protein L9 [Escherichia coli TW09109]
 gb|EIO86534.1| ribosomal protein L9 [Escherichia coli TW10119]
 gb|EIO86928.1| ribosomal protein L9 [Escherichia coli TW09195]
 gb|EIO87873.1| ribosomal protein L9 [Escherichia coli EC4203]
 gb|EIO92654.1| ribosomal protein L9 [Escherichia coli EC4196]
 gb|EIP03587.1| ribosomal protein L9 [Escherichia coli O157:H7 str. TW14313]
 gb|EIP05788.1| ribosomal protein L9 [Escherichia coli TW14301]
 gb|EIP10661.1| ribosomal protein L9 [Escherichia coli EC4421]
 gb|EIP19858.1| ribosomal protein L9 [Escherichia coli EC4422]
 gb|EIP24228.1| ribosomal protein L9 [Escherichia coli EC4013]
 gb|EIP27384.1| ribosomal protein L9 [Escherichia coli EC4402]
 gb|EIP35440.1| ribosomal protein L9 [Escherichia coli EC4439]
 gb|EIP40454.1| ribosomal protein L9 [Escherichia coli EC4436]
 gb|EIP49222.1| ribosomal protein L9 [Escherichia coli EC4437]
 gb|EIP50153.1| ribosomal protein L9 [Escherichia coli EC4448]
 gb|EIP56914.1| ribosomal protein L9 [Escherichia coli EC1738]
 gb|EIP64142.1| ribosomal protein L9 [Escherichia coli EC1734]
 gb|EIP72473.1| ribosomal protein L9 [Escherichia coli EC1845]
 gb|EIP73153.1| ribosomal protein L9 [Escherichia coli EC1863]
 gb|EIQ02892.1| ribosomal protein L9 [Shigella flexneri 2850-71]
 gb|EIQ03138.1| ribosomal protein L9 [Shigella flexneri CCH060]
 gb|EIQ05966.1| ribosomal protein L9 [Shigella flexneri K-1770]
 gb|EIQ15903.1| ribosomal protein L9 [Shigella flexneri K-315]
 gb|EIQ19575.1| ribosomal protein L9 [Shigella flexneri K-404]
 gb|EIQ22584.1| ribosomal protein L9 [Shigella boydii 965-58]
 gb|EIQ28645.1| ribosomal protein L9 [Shigella boydii 4444-74]
 gb|EIQ38336.1| ribosomal protein L9 [Shigella sonnei 3233-85]
 gb|EIQ48869.1| ribosomal protein L9 [Shigella sonnei 3226-85]
 gb|EIQ49573.1| ribosomal protein L9 [Shigella sonnei 4822-66]
 gb|EIQ50784.1| ribosomal protein L9 [Shigella flexneri 1235-66]
 gb|EIQ55529.1| ribosomal protein L9 [Shigella dysenteriae 225-75]
 gb|EIQ58182.1| ribosomal protein L9 [Escherichia coli EPECa12]
 gb|EIQ66150.1| ribosomal protein L9 [Escherichia coli EPEC C342-62]
 gb|EJE62771.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. CVM9634]
 gb|EJE65030.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM10224]
 gb|EJE65408.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. CVM9602]
 gb|EJE82749.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM10021]
 gb|EJE85207.1| 50S ribosomal protein L9 [Escherichia coli O111:H11 str. CVM9553]
 gb|EJE91296.1| 50S ribosomal protein L9 [Escherichia coli O111:H11 str. CVM9455]
 gb|EJE99002.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM9952]
 gb|EJF02513.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. CVM10030]
 gb|EJK93152.1| ribosomal protein L9 [Escherichia coli STEC_O31]
 gb|EJL09738.1| ribosomal protein L9 [Shigella flexneri 6603-63]
 gb|EJL10359.1| ribosomal protein L9 [Shigella sonnei str. Moseley]
 gb|EJZ61062.1| ribosomal protein L9 [Shigella flexneri 1485-80]
 gb|AFS59159.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str.
           2009EL-2050]
 gb|AFS76378.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 2011C-3493]
 gb|AFS84333.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str.
           2009EL-2071]
 gb|EKG96385.1| ribosomal protein L9 [Escherichia coli FRIK920]
 gb|EKG97022.1| ribosomal protein L9 [Escherichia coli PA34]
 gb|EKH07597.1| ribosomal protein L9 [Escherichia coli PA7]
 gb|EKH13535.1| ribosomal protein L9 [Escherichia coli FDA507]
 gb|EKH21141.1| ribosomal protein L9 [Escherichia coli FDA504]
 gb|EKH25546.1| ribosomal protein L9 [Escherichia coli FDA506]
 gb|EKH26777.1| ribosomal protein L9 [Escherichia coli FRIK1999]
 gb|EKH32802.1| ribosomal protein L9 [Escherichia coli FRIK1997]
 gb|EKH43550.1| ribosomal protein L9 [Escherichia coli NE037]
 gb|EKH54046.1| ribosomal protein L9 [Escherichia coli NE1487]
 gb|EKH54995.1| ribosomal protein L9 [Escherichia coli PA4]
 gb|EKH63351.1| ribosomal protein L9 [Escherichia coli FRIK2001]
 gb|EKH64037.1| ribosomal protein L9 [Escherichia coli PA23]
 gb|EKH65445.1| ribosomal protein L9 [Escherichia coli PA49]
 gb|EKH72761.1| ribosomal protein L9 [Escherichia coli PA45]
 gb|EKH79953.1| ribosomal protein L9 [Escherichia coli TT12B]
 gb|EKH88684.1| ribosomal protein L9 [Escherichia coli 5905]
 gb|EKH96972.1| ribosomal protein L9 [Escherichia coli CB7326]
 gb|EKI01175.1| ribosomal protein L9 [Escherichia coli MA6]
 gb|EKI03180.1| ribosomal protein L9 [Escherichia coli EC96038]
 gb|EKI06159.1| ribosomal protein L9 [Escherichia coli 5412]
 gb|EKI14626.1| ribosomal protein L9 [Escherichia coli TW15901]
 gb|EKI21741.1| ribosomal protein L9 [Escherichia coli TW00353]
 gb|EKI21852.1| ribosomal protein L9 [Escherichia coli ARS4.2123]
 gb|EKI32805.1| ribosomal protein L9 [Escherichia coli 3006]
 gb|EKI33570.1| ribosomal protein L9 [Escherichia coli PA38]
 gb|EKI34181.1| ribosomal protein L9 [Escherichia coli 07798]
 gb|EKI46861.1| ribosomal protein L9 [Escherichia coli EC1735]
 gb|EKI47707.1| ribosomal protein L9 [Escherichia coli N1]
 gb|EKI57300.1| ribosomal protein L9 [Escherichia coli EC1736]
 gb|EKI59451.1| ribosomal protein L9 [Escherichia coli EC1737]
 gb|EKI68674.1| ribosomal protein L9 [Escherichia coli EC1846]
 gb|EKI72820.1| ribosomal protein L9 [Escherichia coli EC1847]
 gb|EKI76957.1| ribosomal protein L9 [Escherichia coli EC1848]
 gb|EKI83077.1| ribosomal protein L9 [Escherichia coli EC1849]
 gb|EKI90657.1| ribosomal protein L9 [Escherichia coli EC1850]
 gb|EKI93489.1| ribosomal protein L9 [Escherichia coli EC1856]
 gb|EKJ01000.1| ribosomal protein L9 [Escherichia coli EC1862]
 gb|EKJ06318.1| ribosomal protein L9 [Escherichia coli EC1864]
 gb|EKJ10963.1| ribosomal protein L9 [Escherichia coli EC1865]
 gb|EKJ20203.1| ribosomal protein L9 [Escherichia coli EC1868]
 gb|EKJ25077.1| ribosomal protein L9 [Escherichia coli EC1866]
 gb|EKJ31438.1| ribosomal protein L9 [Escherichia coli EC1869]
 gb|EKJ36804.1| ribosomal protein L9 [Escherichia coli EC1870]
 gb|EKJ38003.1| ribosomal protein L9 [Escherichia coli NE098]
 gb|EKJ48314.1| ribosomal protein L9 [Escherichia coli FRIK523]
 gb|EKJ54424.1| ribosomal protein L9 [Escherichia coli 0.1288]
 gb|EKJ55420.1| ribosomal protein L9 [Escherichia coli 0.1304]
 gb|EKJ82434.1| 50S ribosomal protein L9 [Escherichia coli AD30]
 gb|EKK21359.1| ribosomal protein L9 [Escherichia coli 5.2239]
 gb|EKK21671.1| ribosomal protein L9 [Escherichia coli 3.4870]
 gb|EKK28269.1| ribosomal protein L9 [Escherichia coli 6.0172]
 gb|EKK38247.1| ribosomal protein L9 [Escherichia coli 8.0566]
 gb|EKK38510.1| ribosomal protein L9 [Escherichia coli 8.0586]
 gb|EKK39220.1| ribosomal protein L9 [Escherichia coli 8.0569]
 gb|EKK50890.1| ribosomal protein L9 [Escherichia coli 10.0833]
 gb|EKK52614.1| ribosomal protein L9 [Escherichia coli 8.2524]
 gb|EKK62350.1| ribosomal protein L9 [Escherichia coli 10.0869]
 gb|EKK67102.1| ribosomal protein L9 [Escherichia coli 88.0221]
 gb|EKK72051.1| ribosomal protein L9 [Escherichia coli 8.0416]
 gb|EKK80807.1| ribosomal protein L9 [Escherichia coli 10.0821]
 emb|CCK49543.1| 50S ribosomal subunit protein L9 [Escherichia coli chi7122]
 emb|CCJ46862.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|EKT97966.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str.
           CFSAN001629]
 gb|EKT98532.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str.
           CFSAN001632]
 gb|EKU07136.1| 50S ribosomal protein L9 [Escherichia coli O111:H11 str.
           CFSAN001630]
 gb|EKV70882.1| ribosomal protein L9 [Escherichia coli 89.0511]
 gb|EKV73864.1| ribosomal protein L9 [Escherichia coli 88.1467]
 gb|EKV74940.1| ribosomal protein L9 [Escherichia coli 88.1042]
 gb|EKV85787.1| ribosomal protein L9 [Escherichia coli 90.0091]
 gb|EKV89679.1| ribosomal protein L9 [Escherichia coli 90.2281]
 gb|EKV92161.1| ribosomal protein L9 [Escherichia coli 90.0039]
 gb|EKW04528.1| ribosomal protein L9 [Escherichia coli 93.0055]
 gb|EKW04601.1| ribosomal protein L9 [Escherichia coli 93.0056]
 gb|EKW08804.1| ribosomal protein L9 [Escherichia coli 94.0618]
 gb|EKW21217.1| ribosomal protein L9 [Escherichia coli 95.0183]
 gb|EKW22563.1| ribosomal protein L9 [Escherichia coli 95.1288]
 gb|EKW27038.1| ribosomal protein L9 [Escherichia coli 95.0943]
 gb|EKW37258.1| ribosomal protein L9 [Escherichia coli 96.0428]
 gb|EKW38452.1| ribosomal protein L9 [Escherichia coli 96.0427]
 gb|EKW44259.1| ribosomal protein L9 [Escherichia coli 96.0939]
 gb|EKW51821.1| ribosomal protein L9 [Escherichia coli 96.0932]
 gb|EKW58416.1| ribosomal protein L9 [Escherichia coli 96.0107]
 gb|EKW59923.1| ribosomal protein L9 [Escherichia coli 97.0003]
 gb|EKW69047.1| ribosomal protein L9 [Escherichia coli 97.1742]
 gb|EKW71873.1| ribosomal protein L9 [Escherichia coli 97.0007]
 gb|EKW76556.1| ribosomal protein L9 [Escherichia coli 99.0672]
 gb|EKW85712.1| ribosomal protein L9 [Escherichia coli 99.0678]
 gb|EKW86628.1| ribosomal protein L9 [Escherichia coli 99.0713]
 gb|EKY34766.1| ribosomal protein L9 [Escherichia coli 96.0109]
 gb|EKY35046.1| ribosomal protein L9 [Escherichia coli 97.0010]
 gb|EKY90373.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02030]
 gb|EKY91117.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02033-1]
 gb|EKY91873.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02092]
 gb|EKZ04933.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02093]
 gb|EKZ06158.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02281]
 gb|EKZ08024.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02318]
 gb|EKZ20273.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-02913]
 gb|EKZ23781.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-03439]
 gb|EKZ23892.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-03943]
 gb|EKZ34901.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. 11-04080]
 gb|EKZ37051.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-9990]
 gb|EKZ37918.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-9450]
 gb|EKZ47795.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-4984]
 gb|EKZ49724.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-4986]
 gb|EKZ56524.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-4987]
 gb|EKZ60436.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-4988]
 gb|EKZ65798.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-5603]
 gb|EKZ73488.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-5604]
 gb|EKZ78807.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec12-0465]
 gb|EKZ82044.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-6006]
 gb|EKZ88624.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec12-0466]
 gb|EKZ93135.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. Ec11-9941]
 gb|ELB95502.1| 50S ribosomal protein L9 [Escherichia coli KTE4]
 gb|ELC04949.1| 50S ribosomal protein L9 [Escherichia coli KTE2]
 gb|ELC05328.1| 50S ribosomal protein L9 [Escherichia coli KTE5]
 gb|ELC12956.1| 50S ribosomal protein L9 [Escherichia coli KTE10]
 gb|ELC15200.1| 50S ribosomal protein L9 [Escherichia sp. KTE11]
 gb|ELC16933.1| 50S ribosomal protein L9 [Escherichia coli KTE12]
 gb|ELC24200.1| 50S ribosomal protein L9 [Escherichia coli KTE15]
 gb|ELC32558.1| 50S ribosomal protein L9 [Escherichia coli KTE16]
 gb|ELC33536.1| 50S ribosomal protein L9 [Escherichia coli KTE21]
 gb|ELC40089.1| 50S ribosomal protein L9 [Escherichia coli KTE25]
 gb|ELC42064.1| 50S ribosomal protein L9 [Escherichia coli KTE26]
 gb|ELC46145.1| 50S ribosomal protein L9 [Escherichia coli KTE28]
 gb|ELC65638.1| 50S ribosomal protein L9 [Escherichia coli KTE44]
 gb|ELC68219.1| 50S ribosomal protein L9 [Escherichia coli KTE178]
 gb|ELC68744.1| 50S ribosomal protein L9 [Escherichia coli KTE181]
 gb|ELC76465.1| 50S ribosomal protein L9 [Escherichia coli KTE187]
 gb|ELC78593.1| 50S ribosomal protein L9 [Escherichia coli KTE189]
 gb|ELC85957.1| 50S ribosomal protein L9 [Escherichia coli KTE188]
 gb|ELC92811.1| 50S ribosomal protein L9 [Escherichia coli KTE193]
 gb|ELC94303.1| 50S ribosomal protein L9 [Escherichia coli KTE191]
 gb|ELD01384.1| 50S ribosomal protein L9 [Escherichia coli KTE204]
 gb|ELD03699.1| 50S ribosomal protein L9 [Escherichia coli KTE201]
 gb|ELD05208.1| 50S ribosomal protein L9 [Escherichia coli KTE205]
 gb|ELD10843.1| 50S ribosomal protein L9 [Escherichia coli KTE206]
 gb|ELD16555.1| 50S ribosomal protein L9 [Escherichia coli KTE208]
 gb|ELD25379.1| 50S ribosomal protein L9 [Escherichia coli KTE210]
 gb|ELD26386.1| 50S ribosomal protein L9 [Escherichia coli KTE212]
 gb|ELD29171.1| 50S ribosomal protein L9 [Escherichia coli KTE213]
 gb|ELD42366.1| 50S ribosomal protein L9 [Escherichia coli KTE214]
 gb|ELD45969.1| 50S ribosomal protein L9 [Escherichia coli KTE220]
 gb|ELD46089.1| 50S ribosomal protein L9 [Escherichia coli KTE216]
 gb|ELD47885.1| 50S ribosomal protein L9 [Escherichia coli KTE224]
 gb|ELD56757.1| 50S ribosomal protein L9 [Escherichia coli KTE228]
 gb|ELD65587.1| 50S ribosomal protein L9 [Escherichia coli KTE230]
 gb|ELD67790.1| 50S ribosomal protein L9 [Escherichia coli KTE233]
 gb|ELD74289.1| 50S ribosomal protein L9 [Escherichia coli KTE234]
 gb|ELD74598.1| 50S ribosomal protein L9 [Escherichia coli KTE235]
 gb|ELD77411.1| 50S ribosomal protein L9 [Escherichia coli KTE236]
 gb|ELD82717.1| 50S ribosomal protein L9 [Escherichia coli KTE237]
 gb|ELD93449.1| 50S ribosomal protein L9 [Escherichia coli KTE47]
 gb|ELE01165.1| 50S ribosomal protein L9 [Escherichia coli KTE49]
 gb|ELE06811.1| 50S ribosomal protein L9 [Escherichia coli KTE51]
 gb|ELE08507.1| 50S ribosomal protein L9 [Escherichia coli KTE53]
 gb|ELE14458.1| 50S ribosomal protein L9 [Escherichia coli KTE56]
 gb|ELE16706.1| 50S ribosomal protein L9 [Escherichia coli KTE55]
 gb|ELE26326.1| 50S ribosomal protein L9 [Escherichia coli KTE57]
 gb|ELE27349.1| 50S ribosomal protein L9 [Escherichia coli KTE58]
 gb|ELE36334.1| 50S ribosomal protein L9 [Escherichia coli KTE60]
 gb|ELE37035.1| 50S ribosomal protein L9 [Escherichia coli KTE62]
 gb|ELE44770.1| 50S ribosomal protein L9 [Escherichia coli KTE67]
 gb|ELE46074.1| 50S ribosomal protein L9 [Escherichia coli KTE66]
 gb|ELE46988.1| 50S ribosomal protein L9 [Escherichia coli KTE72]
 gb|ELE49997.1| 50S ribosomal protein L9 [Escherichia coli KTE75]
 gb|ELE54848.1| 50S ribosomal protein L9 [Escherichia coli KTE76]
 gb|ELE66568.1| 50S ribosomal protein L9 [Escherichia coli KTE80]
 gb|ELE67078.1| 50S ribosomal protein L9 [Escherichia coli KTE77]
 gb|ELE75225.1| 50S ribosomal protein L9 [Escherichia coli KTE81]
 gb|ELE76241.1| 50S ribosomal protein L9 [Escherichia coli KTE83]
 gb|ELE76796.1| 50S ribosomal protein L9 [Escherichia coli KTE86]
 gb|ELE86360.1| 50S ribosomal protein L9 [Escherichia coli KTE93]
 gb|ELE94264.1| 50S ribosomal protein L9 [Escherichia coli KTE87]
 gb|ELF03099.1| 50S ribosomal protein L9 [Escherichia coli KTE111]
 gb|ELF04101.1| 50S ribosomal protein L9 [Escherichia coli KTE116]
 gb|ELF07248.1| 50S ribosomal protein L9 [Escherichia coli KTE142]
 gb|ELF12875.1| 50S ribosomal protein L9 [Escherichia coli KTE119]
 gb|ELF13583.1| 50S ribosomal protein L9 [Escherichia coli KTE143]
 gb|ELF23363.1| 50S ribosomal protein L9 [Escherichia coli KTE156]
 gb|ELF25598.1| 50S ribosomal protein L9 [Escherichia coli KTE162]
 gb|ELF28778.1| 50S ribosomal protein L9 [Escherichia coli KTE161]
 gb|ELF33528.1| 50S ribosomal protein L9 [Escherichia coli KTE169]
 gb|ELF42455.1| 50S ribosomal protein L9 [Escherichia coli KTE171]
 gb|ELF43979.1| 50S ribosomal protein L9 [Escherichia coli KTE8]
 gb|ELF46758.1| 50S ribosomal protein L9 [Escherichia coli KTE6]
 gb|ELF59938.1| 50S ribosomal protein L9 [Escherichia coli KTE9]
 gb|ELF60673.1| 50S ribosomal protein L9 [Escherichia coli KTE17]
 gb|ELF68512.1| 50S ribosomal protein L9 [Escherichia coli KTE18]
 gb|ELF70027.1| 50S ribosomal protein L9 [Escherichia coli KTE45]
 gb|ELF77767.1| 50S ribosomal protein L9 [Escherichia coli KTE23]
 gb|ELF79142.1| 50S ribosomal protein L9 [Escherichia coli KTE43]
 gb|ELF79334.1| 50S ribosomal protein L9 [Escherichia coli KTE42]
 gb|ELF82707.1| 50S ribosomal protein L9 [Escherichia coli KTE29]
 gb|ELF87644.1| 50S ribosomal protein L9 [Escherichia coli KTE22]
 gb|ELF92265.1| 50S ribosomal protein L9 [Escherichia coli KTE46]
 gb|ELG02135.1| 50S ribosomal protein L9 [Escherichia coli KTE48]
 gb|ELG08536.1| 50S ribosomal protein L9 [Escherichia coli KTE50]
 gb|ELG09956.1| 50S ribosomal protein L9 [Escherichia coli KTE54]
 gb|ELG19751.1| 50S ribosomal protein L9 [Escherichia coli KTE59]
 gb|ELG20253.1| 50S ribosomal protein L9 [Escherichia coli KTE63]
 gb|ELG21360.1| 50S ribosomal protein L9 [Escherichia coli KTE65]
 gb|ELG30481.1| 50S ribosomal protein L9 [Escherichia coli KTE78]
 gb|ELG33851.1| 50S ribosomal protein L9 [Escherichia coli KTE79]
 gb|ELG38454.1| 50S ribosomal protein L9 [Escherichia coli KTE91]
 gb|ELG45359.1| 50S ribosomal protein L9 [Escherichia coli KTE101]
 gb|ELG45666.1| 50S ribosomal protein L9 [Escherichia coli KTE115]
 gb|ELG57597.1| 50S ribosomal protein L9 [Escherichia coli KTE118]
 gb|ELG61749.1| 50S ribosomal protein L9 [Escherichia coli KTE123]
 gb|ELG65616.1| 50S ribosomal protein L9 [Escherichia coli KTE135]
 gb|ELG73774.1| 50S ribosomal protein L9 [Escherichia coli KTE136]
 gb|ELG76679.1| 50S ribosomal protein L9 [Escherichia coli KTE140]
 gb|ELG79759.1| 50S ribosomal protein L9 [Escherichia coli KTE144]
 gb|ELG82282.1| 50S ribosomal protein L9 [Escherichia coli KTE141]
 gb|ELG89775.1| 50S ribosomal protein L9 [Escherichia coli KTE147]
 gb|ELG92910.1| 50S ribosomal protein L9 [Escherichia coli KTE146]
 gb|ELG98128.1| 50S ribosomal protein L9 [Escherichia coli KTE154]
 gb|ELH03428.1| 50S ribosomal protein L9 [Escherichia coli KTE158]
 gb|ELH09815.1| 50S ribosomal protein L9 [Escherichia coli KTE165]
 gb|ELH14070.1| 50S ribosomal protein L9 [Escherichia coli KTE192]
 gb|ELH19591.1| 50S ribosomal protein L9 [Escherichia coli KTE194]
 gb|ELH30278.1| 50S ribosomal protein L9 [Escherichia coli KTE190]
 gb|ELH30716.1| 50S ribosomal protein L9 [Escherichia coli KTE173]
 gb|ELH31513.1| 50S ribosomal protein L9 [Escherichia coli KTE175]
 gb|ELH37421.1| 50S ribosomal protein L9 [Escherichia coli KTE184]
 gb|ELH39014.1| 50S ribosomal protein L9 [Escherichia coli KTE183]
 gb|ELH45763.1| 50S ribosomal protein L9 [Escherichia coli KTE196]
 gb|ELH54813.1| 50S ribosomal protein L9 [Escherichia coli KTE197]
 gb|ELH55131.1| 50S ribosomal protein L9 [Escherichia coli KTE203]
 gb|ELH63830.1| 50S ribosomal protein L9 [Escherichia coli KTE209]
 gb|ELH64692.1| 50S ribosomal protein L9 [Escherichia coli KTE202]
 gb|ELH67807.1| 50S ribosomal protein L9 [Escherichia coli KTE207]
 gb|ELH70914.1| 50S ribosomal protein L9 [Escherichia coli KTE215]
 gb|ELH79462.1| 50S ribosomal protein L9 [Escherichia coli KTE211]
 gb|ELH79648.1| 50S ribosomal protein L9 [Escherichia coli KTE217]
 gb|ELH90343.1| 50S ribosomal protein L9 [Escherichia coli KTE218]
 gb|ELH95501.1| 50S ribosomal protein L9 [Escherichia coli KTE223]
 gb|ELH97176.1| 50S ribosomal protein L9 [Escherichia coli KTE229]
 gb|ELH97278.1| 50S ribosomal protein L9 [Escherichia coli KTE227]
 gb|ELI01868.1| 50S ribosomal protein L9 [Escherichia coli KTE104]
 gb|ELI02753.1| 50S ribosomal protein L9 [Escherichia coli KTE105]
 gb|ELI04844.1| 50S ribosomal protein L9 [Escherichia coli KTE106]
 gb|ELI14361.1| 50S ribosomal protein L9 [Escherichia coli KTE109]
 gb|ELI19040.1| 50S ribosomal protein L9 [Escherichia coli KTE112]
 gb|ELI24520.1| 50S ribosomal protein L9 [Escherichia coli KTE117]
 gb|ELI30595.1| 50S ribosomal protein L9 [Escherichia coli KTE113]
 gb|ELI34017.1| 50S ribosomal protein L9 [Escherichia coli KTE120]
 gb|ELI37093.1| 50S ribosomal protein L9 [Escherichia coli KTE122]
 gb|ELI37395.1| 50S ribosomal protein L9 [Escherichia coli KTE124]
 gb|ELI49716.1| 50S ribosomal protein L9 [Escherichia coli KTE125]
 gb|ELI50197.1| 50S ribosomal protein L9 [Escherichia coli KTE128]
 gb|ELI52864.1| 50S ribosomal protein L9 [Escherichia coli KTE129]
 gb|ELI62474.1| 50S ribosomal protein L9 [Escherichia coli KTE131]
 gb|ELI66316.1| 50S ribosomal protein L9 [Escherichia coli KTE133]
 gb|ELI68565.1| 50S ribosomal protein L9 [Escherichia coli KTE137]
 gb|ELI74662.1| 50S ribosomal protein L9 [Escherichia coli KTE138]
 gb|ELI79892.1| 50S ribosomal protein L9 [Escherichia coli KTE139]
 gb|ELI83058.1| 50S ribosomal protein L9 [Escherichia coli KTE145]
 gb|ELI90449.1| 50S ribosomal protein L9 [Escherichia coli KTE148]
 gb|ELI91681.1| 50S ribosomal protein L9 [Escherichia coli KTE150]
 gb|ELI96379.1| 50S ribosomal protein L9 [Escherichia coli KTE153]
 gb|ELJ05465.1| 50S ribosomal protein L9 [Escherichia coli KTE157]
 gb|ELJ06527.1| 50S ribosomal protein L9 [Escherichia coli KTE160]
 gb|ELJ08649.1| 50S ribosomal protein L9 [Escherichia coli KTE163]
 gb|ELJ19379.1| 50S ribosomal protein L9 [Escherichia coli KTE166]
 gb|ELJ21011.1| 50S ribosomal protein L9 [Escherichia coli KTE167]
 gb|ELJ22501.1| 50S ribosomal protein L9 [Escherichia coli KTE168]
 gb|ELJ32640.1| 50S ribosomal protein L9 [Escherichia coli KTE174]
 gb|ELJ35121.1| 50S ribosomal protein L9 [Escherichia coli KTE176]
 gb|ELJ38072.1| 50S ribosomal protein L9 [Escherichia coli KTE177]
 gb|ELJ47578.1| 50S ribosomal protein L9 [Escherichia coli KTE179]
 gb|ELJ47928.1| 50S ribosomal protein L9 [Escherichia coli KTE180]
 gb|ELJ50943.1| 50S ribosomal protein L9 [Escherichia coli KTE232]
 gb|ELJ61966.1| 50S ribosomal protein L9 [Escherichia coli KTE82]
 gb|ELJ64895.1| 50S ribosomal protein L9 [Escherichia coli KTE85]
 gb|ELJ65102.1| 50S ribosomal protein L9 [Escherichia coli KTE88]
 gb|ELJ76364.1| 50S ribosomal protein L9 [Escherichia coli KTE90]
 gb|ELJ78632.1| 50S ribosomal protein L9 [Escherichia coli KTE95]
 gb|ELJ79452.1| 50S ribosomal protein L9 [Escherichia coli KTE94]
 gb|ELJ90712.1| 50S ribosomal protein L9 [Escherichia coli KTE97]
 gb|ELJ93718.1| 50S ribosomal protein L9 [Escherichia coli KTE99]
 gb|ELL40158.1| 50S ribosomal protein L9 [Escherichia coli J96]
 emb|CCP96235.1| LSU ribosomal protein L9p [Escherichia coli O10:K5(L):H4 str. ATCC
           23506]
 emb|CCQ02265.1| LSU ribosomal protein L9p [Escherichia coli O5:K4(L):H4 str. ATCC
           23502]
 emb|CCQ06977.1| LSU ribosomal protein L9p [Escherichia coli Nissle 1917]
 gb|AGC85128.1| 50S ribosomal protein L9 [Escherichia coli APEC O78]
 gb|ELV14764.1| ribosomal protein L9 [Escherichia coli 99.0814]
 gb|ELV15541.1| ribosomal protein L9 [Escherichia coli 09BKT078844]
 gb|ELV23738.1| ribosomal protein L9 [Escherichia coli 99.0815]
 gb|ELV31396.1| ribosomal protein L9 [Escherichia coli 99.0839]
 gb|ELV35727.1| ribosomal protein L9 [Escherichia coli 99.0848]
 gb|ELV42146.1| ribosomal protein L9 [Escherichia coli 99.0816]
 gb|ELV44664.1| ribosomal protein L9 [Escherichia coli 99.1753]
 gb|ELV47617.1| ribosomal protein L9 [Escherichia coli 99.1775]
 gb|ELV51145.1| ribosomal protein L9 [Escherichia coli 99.1793]
 gb|ELV62323.1| ribosomal protein L9 [Escherichia coli 99.1805]
 gb|ELV63513.1| ribosomal protein L9 [Escherichia coli ATCC 700728]
 gb|ELV64014.1| ribosomal protein L9 [Escherichia coli PA11]
 gb|ELV76996.1| ribosomal protein L9 [Escherichia coli PA19]
 gb|ELV77370.1| ribosomal protein L9 [Escherichia coli PA13]
 gb|ELV86010.1| ribosomal protein L9 [Escherichia coli PA2]
 gb|ELV93577.1| ribosomal protein L9 [Escherichia coli PA48]
 gb|ELV95764.1| ribosomal protein L9 [Escherichia coli PA47]
 gb|ELV99613.1| ribosomal protein L9 [Escherichia coli PA8]
 gb|ELW07889.1| ribosomal protein L9 [Escherichia coli 7.1982]
 gb|ELW09184.1| ribosomal protein L9 [Escherichia coli 99.1781]
 gb|ELW14128.1| ribosomal protein L9 [Escherichia coli 99.1762]
 gb|ELW25886.1| ribosomal protein L9 [Escherichia coli PA35]
 gb|ELW29185.1| ribosomal protein L9 [Escherichia coli 3.4880]
 gb|ELW30333.1| ribosomal protein L9 [Escherichia coli 95.0083]
 gb|ELW38409.1| ribosomal protein L9 [Escherichia coli 99.0670]
 gb|EMD02764.1| 50S ribosomal protein L9 [Escherichia coli O08]
 gb|EMD03254.1| 50S ribosomal protein L9 [Escherichia coli S17]
 gb|EMD05207.1| 50S ribosomal protein L9 [Escherichia coli SEPT362]
 gb|EMR92206.1| 50S ribosomal subunit protein L9 [Escherichia coli ONT:H33 str.
           C48/93]
 gb|EMR94163.1| 50S ribosomal subunit protein L9 [Escherichia coli O104:H4 str.
           E92/11]
 gb|EMR96554.1| 50S ribosomal subunit protein L9 [Escherichia coli O104:H4 str.
           E112/10]
 gb|EMS03747.1| 50S ribosomal subunit protein L9 [Escherichia coli O127:H27 str.
           C43/90]
 gb|EMU56690.1| ribosomal protein L9 [Escherichia coli MP021552.11]
 gb|EMU57055.1| ribosomal protein L9 [Escherichia coli MP021552.7]
 gb|EMU65444.1| ribosomal protein L9 [Escherichia coli MP021552.12]
 gb|EMU73263.1| ribosomal protein L9 [Escherichia coli MP021017.9]
 gb|EMU76161.1| ribosomal protein L9 [Escherichia coli MP021017.5]
 gb|EMU87487.1| ribosomal protein L9 [Escherichia coli MP021017.4]
 gb|EMU88615.1| ribosomal protein L9 [Escherichia coli MP021017.3]
 gb|EMU90262.1| ribosomal protein L9 [Escherichia coli MP021017.2]
 gb|EMV03398.1| ribosomal protein L9 [Escherichia coli MP021017.10]
 gb|EMV06566.1| ribosomal protein L9 [Escherichia coli MP021017.11]
 gb|EMV12087.1| ribosomal protein L9 [Escherichia coli MP021017.12]
 gb|EMV15106.1| ribosomal protein L9 [Escherichia coli C-34666]
 gb|EMV16652.1| ribosomal protein L9 [Escherichia coli BCE034_MS-14]
 gb|EMV29408.1| ribosomal protein L9 [Escherichia coli BCE002_MS12]
 gb|EMV33801.1| ribosomal protein L9 [Escherichia coli 2875000]
 gb|EMV34161.1| ribosomal protein L9 [Escherichia coli BCE019_MS-13]
 gb|EMV42046.1| ribosomal protein L9 [Escherichia coli 2872800]
 gb|EMV51180.1| ribosomal protein L9 [Escherichia coli 2871950]
 gb|EMV51468.1| ribosomal protein L9 [Escherichia coli 2872000]
 gb|EMV53739.1| ribosomal protein L9 [Escherichia coli 2867750]
 gb|EMV66420.1| ribosomal protein L9 [Escherichia coli 2866550]
 gb|EMV67216.1| ribosomal protein L9 [Escherichia coli 2866450]
 gb|EMV69564.1| ribosomal protein L9 [Escherichia coli 2866750]
 gb|EMV81894.1| ribosomal protein L9 [Escherichia coli 2861200]
 gb|EMV85931.1| ribosomal protein L9 [Escherichia coli 2865200]
 gb|EMV87500.1| ribosomal protein L9 [Escherichia coli 2860050]
 gb|EMV96950.1| ribosomal protein L9 [Escherichia coli 2853500]
 gb|EMV97265.1| ribosomal protein L9 [Escherichia coli 2851500]
 gb|EMW01722.1| ribosomal protein L9 [Escherichia coli 2850750]
 gb|EMW13688.1| ribosomal protein L9 [Escherichia coli 2850400]
 gb|EMW14205.1| ribosomal protein L9 [Escherichia coli 2845650]
 gb|EMW15544.1| ribosomal protein L9 [Escherichia coli 2848050]
 gb|EMW27092.1| ribosomal protein L9 [Escherichia coli 2845350]
 gb|EMW39026.1| ribosomal protein L9 [Escherichia coli 2788150]
 gb|EMW45426.1| ribosomal protein L9 [Escherichia coli 2780750]
 gb|EMW46502.1| ribosomal protein L9 [Escherichia coli 2770900]
 gb|EMW51031.1| ribosomal protein L9 [Escherichia coli 2762100]
 gb|EMW55786.1| ribosomal protein L9 [Escherichia coli 2756500]
 gb|EMW64790.1| ribosomal protein L9 [Escherichia coli 2749250]
 gb|EMW70229.1| ribosomal protein L9 [Escherichia coli 2747800]
 gb|EMW71874.1| ribosomal protein L9 [Escherichia coli 2731150]
 gb|EMW74836.1| ribosomal protein L9 [Escherichia coli 180600]
 gb|EMW83247.1| ribosomal protein L9 [Escherichia coli 180050]
 gb|EMW90912.1| ribosomal protein L9 [Escherichia coli 174750]
 gb|EMW92457.1| ribosomal protein L9 [Escherichia coli ThroopD]
 gb|EMW95128.1| ribosomal protein L9 [Escherichia coli P0304777.1]
 gb|EMX10746.1| ribosomal protein L9 [Escherichia coli P0302293.2]
 gb|EMX10927.1| ribosomal protein L9 [Escherichia coli P0302308.1]
 gb|EMX15670.1| ribosomal protein L9 [Escherichia coli P0301867.1]
 gb|EMX27162.1| ribosomal protein L9 [Escherichia coli MP021566.1]
 gb|EMX33612.1| ribosomal protein L9 [Escherichia coli MP021561.2]
 gb|EMX34338.1| ribosomal protein L9 [Escherichia coli MP021552.8]
 gb|EMX34683.1| ribosomal protein L9 [Escherichia coli MP021017.1]
 gb|EMX45119.1| ribosomal protein L9 [Escherichia coli Jurua 20/10]
 gb|EMX47533.1| ribosomal protein L9 [Escherichia coli MP020940.1]
 gb|EMX56926.1| ribosomal protein L9 [Escherichia coli MP020980.2]
 gb|EMX58728.1| ribosomal protein L9 [Escherichia coli Jurua 18/11]
 gb|EMX63876.1| ribosomal protein L9 [Escherichia coli Envira 10/1]
 gb|EMX64161.1| ribosomal protein L9 [Escherichia coli Envira 8/11]
 gb|EMX70555.1| ribosomal protein L9 [Escherichia coli 2726800]
 gb|EMX81468.1| ribosomal protein L9 [Escherichia coli 2719100]
 gb|EMX83822.1| ribosomal protein L9 [Escherichia coli BCE001_MS16]
 gb|EMX84867.1| ribosomal protein L9 [Escherichia coli 2720900]
 gb|EMZ39826.1| 50S ribosomal protein L9 [Escherichia coli SWW33]
 gb|EMZ59978.1| ribosomal protein L9 [Escherichia coli 174900]
 gb|EMZ60545.1| ribosomal protein L9 [Escherichia coli 2846750]
 gb|EMZ62336.1| ribosomal protein L9 [Escherichia coli 2735000]
 gb|EMZ74034.1| ribosomal protein L9 [Escherichia coli 199900.1]
 gb|EMZ74437.1| ribosomal protein L9 [Escherichia coli 2722950]
 gb|EMZ79561.1| ribosomal protein L9 [Escherichia coli p0305293.1]
 gb|EMZ89449.1| ribosomal protein L9 [Escherichia coli P0305260.1]
 gb|EMZ92696.1| ribosomal protein L9 [Escherichia coli P0304816.1]
 gb|ENA00169.1| ribosomal protein L9 [Escherichia coli P0299438.2]
 gb|ENA01101.1| ribosomal protein L9 [Escherichia coli P0299917.1]
 gb|ENA09952.1| ribosomal protein L9 [Escherichia coli P0298942.1]
 gb|ENA11902.1| ribosomal protein L9 [Escherichia coli BCE008_MS-13]
 gb|ENA25604.1| ribosomal protein L9 [Escherichia coli 201600.1]
 gb|ENA26334.1| ribosomal protein L9 [Escherichia coli BCE007_MS-11]
 gb|ENA26645.1| ribosomal protein L9 [Escherichia coli BCE007_MS-11]
 gb|ENA30887.1| ribosomal protein L9 [Escherichia coli P0301867.4]
 gb|ENA41149.1| ribosomal protein L9 [Escherichia coli P0301867.2]
 gb|ENA47030.1| ribosomal protein L9 [Escherichia coli 2726950]
 gb|ENA47425.1| ribosomal protein L9 [Escherichia coli 2729250]
 gb|ENA56235.1| ribosomal protein L9 [Escherichia coli 178900]
 gb|ENA58530.1| ribosomal protein L9 [Escherichia coli 179550]
 gb|ENA61613.1| ribosomal protein L9 [Escherichia coli 180200]
 gb|ENA73619.1| ribosomal protein L9 [Escherichia coli 2730450]
 gb|ENA74604.1| ribosomal protein L9 [Escherichia coli 2730350]
 gb|ENA74991.1| ribosomal protein L9 [Escherichia coli 2741950]
 gb|ENA88480.1| ribosomal protein L9 [Escherichia coli 2860650]
 gb|ENA89254.1| ribosomal protein L9 [Escherichia coli 2862600]
 gb|ENA90216.1| ribosomal protein L9 [Escherichia coli 2864350]
 gb|ENB03950.1| ribosomal protein L9 [Escherichia coli 2866350]
 gb|ENB06274.1| ribosomal protein L9 [Escherichia coli BCE008_MS-01]
 gb|ENB06456.1| ribosomal protein L9 [Escherichia coli 2875150]
 gb|ENB18073.1| ribosomal protein L9 [Escherichia coli BCE011_MS-01]
 gb|ENB23960.1| ribosomal protein L9 [Escherichia coli BCE030_MS-09]
 gb|ENB29504.1| ribosomal protein L9 [Escherichia coli BCE032_MS-12]
 gb|ENB31679.1| ribosomal protein L9 [Escherichia coli MP021561.3]
 gb|ENB34547.1| ribosomal protein L9 [Escherichia coli P0298942.10]
 gb|ENB43977.1| ribosomal protein L9 [Escherichia coli P0298942.11]
 gb|ENB53146.1| ribosomal protein L9 [Escherichia coli P0298942.12]
 gb|ENB56154.1| ribosomal protein L9 [Escherichia coli P0298942.2]
 gb|ENB56284.1| ribosomal protein L9 [Escherichia coli P0298942.15]
 gb|ENB56402.1| ribosomal protein L9 [Escherichia coli P0298942.6]
 gb|ENB71442.1| ribosomal protein L9 [Escherichia coli P0298942.8]
 gb|ENB72156.1| ribosomal protein L9 [Escherichia coli P0298942.9]
 gb|ENB73770.1| ribosomal protein L9 [Escherichia coli P0298942.7]
 gb|ENB84515.1| ribosomal protein L9 [Escherichia coli P0299438.10]
 gb|ENB96254.1| ribosomal protein L9 [Escherichia coli P0299438.11]
 gb|ENB98808.1| ribosomal protein L9 [Escherichia coli P0299438.4]
 gb|ENC00790.1| ribosomal protein L9 [Escherichia coli P0299438.3]
 gb|ENC05810.1| ribosomal protein L9 [Escherichia coli P0299438.5]
 gb|ENC09528.1| ribosomal protein L9 [Escherichia coli P0299438.6]
 gb|ENC10397.1| ribosomal protein L9 [Escherichia coli P0299438.7]
 gb|ENC25521.1| ribosomal protein L9 [Escherichia coli P0299438.8]
 gb|ENC27000.1| ribosomal protein L9 [Escherichia coli P0299438.9]
 gb|ENC27680.1| ribosomal protein L9 [Escherichia coli P02997067.6]
 gb|ENC35627.1| ribosomal protein L9 [Escherichia coli P0299917.10]
 gb|ENC43721.1| ribosomal protein L9 [Escherichia coli P0299917.2]
 gb|ENC49974.1| ribosomal protein L9 [Escherichia coli P0299917.3]
 gb|ENC52148.1| ribosomal protein L9 [Escherichia coli P0299917.4]
 gb|ENC56846.1| ribosomal protein L9 [Escherichia coli P0299917.5]
 gb|ENC66528.1| ribosomal protein L9 [Escherichia coli P0299917.6]
 gb|ENC66973.1| ribosomal protein L9 [Escherichia coli P0299917.8]
 gb|ENC73234.1| ribosomal protein L9 [Escherichia coli P0299917.7]
 gb|ENC79447.1| ribosomal protein L9 [Escherichia coli P0299917.9]
 gb|ENC87030.1| ribosomal protein L9 [Escherichia coli P0301867.8]
 gb|ENC87956.1| ribosomal protein L9 [Escherichia coli P0301867.11]
 gb|ENC95446.1| ribosomal protein L9 [Escherichia coli P0302308.10]
 gb|ENC97972.1| ribosomal protein L9 [Escherichia coli P0302308.11]
 gb|END07204.1| ribosomal protein L9 [Escherichia coli P0302308.3]
 gb|END09156.1| ribosomal protein L9 [Escherichia coli P0302308.2]
 gb|END18723.1| ribosomal protein L9 [Escherichia coli P0302308.4]
 gb|END18965.1| ribosomal protein L9 [Escherichia coli P0302308.5]
 gb|END29651.1| ribosomal protein L9 [Escherichia coli 179100]
 gb|END31481.1| ribosomal protein L9 [Escherichia coli p0305293.13]
 gb|END36638.1| ribosomal protein L9 [Escherichia coli 2733950]
 gb|END37092.1| ribosomal protein L9 [Escherichia coli 2854350]
 gb|END52684.1| ribosomal protein L9 [Escherichia coli BCE006_MS-23]
 gb|END61402.1| ribosomal protein L9 [Escherichia coli P0298942.4]
 gb|END62002.1| ribosomal protein L9 [Escherichia coli P0298942.3]
 gb|END64217.1| ribosomal protein L9 [Escherichia coli P0299483.1]
 gb|END75713.1| ribosomal protein L9 [Escherichia coli P0299483.2]
 gb|END77727.1| ribosomal protein L9 [Escherichia coli P0299483.3]
 gb|END86932.1| ribosomal protein L9 [Escherichia coli P0301867.13]
 gb|END88055.1| ribosomal protein L9 [Escherichia coli P0301904.3]
 gb|END94294.1| ribosomal protein L9 [Escherichia coli P0302293.7]
 gb|ENE00061.1| ribosomal protein L9 [Escherichia coli P0304799.3]
 gb|ENE03505.1| ribosomal protein L9 [Escherichia coli P0305260.2]
 gb|ENE05507.1| ribosomal protein L9 [Escherichia coli p0305293.14]
 gb|ENE17025.1| ribosomal protein L9 [Escherichia coli P0302293.10]
 gb|ENE19563.1| ribosomal protein L9 [Escherichia coli P0302293.3]
 gb|ENE26703.1| ribosomal protein L9 [Escherichia coli P0302293.4]
 gb|ENE33158.1| ribosomal protein L9 [Escherichia coli P0302293.6]
 gb|ENE37948.1| ribosomal protein L9 [Escherichia coli P0302293.8]
 gb|ENE41599.1| ribosomal protein L9 [Escherichia coli P0304777.10]
 gb|ENE47247.1| ribosomal protein L9 [Escherichia coli P0302293.9]
 gb|ENE52737.1| ribosomal protein L9 [Escherichia coli P0304777.11]
 gb|ENE59989.1| ribosomal protein L9 [Escherichia coli P0304777.12]
 gb|ENE61154.1| ribosomal protein L9 [Escherichia coli P0304777.13]
 gb|ENE66070.1| ribosomal protein L9 [Escherichia coli P0304777.14]
 gb|ENE72709.1| ribosomal protein L9 [Escherichia coli P0304777.15]
 gb|ENE75453.1| ribosomal protein L9 [Escherichia coli P0304777.2]
 gb|ENE83158.1| ribosomal protein L9 [Escherichia coli P0304777.3]
 gb|ENE90713.1| ribosomal protein L9 [Escherichia coli P0304777.4]
 gb|ENE97246.1| ribosomal protein L9 [Escherichia coli P0304777.7]
 gb|ENF05039.1| ribosomal protein L9 [Escherichia coli P0304777.8]
 gb|ENF07884.1| ribosomal protein L9 [Escherichia coli P0304777.9]
 gb|ENF09962.1| ribosomal protein L9 [Escherichia coli P0304777.5]
 gb|ENF16548.1| ribosomal protein L9 [Escherichia coli P0304816.11]
 gb|ENF20218.1| ribosomal protein L9 [Escherichia coli P0304816.10]
 gb|ENF27493.1| ribosomal protein L9 [Escherichia coli P0304816.12]
 gb|ENF29959.1| ribosomal protein L9 [Escherichia coli P0304816.14]
 gb|ENF36406.1| ribosomal protein L9 [Escherichia coli P0304816.13]
 gb|ENF42713.1| ribosomal protein L9 [Escherichia coli P0304816.15]
 gb|ENF45416.1| ribosomal protein L9 [Escherichia coli P0304816.2]
 gb|ENF45984.1| ribosomal protein L9 [Escherichia coli P0304816.6]
 gb|ENF59266.1| ribosomal protein L9 [Escherichia coli P0304816.7]
 gb|ENF64708.1| ribosomal protein L9 [Escherichia coli P0304816.8]
 gb|ENF67031.1| ribosomal protein L9 [Escherichia coli P0304816.9]
 gb|ENF70358.1| ribosomal protein L9 [Escherichia coli P0305260.10]
 gb|ENF79141.1| ribosomal protein L9 [Escherichia coli P0305260.11]
 gb|ENF81194.1| ribosomal protein L9 [Escherichia coli P0305260.12]
 gb|ENF85164.1| ribosomal protein L9 [Escherichia coli P0305260.13]
 gb|ENF93397.1| ribosomal protein L9 [Escherichia coli P0305260.15]
 gb|ENF97682.1| ribosomal protein L9 [Escherichia coli P0305260.3]
 gb|ENF99316.1| ribosomal protein L9 [Escherichia coli P0305260.4]
 gb|ENG08949.1| ribosomal protein L9 [Escherichia coli P0305260.5]
 gb|ENG10970.1| ribosomal protein L9 [Escherichia coli P0305260.6]
 gb|ENG11606.1| ribosomal protein L9 [Escherichia coli P0305260.7]
 gb|ENG21520.1| ribosomal protein L9 [Escherichia coli P0305260.8]
 gb|ENG25563.1| ribosomal protein L9 [Escherichia coli p0305293.10]
 gb|ENG28917.1| ribosomal protein L9 [Escherichia coli P0305260.9]
 gb|ENG36797.1| ribosomal protein L9 [Escherichia coli p0305293.11]
 gb|ENG39217.1| ribosomal protein L9 [Escherichia coli p0305293.12]
 gb|ENG48067.1| ribosomal protein L9 [Escherichia coli p0305293.15]
 gb|ENG51678.1| ribosomal protein L9 [Escherichia coli p0305293.2]
 gb|ENG57174.1| ribosomal protein L9 [Escherichia coli p0305293.3]
 gb|ENG59025.1| ribosomal protein L9 [Escherichia coli p0305293.4]
 gb|ENG67688.1| ribosomal protein L9 [Escherichia coli p0305293.8]
 gb|ENG74606.1| ribosomal protein L9 [Escherichia coli p0305293.9]
 gb|ENG78926.1| ribosomal protein L9 [Escherichia coli 178200]
 gb|ENG84734.1| ribosomal protein L9 [Escherichia coli 178850]
 gb|ENG93575.1| ribosomal protein L9 [Escherichia coli P0301867.3]
 gb|ENG97685.1| ribosomal protein L9 [Escherichia coli P0301867.5]
 gb|ENH05331.1| ribosomal protein L9 [Escherichia coli P0301867.7]
 gb|ENH11820.1| ribosomal protein L9 [Escherichia coli P0302308.13]
 gb|ENH13615.1| ribosomal protein L9 [Escherichia coli P0302308.12]
 gb|ENH15676.1| ribosomal protein L9 [Escherichia coli P0302308.14]
 gb|ENH28017.1| ribosomal protein L9 [Escherichia coli P0304816.4]
 gb|ENH28134.1| ribosomal protein L9 [Escherichia coli P0304816.3]
 gb|ENH34861.1| ribosomal protein L9 [Escherichia coli P0304816.5]
 gb|ENH41186.1| ribosomal protein L9 [Escherichia coli p0305293.5]
 gb|ENH48611.1| ribosomal protein L9 [Escherichia coli p0305293.7]
 gb|ENH51785.1| ribosomal protein L9 [Escherichia coli p0305293.6]
 gb|ENO10473.1| 50S ribosomal subunit protein L9 [Escherichia coli O157:H43 str.
           T22]
 gb|EOQ46990.1| 50S ribosomal protein L9 [Escherichia coli KTE33]
 gb|EOR51154.1| 50S ribosomal subunit protein L9 [Escherichia coli ATCC 25922]
 gb|EOU27214.1| 50S ribosomal protein L9 [Escherichia coli KTE13]
 gb|EOU39522.1| 50S ribosomal protein L9 [Escherichia coli KTE7]
 gb|EOU41168.1| 50S ribosomal protein L9 [Escherichia coli KTE3]
 gb|EOU45426.1| 50S ribosomal protein L9 [Escherichia coli KTE231]
 gb|EOU48446.1| 50S ribosomal protein L9 [Escherichia sp. KTE114]
 gb|EOU57806.1| 50S ribosomal protein L9 [Escherichia coli KTE35]
 gb|EOU59115.1| 50S ribosomal protein L9 [Escherichia coli KTE19]
 gb|EOU59703.1| 50S ribosomal protein L9 [Escherichia coli KTE20]
 gb|EOU77758.1| 50S ribosomal protein L9 [Escherichia sp. KTE31]
 gb|EOU79503.1| 50S ribosomal protein L9 [Escherichia coli KTE27]
 gb|EOU84748.1| 50S ribosomal protein L9 [Escherichia coli KTE24]
 gb|EOU86094.1| 50S ribosomal protein L9 [Escherichia coli KTE37]
 gb|EOU96348.1| 50S ribosomal protein L9 [Escherichia coli KTE36]
 gb|EOU99869.1| 50S ribosomal protein L9 [Escherichia coli KTE38]
 gb|EOV00891.1| 50S ribosomal protein L9 [Escherichia coli KTE34]
 gb|EOV02369.1| 50S ribosomal protein L9 [Escherichia coli KTE40]
 gb|EOV02470.1| 50S ribosomal protein L9 [Escherichia coli KTE195]
 gb|EOV18483.1| 50S ribosomal protein L9 [Escherichia coli KTE200]
 gb|EOV19732.1| 50S ribosomal protein L9 [Escherichia coli KTE199]
 gb|EOV30019.1| 50S ribosomal protein L9 [Escherichia coli KTE219]
 gb|EOV31413.1| 50S ribosomal protein L9 [Escherichia coli KTE221]
 gb|EOV32170.1| 50S ribosomal protein L9 [Escherichia coli KTE198]
 gb|EOV39758.1| 50S ribosomal protein L9 [Escherichia coli KTE222]
 gb|EOV44889.1| 50S ribosomal protein L9 [Escherichia coli KTE61]
 gb|EOV45784.1| 50S ribosomal protein L9 [Escherichia sp. KTE52]
 gb|EOV52654.1| 50S ribosomal protein L9 [Escherichia coli KTE64]
 gb|EOV55794.1| 50S ribosomal protein L9 [Escherichia coli KTE68]
 gb|EOV59060.1| 50S ribosomal protein L9 [Escherichia coli KTE69]
 gb|EOV68738.1| 50S ribosomal protein L9 [Escherichia coli KTE70]
 gb|EOV73129.1| 50S ribosomal protein L9 [Escherichia coli KTE73]
 gb|EOV83586.1| 50S ribosomal protein L9 [Escherichia coli KTE74]
 gb|EOV85346.1| 50S ribosomal protein L9 [Escherichia coli KTE71]
 gb|EOV85547.1| 50S ribosomal protein L9 [Escherichia coli KTE89]
 gb|EOV92030.1| 50S ribosomal protein L9 [Escherichia sp. KTE96]
 gb|EOW04712.1| 50S ribosomal protein L9 [Escherichia coli KTE98]
 gb|EOW12276.1| 50S ribosomal protein L9 [Escherichia coli KTE100]
 gb|EOW12454.1| 50S ribosomal protein L9 [Escherichia coli KTE102]
 gb|EOW20796.1| 50S ribosomal protein L9 [Escherichia coli KTE103]
 gb|EOW25198.1| 50S ribosomal protein L9 [Escherichia coli KTE108]
 gb|EOW25447.1| 50S ribosomal protein L9 [Escherichia coli KTE121]
 gb|EOW30233.1| 50S ribosomal protein L9 [Escherichia coli KTE107]
 gb|EOW41292.1| 50S ribosomal protein L9 [Escherichia coli KTE126]
 gb|EOW43968.1| 50S ribosomal protein L9 [Escherichia coli KTE127]
 gb|EOW53975.1| 50S ribosomal protein L9 [Escherichia coli KTE132]
 gb|EOW54088.1| 50S ribosomal protein L9 [Escherichia coli KTE130]
 gb|EOW56753.1| 50S ribosomal protein L9 [Escherichia sp. KTE159]
 gb|EOW61036.1| 50S ribosomal protein L9 [Escherichia coli KTE134]
 gb|EOW64616.1| 50S ribosomal protein L9 [Escherichia coli KTE155]
 gb|EOW71487.1| 50S ribosomal protein L9 [Escherichia sp. KTE172]
 gb|EOW72842.1| 50S ribosomal protein L9 [Escherichia coli KTE170]
 gb|EOW90022.1| 50S ribosomal protein L9 [Escherichia coli KTE182]
 gb|EOW99906.1| 50S ribosomal protein L9 [Escherichia coli KTE1]
 gb|EOX02719.1| 50S ribosomal protein L9 [Escherichia coli KTE41]
 gb|EOX03644.1| 50S ribosomal protein L9 [Escherichia coli KTE226]
 gb|EOX14132.1| 50S ribosomal protein L9 [Escherichia coli KTE225]
 gb|EOX17002.1| 50S ribosomal protein L9 [Escherichia coli KTE240]
 gb|EOX26908.1| 50S ribosomal protein L9 [Escherichia coli KTE185]
 gb|EOX27175.1| 50S ribosomal protein L9 [Escherichia coli KTE186]
 gb|EPH48473.1| LSU ribosomal protein L9p [Escherichia coli E2265]
 emb|CDC84333.1| 50S ribosomal protein L9 [Escherichia coli CAG:4]
 gb|EQM98600.1| 50S ribosomal protein L9 [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN01052.1| 50S ribosomal protein L9 [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN02052.1| 50S ribosomal protein L9 [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN13721.1| 50S ribosomal protein L9 [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN19169.1| 50S ribosomal protein L9 [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN23034.1| 50S ribosomal protein L9 [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN26519.1| 50S ribosomal protein L9 [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN26769.1| 50S ribosomal protein L9 [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN36808.1| 50S ribosomal protein L9 [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN40347.1| 50S ribosomal protein L9 [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN42575.1| 50S ribosomal protein L9 [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN48681.1| 50S ribosomal protein L9 [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN58163.1| 50S ribosomal protein L9 [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN58940.1| 50S ribosomal protein L9 [Escherichia coli HVH 18 (4-8589585)]
 gb|EQN64897.1| 50S ribosomal protein L9 [Escherichia coli HVH 19 (4-7154984)]
 gb|EQN70909.1| 50S ribosomal protein L9 [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN74634.1| 50S ribosomal protein L9 [Escherichia coli HVH 22 (4-2258986)]
 gb|EQN79892.1| 50S ribosomal protein L9 [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN87999.1| 50S ribosomal protein L9 [Escherichia coli HVH 25 (4-5851939)]
 gb|EQN88207.1| 50S ribosomal protein L9 [Escherichia coli HVH 26 (4-5703913)]
 gb|EQN89398.1| 50S ribosomal protein L9 [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO01739.1| 50S ribosomal protein L9 [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO02356.1| 50S ribosomal protein L9 [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO09639.1| 50S ribosomal protein L9 [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO11239.1| 50S ribosomal protein L9 [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO18088.1| 50S ribosomal protein L9 [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO25679.1| 50S ribosomal protein L9 [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO31606.1| 50S ribosomal protein L9 [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO36777.1| 50S ribosomal protein L9 [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO38072.1| 50S ribosomal protein L9 [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO38862.1| 50S ribosomal protein L9 [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO48431.1| 50S ribosomal protein L9 [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO53306.1| 50S ribosomal protein L9 [Escherichia coli HVH 41 (4-2677849)]
 gb|EQO56799.1| 50S ribosomal protein L9 [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO58381.1| 50S ribosomal protein L9 [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO66801.1| 50S ribosomal protein L9 [Escherichia coli HVH 44 (4-2298570)]
 gb|EQO74792.1| 50S ribosomal protein L9 [Escherichia coli HVH 45 (4-3129918)]
 gb|EQO77318.1| 50S ribosomal protein L9 [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO79740.1| 50S ribosomal protein L9 [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO86361.1| 50S ribosomal protein L9 [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO92051.1| 50S ribosomal protein L9 [Escherichia coli HVH 53 (4-0631051)]
 gb|EQO94034.1| 50S ribosomal protein L9 [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP03485.1| 50S ribosomal protein L9 [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP05892.1| 50S ribosomal protein L9 [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP11068.1| 50S ribosomal protein L9 [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP15567.1| 50S ribosomal protein L9 [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP19882.1| 50S ribosomal protein L9 [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP28884.1| 50S ribosomal protein L9 [Escherichia coli HVH 65 (4-2262045)]
 gb|EQP29781.1| 50S ribosomal protein L9 [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP30754.1| 50S ribosomal protein L9 [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP41964.1| 50S ribosomal protein L9 [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP44514.1| 50S ribosomal protein L9 [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP46200.1| 50S ribosomal protein L9 [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP57470.1| 50S ribosomal protein L9 [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP64070.1| 50S ribosomal protein L9 [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP64426.1| 50S ribosomal protein L9 [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP66714.1| 50S ribosomal protein L9 [Escherichia coli HVH 79 (4-2512823)]
 gb|EQP83083.1| 50S ribosomal protein L9 [Escherichia coli HVH 80 (4-2428830)]
 gb|EQP85578.1| 50S ribosomal protein L9 [Escherichia coli HVH 84 (4-1021478)]
 gb|EQP88215.1| 50S ribosomal protein L9 [Escherichia coli HVH 85 (4-0792144)]
 gb|EQP93753.1| 50S ribosomal protein L9 [Escherichia coli HVH 82 (4-2209276)]
 gb|EQP98351.1| 50S ribosomal protein L9 [Escherichia coli HVH 89 (4-5885604)]
 gb|EQP98621.1| 50S ribosomal protein L9 [Escherichia coli HVH 87 (4-5977630)]
 gb|EQP99233.1| 50S ribosomal protein L9 [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ09729.1| 50S ribosomal protein L9 [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ14673.1| 50S ribosomal protein L9 [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ19557.1| 50S ribosomal protein L9 [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ21289.1| 50S ribosomal protein L9 [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ31521.1| 50S ribosomal protein L9 [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ43411.1| 50S ribosomal protein L9 [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ44205.1| 50S ribosomal protein L9 [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ45333.1| 50S ribosomal protein L9 [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ45768.1| 50S ribosomal protein L9 [Escherichia coli HVH 104 (4-6977960)]
 gb|EQQ54830.1| 50S ribosomal protein L9 [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ62002.1| 50S ribosomal protein L9 [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ62686.1| 50S ribosomal protein L9 [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ62873.1| 50S ribosomal protein L9 [Escherichia coli HVH 107 (4-5860571)]
 gb|EQQ70826.1| 50S ribosomal protein L9 [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ80932.1| 50S ribosomal protein L9 [Escherichia coli HVH 112 (4-5987253)]
 gb|EQQ82135.1| 50S ribosomal protein L9 [Escherichia coli HVH 114 (4-7037740)]
 gb|EQQ82954.1| 50S ribosomal protein L9 [Escherichia coli HVH 113 (4-7535473)]
 gb|EQQ97159.1| 50S ribosomal protein L9 [Escherichia coli HVH 115 (4-4465997)]
 gb|EQR02252.1| 50S ribosomal protein L9 [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR07765.1| 50S ribosomal protein L9 [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR10242.1| 50S ribosomal protein L9 [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR12073.1| 50S ribosomal protein L9 [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR15478.1| 50S ribosomal protein L9 [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR23739.1| 50S ribosomal protein L9 [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR30080.1| 50S ribosomal protein L9 [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR31167.1| 50S ribosomal protein L9 [Escherichia coli HVH 121 (4-6877826)]
 gb|EQR38074.1| 50S ribosomal protein L9 [Escherichia coli HVH 125 (4-2634716)]
 gb|EQR43782.1| 50S ribosomal protein L9 [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR49349.1| 50S ribosomal protein L9 [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR54531.1| 50S ribosomal protein L9 [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR57839.1| 50S ribosomal protein L9 [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR60718.1| 50S ribosomal protein L9 [Escherichia coli HVH 132 (4-6876862)]
 gb|EQR70799.1| 50S ribosomal protein L9 [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR73215.1| 50S ribosomal protein L9 [Escherichia coli HVH 135 (4-4449320)]
 gb|EQR74975.1| 50S ribosomal protein L9 [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR82550.1| 50S ribosomal protein L9 [Escherichia coli HVH 137 (4-2124971)]
 gb|EQR89316.1| 50S ribosomal protein L9 [Escherichia coli HVH 138 (4-6066704)]
 gb|EQR90465.1| 50S ribosomal protein L9 [Escherichia coli HVH 139 (4-3192644)]
 gb|EQR98105.1| 50S ribosomal protein L9 [Escherichia coli HVH 140 (4-5894387)]
 gb|EQR98642.1| 50S ribosomal protein L9 [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS08821.1| 50S ribosomal protein L9 [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS11254.1| 50S ribosomal protein L9 [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS12011.1| 50S ribosomal protein L9 [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS19863.1| 50S ribosomal protein L9 [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS28612.1| 50S ribosomal protein L9 [Escherichia coli HVH 147 (4-5893887)]
 gb|EQS29115.1| 50S ribosomal protein L9 [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS34355.1| 50S ribosomal protein L9 [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS44324.1| 50S ribosomal protein L9 [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS44821.1| 50S ribosomal protein L9 [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS49323.1| 50S ribosomal protein L9 [Escherichia coli HVH 150 (4-3258106)]
 gb|EQS57485.1| 50S ribosomal protein L9 [Escherichia coli HVH 158 (4-3224287)]
 gb|EQS60721.1| 50S ribosomal protein L9 [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS70080.1| 50S ribosomal protein L9 [Escherichia coli HVH 161 (4-3119890)]
 gb|EQS73362.1| 50S ribosomal protein L9 [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS75467.1| 50S ribosomal protein L9 [Escherichia coli HVH 162 (4-5627982)]
 gb|EQS78402.1| 50S ribosomal protein L9 [Escherichia coli HVH 164 (4-5953081)]
 gb|EQS83359.1| 50S ribosomal protein L9 [Escherichia coli HVH 167 (4-6073565)]
 gb|EQS91539.1| 50S ribosomal protein L9 [Escherichia coli HVH 169 (4-1075578)]
 gb|EQS95637.1| 50S ribosomal protein L9 [Escherichia coli HVH 171 (4-3191958)]
 gb|EQS97333.1| 50S ribosomal protein L9 [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT05561.1| 50S ribosomal protein L9 [Escherichia coli HVH 172 (4-3248542)]
 gb|EQT13664.1| 50S ribosomal protein L9 [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT18086.1| 50S ribosomal protein L9 [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT18235.1| 50S ribosomal protein L9 [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT21995.1| 50S ribosomal protein L9 [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT31859.1| 50S ribosomal protein L9 [Escherichia coli HVH 182 (4-0985554)]
 gb|EQT32919.1| 50S ribosomal protein L9 [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT38814.1| 50S ribosomal protein L9 [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT44777.1| 50S ribosomal protein L9 [Escherichia coli HVH 185 (4-2876639)]
 gb|EQT52565.1| 50S ribosomal protein L9 [Escherichia coli HVH 186 (4-3405044)]
 gb|EQT55068.1| 50S ribosomal protein L9 [Escherichia coli HVH 187 (4-4471660)]
 gb|EQT56735.1| 50S ribosomal protein L9 [Escherichia coli HVH 188 (4-2356988)]
 gb|EQT71499.1| 50S ribosomal protein L9 [Escherichia coli HVH 189 (4-3220125)]
 gb|EQT71719.1| 50S ribosomal protein L9 [Escherichia coli HVH 190 (4-3255514)]
 gb|EQT72102.1| 50S ribosomal protein L9 [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT77982.1| 50S ribosomal protein L9 [Escherichia coli HVH 192 (4-3054470)]
 gb|EQT84479.1| 50S ribosomal protein L9 [Escherichia coli HVH 193 (4-3331423)]
 gb|EQT88475.1| 50S ribosomal protein L9 [Escherichia coli HVH 195 (3-7155360)]
 gb|EQT96596.1| 50S ribosomal protein L9 [Escherichia coli HVH 196 (4-4530470)]
 gb|EQT98900.1| 50S ribosomal protein L9 [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU05419.1| 50S ribosomal protein L9 [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU06408.1| 50S ribosomal protein L9 [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU07116.1| 50S ribosomal protein L9 [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU18217.1| 50S ribosomal protein L9 [Escherichia coli HVH 200 (4-4449924)]
 gb|EQU18497.1| 50S ribosomal protein L9 [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU28261.1| 50S ribosomal protein L9 [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU29773.1| 50S ribosomal protein L9 [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU34718.1| 50S ribosomal protein L9 [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU41780.1| 50S ribosomal protein L9 [Escherichia coli HVH 205 (4-3094677)]
 gb|EQU45935.1| 50S ribosomal protein L9 [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU51706.1| 50S ribosomal protein L9 [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU56099.1| 50S ribosomal protein L9 [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU61427.1| 50S ribosomal protein L9 [Escherichia coli HVH 209 (4-3062651)]
 gb|EQU66079.1| 50S ribosomal protein L9 [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU67001.1| 50S ribosomal protein L9 [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU75657.1| 50S ribosomal protein L9 [Escherichia coli HVH 213 (4-3042928)]
 gb|EQU81894.1| 50S ribosomal protein L9 [Escherichia coli HVH 215 (4-3008371)]
 gb|EQU87722.1| 50S ribosomal protein L9 [Escherichia coli HVH 217 (4-1022806)]
 gb|EQU89383.1| 50S ribosomal protein L9 [Escherichia coli HVH 216 (4-3042952)]
 gb|EQU95618.1| 50S ribosomal protein L9 [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV01807.1| 50S ribosomal protein L9 [Escherichia coli HVH 221 (4-3136817)]
 gb|EQV03473.1| 50S ribosomal protein L9 [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV08291.1| 50S ribosomal protein L9 [Escherichia coli HVH 222 (4-2977443)]
 gb|EQV16830.1| 50S ribosomal protein L9 [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV20732.1| 50S ribosomal protein L9 [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV20852.1| 50S ribosomal protein L9 [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV28886.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 30 (63a)]
 gb|EQV36415.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 32 (66a)]
 gb|EQV40429.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 33 (68a)]
 gb|EQV47784.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 43 (105a)]
 gb|EQV52924.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 44 (106a)]
 gb|EQV61175.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 56 (169a)]
 gb|EQV61527.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 61 (174a)]
 gb|EQV62114.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 58 (171a)]
 gb|EQV75779.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 68 (182a)]
 gb|EQV76273.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 70 (185a)]
 gb|EQV77782.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 62 (175a)]
 gb|EQV89598.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 71 (186a)]
 gb|EQV93813.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 73 (195a)]
 gb|EQV95682.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 77 (202a)]
 gb|EQV96576.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 118 (317a)]
 gb|EQW07759.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 131 (358a)]
 gb|EQW12124.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3014-1]
 gb|EQW12861.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3022-1]
 gb|EQW24699.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3033-1]
 gb|EQW25835.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3052-1]
 gb|EQW26533.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3041-1]
 gb|EQW36815.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3053-1]
 gb|EQW39452.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3065-1]
 gb|EQW45261.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3087-1]
 gb|EQW50705.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3097-1]
 gb|EQW54276.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3088-1]
 gb|EQW60460.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3113-1]
 gb|EQW61960.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3108-1]
 gb|EQW70035.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3117-1]
 gb|EQW73381.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3121-1]
 gb|EQW78052.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3122-1]
 gb|EQW81788.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3124-1]
 gb|EQW85682.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3139-1]
 gb|EQW97174.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3140-1]
 gb|EQW97583.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3152-1]
 gb|EQX05573.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3159-1]
 gb|EQX06157.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3155-1]
 gb|EQX13688.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3160-1]
 gb|EQX14054.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3161-1]
 gb|EQX21991.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3162-1]
 gb|EQX26664.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3163-1]
 gb|EQX28495.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3172-1]
 gb|EQX36568.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3173-1]
 gb|EQX39490.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3175-1]
 gb|EQX46481.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3174-1]
 gb|EQX50338.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3176-1]
 gb|EQX51141.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3178-1]
 gb|EQX62211.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3185-1]
 gb|EQX63154.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3180-1]
 gb|EQX71568.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3193-1]
 gb|EQX74574.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3190-1]
 gb|EQX79374.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3199-1]
 gb|EQX81861.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3200-1]
 gb|EQX91634.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3201-1]
 gb|EQX94753.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3203-1]
 gb|EQX95431.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3206-1]
 gb|EQY06667.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3208-1]
 gb|EQY08654.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3212-1]
 gb|EQY09323.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3215-1]
 gb|EQY17649.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3216-1]
 gb|EQY23525.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3217-1]
 gb|EQY26783.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3220-1]
 gb|EQY35307.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3221-1]
 gb|EQY35852.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3222-1]
 gb|EQY38058.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3230-1]
 gb|EQY50461.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3233-1]
 gb|EQY51074.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3244-1]
 gb|EQY63356.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3264-1]
 gb|EQY64295.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3257-1]
 gb|EQY71421.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3268-1]
 gb|EQY79922.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3304-1]
 gb|EQY81762.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3317-1]
 gb|EQY82331.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3314-1]
 gb|EQY93425.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3318-1]
 gb|EQY93708.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3329-1]
 gb|EQY95251.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3337-1]
 gb|EQZ06970.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3341-1]
 gb|EQZ10030.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3355-1]
 gb|EQZ12207.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3391-1]
 gb|EQZ19033.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3490-1]
 gb|EQZ28600.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3592-1]
 gb|EQZ29270.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3585-1]
 gb|EQZ33422.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3617-1]
 gb|EQZ33715.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3609-1]
 gb|EQZ46159.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3632-1]
 gb|EQZ47875.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3656-1]
 gb|EQZ48634.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3662-1]
 gb|EQZ59635.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3671-1]
 gb|EQZ60259.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3682-1]
 gb|EQZ63923.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3687-1]
 gb|EQZ71386.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3694-1]
 gb|EQZ72526.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3702-1]
 gb|EQZ84655.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3707-1]
 gb|EQZ85390.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3705-1]
 gb|EQZ85823.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3703-1]
 gb|EQZ94123.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3718-1]
 gb|ERA01680.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3805-1]
 gb|ERA03371.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3821-1]
 gb|ERA13304.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3889-1]
 gb|ERA14578.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3893-1]
 gb|ERA15190.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3834-1]
 gb|ERA29214.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3955-1]
 gb|ERA29569.1| 50S ribosomal protein L9 [Escherichia coli UMEA 4075-1]
 gb|ERA32348.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3899-1]
 gb|ERA40757.1| 50S ribosomal protein L9 [Escherichia coli UMEA 4076-1]
 gb|ERA41738.1| 50S ribosomal protein L9 [Escherichia coli UMEA 4207-1]
 gb|ERA55802.1| 50S ribosomal protein L9 [Escherichia coli 95NR1]
 gb|ERA63493.1| 50S ribosomal protein L9 [Escherichia coli HVH 155 (4-4509048)]
 gb|ERA64753.1| 50S ribosomal protein L9 [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA64982.1| 50S ribosomal protein L9 [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA72340.1| 50S ribosomal protein L9 [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA80600.1| 50S ribosomal protein L9 [Escherichia coli HVH 160 (4-5695937)]
 gb|ERA85536.1| 50S ribosomal protein L9 [Escherichia coli HVH 210 (4-3042480)]
 gb|ERA87057.1| 50S ribosomal protein L9 [Escherichia coli HVH 228 (4-7787030)]
 gb|ERA97036.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 3 (4a)]
 gb|ERA99105.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 7 (16a)]
 gb|ERA99216.1| 50S ribosomal protein L9 [Escherichia coli KOEGE 10 (25a)]
 gb|ERB09691.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3144-1]
 gb|ERB12000.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3150-1]
 gb|ERB13277.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3151-1]
 gb|ERB24099.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3271-1]
 gb|ERB28727.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3292-1]
 gb|ERB29026.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3298-1]
 gb|ERB67686.1| ribosomal protein L9 [Escherichia coli B107]
 gb|ERB67906.1| ribosomal protein L9 [Escherichia coli B102]
 gb|ERB68921.1| ribosomal protein L9 [Escherichia coli 09BKT076207]
 gb|ERB80981.1| ribosomal protein L9 [Escherichia coli B26-1]
 gb|ERB85378.1| ribosomal protein L9 [Escherichia coli B26-2]
 gb|ERB92299.1| ribosomal protein L9 [Escherichia coli B28-1]
 gb|ERB92672.1| ribosomal protein L9 [Escherichia coli B28-2]
 gb|ERC02299.1| ribosomal protein L9 [Escherichia coli B29-1]
 gb|ERC09639.1| ribosomal protein L9 [Escherichia coli B29-2]
 gb|ERC11752.1| ribosomal protein L9 [Escherichia coli B36-1]
 gb|ERC17318.1| ribosomal protein L9 [Escherichia coli B36-2]
 gb|ERC25226.1| ribosomal protein L9 [Escherichia coli B7-1]
 gb|ERC29975.1| ribosomal protein L9 [Escherichia coli B7-2]
 gb|ERC33849.1| ribosomal protein L9 [Escherichia coli B93]
 gb|ERC40257.1| ribosomal protein L9 [Escherichia coli B94]
 gb|ERC48175.1| ribosomal protein L9 [Escherichia coli B95]
 gb|ERC51711.1| ribosomal protein L9 [Escherichia coli TW07509]
 gb|ERC53782.1| ribosomal protein L9 [Escherichia coli 08BKT055439]
 gb|ERC62301.1| ribosomal protein L9 [Escherichia coli Bd5610_99]
 gb|ERC66293.1| ribosomal protein L9 [Escherichia coli T1840_97]
 gb|ERC74419.1| ribosomal protein L9 [Escherichia coli T234_00]
 gb|ERC78897.1| ribosomal protein L9 [Escherichia coli 14A]
 gb|ERC81312.1| ribosomal protein L9 [Escherichia coli T924_01]
 gb|ERC90291.1| ribosomal protein L9 [Escherichia coli 2886-75]
 gb|ERC94179.1| ribosomal protein L9 [Escherichia coli B103]
 gb|ERC94695.1| ribosomal protein L9 [Escherichia coli B104]
 gb|ERD05861.1| ribosomal protein L9 [Escherichia coli B105]
 gb|ERD10040.1| ribosomal protein L9 [Escherichia coli B106]
 gb|ERD10605.1| ribosomal protein L9 [Escherichia coli B108]
 gb|ERD22824.1| ribosomal protein L9 [Escherichia coli B109]
 gb|ERD27931.1| ribosomal protein L9 [Escherichia coli B113]
 gb|ERD37667.1| ribosomal protein L9 [Escherichia coli B114]
 gb|ERD37765.1| ribosomal protein L9 [Escherichia coli B112]
 gb|ERD40920.1| ribosomal protein L9 [Escherichia coli B15]
 gb|ERD45769.1| ribosomal protein L9 [Escherichia coli B17]
 gb|ERD55579.1| ribosomal protein L9 [Escherichia coli B40-1]
 gb|ERD56308.1| ribosomal protein L9 [Escherichia coli B40-2]
 gb|ERD59523.1| ribosomal protein L9 [Escherichia coli B49-2]
 gb|ERD69396.1| ribosomal protein L9 [Escherichia coli B5-2]
 gb|ERD73870.1| ribosomal protein L9 [Escherichia coli B83]
 gb|ERD77305.1| ribosomal protein L9 [Escherichia coli B84]
 gb|ERD84456.1| ribosomal protein L9 [Escherichia coli B85]
 gb|ERD89037.1| ribosomal protein L9 [Escherichia coli B86]
 gb|ERD98419.1| 50S ribosomal protein L9 [Escherichia coli 95JB1]
 gb|ERE00715.1| ribosomal protein L9 [Escherichia coli 08BKT77219]
 gb|ERE11158.1| ribosomal protein L9 [Escherichia coli 09BKT024447]
 gb|ERE14781.1| ribosomal protein L9 [Escherichia coli T1282_01]
 gb|ERE22928.1| ribosomal protein L9 [Escherichia coli B89]
 gb|ERE24902.1| ribosomal protein L9 [Escherichia coli B90]
 gb|ERE29874.1| ribosomal protein L9 [Escherichia coli Tx1686]
 gb|ERE36626.1| ribosomal protein L9 [Escherichia coli Tx3800]
 gb|ERF50276.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3652-1]
 gb|ERF95988.1| 50S ribosomal protein L9 [Escherichia coli O104:H21 str.
           CFSAN002237]
 gb|AGW11240.1| 50S ribosomal protein L9 [Escherichia coli LY180]
 emb|CDH67953.1| 50S ribosomal protein L9 [Escherichia coli PMV-1]
 gb|AGX36113.1| 50S ribosomal subunit protein L9 [synthetic Escherichia coli
           C321.deltaA]
 gb|ERO93434.1| 50S ribosomal protein L9 [Escherichia coli BWH 24]
 gb|ERO99307.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 19C]
 gb|ESA25450.1| LSU ribosomal protein L9p [Escherichia coli SCD2]
 gb|ESA30039.1| LSU ribosomal protein L9p [Escherichia coli SCD1]
 gb|ESA68822.1| ribosomal protein L9 [Escherichia coli 113303]
 gb|ESA71576.1| ribosomal protein L9 [Escherichia coli 907357]
 gb|ESA71840.1| ribosomal protein L9 [Escherichia coli 113290]
 gb|ESA76603.1| ribosomal protein L9 [Escherichia coli 110957]
 gb|ESA91014.1| ribosomal protein L9 [Escherichia coli 909945-2]
 gb|ESA91362.1| ribosomal protein L9 [Escherichia coli 907779]
 gb|ESA93521.1| ribosomal protein L9 [Escherichia coli 907713]
 gb|ESC95299.1| ribosomal protein L9 [Escherichia coli 907446]
 gb|ESD01099.1| ribosomal protein L9 [Escherichia coli 907391]
 gb|ESD02188.1| ribosomal protein L9 [Escherichia coli 113302]
 gb|ESD04244.1| ribosomal protein L9 [Escherichia coli 907672]
 gb|ESD08074.1| ribosomal protein L9 [Escherichia coli 907700]
 gb|ESD22574.1| ribosomal protein L9 [Escherichia coli 907710]
 gb|ESD27250.1| ribosomal protein L9 [Escherichia coli 907701]
 gb|ESD29722.1| ribosomal protein L9 [Escherichia coli 907715]
 gb|ESD34303.1| ribosomal protein L9 [Escherichia coli 907892]
 gb|ESD40850.1| ribosomal protein L9 [Escherichia coli 908519]
 gb|ESD44534.1| ribosomal protein L9 [Escherichia coli 907889]
 gb|ESD52264.1| ribosomal protein L9 [Escherichia coli 908522]
 gb|ESD56104.1| ribosomal protein L9 [Escherichia coli 908521]
 gb|ESD62120.1| ribosomal protein L9 [Escherichia coli 908524]
 gb|ESD64997.1| ribosomal protein L9 [Escherichia coli 908555]
 gb|ESD65105.1| ribosomal protein L9 [Escherichia coli 908541]
 gb|ESD75669.1| ribosomal protein L9 [Escherichia coli 908525]
 gb|ESD85360.1| ribosomal protein L9 [Escherichia coli 908573]
 gb|ESD86640.1| ribosomal protein L9 [Escherichia coli 908585]
 gb|ESD90763.1| ribosomal protein L9 [Escherichia coli 908616]
 gb|ESD99631.1| ribosomal protein L9 [Escherichia coli 908624]
 gb|ESE03058.1| ribosomal protein L9 [Escherichia coli 908632]
 gb|ESE09291.1| ribosomal protein L9 [Escherichia coli 908658]
 gb|ESE17024.1| ribosomal protein L9 [Escherichia coli 908675]
 gb|ESE23297.1| ribosomal protein L9 [Escherichia coli 908691]
 gb|ESE26443.1| ribosomal protein L9 [Escherichia coli 910096-2]
 gb|ESE35872.1| ribosomal protein L9 [Escherichia coli A25922R]
 gb|ESE36670.1| ribosomal protein L9 [Escherichia coli A35218R]
 gb|AGY86830.1| 50S ribosomal protein L9 [Escherichia coli JJ1886]
 gb|ESJ98744.1| 50S ribosomal protein L9 [Escherichia coli HVH 98 (4-5799287)]
 gb|ESJ99943.1| 50S ribosomal protein L9 [Escherichia coli HVH 50 (4-2593475)]
 gb|ESK01836.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3336-1]
 gb|ESK12626.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3290-1]
 gb|ESK22251.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3426-1]
 gb|ESK23819.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3342-1]
 gb|ESK24297.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3693-1]
 gb|ESK26770.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3323-1]
 gb|ESL16853.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 39]
 gb|ESL31261.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 37]
 gb|ESL31707.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 38]
 gb|ESM26187.1| 50S ribosomal protein L9 [Escherichia coli BWH 32]
 gb|ESP09506.1| 50S ribosomal protein L9 [Escherichia coli HVH 36 (4-5675286)]
 gb|ESP12095.1| 50S ribosomal protein L9 [Escherichia coli HVH 136 (4-5970458)]
 gb|ESP12839.1| 50S ribosomal protein L9 [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP14023.1| 50S ribosomal protein L9 [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP27877.1| 50S ribosomal protein L9 [Escherichia coli HVH 178 (4-3189163)]
 gb|ESP30439.1| 50S ribosomal protein L9 [Escherichia coli HVH 152 (4-3447545)]
 gb|ESP35302.1| 50S ribosomal protein L9 [Escherichia coli HVH 148 (4-3192490)]
 gb|ESP39723.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3148-1]
 gb|ESP40124.1| 50S ribosomal protein L9 [Escherichia coli HVH 108 (4-6924867)]
 emb|CDJ74434.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MC4100]
 gb|ESS97526.1| LSU ribosomal protein L9p [Escherichia coli CE549]
 gb|ESS97712.1| LSU ribosomal protein L9p [Escherichia coli CE516]
 gb|EST01849.1| LSU ribosomal protein L9p [Escherichia coli CE418]
 gb|EST64726.1| 50S ribosomal protein L9 [Escherichia coli ECC-Z]
 gb|EST66815.1| 50S ribosomal protein L9 [Escherichia coli P4-NR]
 gb|EST67065.1| 50S ribosomal protein L9 [Escherichia coli P4-96]
 gb|EST78406.1| 50S ribosomal protein L9 [Escherichia coli ECA-0157]
 gb|EST79861.1| 50S ribosomal protein L9 [Escherichia coli ECA-727]
 gb|ESV05672.1| LSU ribosomal protein L9p [Escherichia coli E1777]
 gb|ETD57667.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2215]
 gb|ETD58339.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2209]
 gb|ETE10694.1| 50S ribosomal protein L9 [Escherichia coli LAU-EC8]
 gb|ETE12494.1| 50S ribosomal protein L9 [Escherichia coli LAU-EC6]
 gb|ETE24056.1| 50S ribosomal protein L9 [Escherichia coli LAU-EC10]
 gb|ETE29920.1| 50S ribosomal protein L9 [Escherichia coli LAU-EC7]
 gb|ETE37940.1| 50S ribosomal protein L9 [Escherichia coli LAU-EC9]
 gb|ETF14268.1| 50S ribosomal protein L9 [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF18533.1| 50S ribosomal protein L9 [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF19649.1| 50S ribosomal protein L9 [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF27933.1| 50S ribosomal protein L9 [Escherichia coli HVH 214 (4-3062198)]
 gb|ETF33454.1| 50S ribosomal protein L9 [Escherichia coli UMEA 3489-1]
 gb|ETI79064.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2196]
 gb|ETI80201.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2219]
 gb|ETJ11845.1| 50S ribosomal protein L9 [Escherichia coli DORA_A_5_14_21]
 gb|ETJ59337.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2193]
 gb|ETJ67793.1| 50S ribosomal protein L9 [Escherichia coli ATCC 35150]
 gb|ETJ80609.1| 50S ribosomal protein L9 [Escherichia coli ATCC BAA-2192]
 emb|CDK48789.1| LSU ribosomal protein L9p [Escherichia coli IS1]
 emb|CDK55138.1| LSU ribosomal protein L9p [Escherichia coli IS5]
 gb|AHE59511.1| 50S ribosomal protein L9 [Escherichia albertii KF1]
 emb|CDK83837.1| LSU ribosomal protein L9p [Escherichia coli IS25]
 emb|CDL27090.1| LSU ribosomal protein L9p [Escherichia coli ISC7]
 emb|CDK73563.1| LSU ribosomal protein L9p [Klebsiella pneumoniae IS22]
 emb|CDK57634.1| LSU ribosomal protein L9p [Escherichia coli IS9]
 emb|CDL04935.1| LSU ribosomal protein L9p [Escherichia coli IS35]
 emb|CDK90934.1| LSU ribosomal protein L9p [Escherichia coli IS29]
 gb|ETS27365.1| 50S ribosomal protein L9 [Escherichia coli O6:H16:CFA/II str. B2C]
 gb|AHG17729.1| LSU ribosomal protein L9p [Escherichia coli O145:H28 str. RM13516]
 gb|AHG12083.1| LSU ribosomal protein L9p [Escherichia coli O145:H28 str. RM13514]
 gb|ETX76799.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 43b]
 gb|ETX81949.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 43a]
 gb|ETX87534.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 20B]
 gb|ETX90429.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 20A]
 gb|ETX96510.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 19B]
 gb|ETY08859.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 19A]
 gb|ETY13312.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 17A]
 gb|ETY13825.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 17B]
 gb|ETY20234.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 15]
 gb|ETY23453.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 9]
 gb|ETY30143.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 3]
 gb|ETY35225.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 2B]
 gb|ETY47792.1| 50S ribosomal protein L9 [Escherichia coli BWH 34]
 gb|ETY50887.1| 50S ribosomal protein L9 [Escherichia coli BWH 40]
 gb|ETY52486.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 49b]
 gb|ETY56064.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 49a]
 gb|ETY61437.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 6]
 emb|CDL49960.1| LSU ribosomal protein L9p [Escherichia coli ISC41]
 gb|EWC54737.1| 50S ribosomal protein L9 [Escherichia coli EC096/10]
 gb|EWY52120.1| 50S ribosomal protein L9 [Escherichia coli MP1]
 gb|AHM30323.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AHM36431.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AHM41030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AHM41968.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AHM46602.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AHM51157.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB43961.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB47701.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB50165.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB57655.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB61535.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYB66075.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EYD78571.1| ribosomal protein L9 [Escherichia coli 1-176-05_S1_C1]
 gb|EYD79001.1| ribosomal protein L9 [Escherichia coli 1-176-05_S3_C1]
 gb|EYD82963.1| ribosomal protein L9 [Escherichia coli 1-176-05_S3_C2]
 gb|EYD93707.1| ribosomal protein L9 [Escherichia coli 1-110-08_S4_C3]
 gb|EYD94413.1| ribosomal protein L9 [Escherichia coli 1-110-08_S4_C2]
 gb|EYD97043.1| ribosomal protein L9 [Escherichia coli 1-110-08_S4_C1]
 gb|EYE09826.1| ribosomal protein L9 [Escherichia coli 1-110-08_S3_C3]
 gb|EYE16279.1| ribosomal protein L9 [Escherichia coli 1-110-08_S3_C2]
 gb|EYE16630.1| ribosomal protein L9 [Escherichia coli 1-110-08_S1_C3]
 gb|EYE18325.1| ribosomal protein L9 [Escherichia coli 1-110-08_S3_C1]
 gb|EYE32648.1| ribosomal protein L9 [Escherichia coli 1-110-08_S1_C2]
 gb|EYE39322.1| ribosomal protein L9 [Escherichia coli 1-110-08_S1_C1]
 gb|EYT06065.1| 50S ribosomal protein L9 [Escherichia coli K02]
 gb|EYU73807.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU80260.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-4254]
 gb|EYU86347.1| 50S ribosomal protein L9 [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU87570.1| 50S ribosomal protein L9 [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU91083.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYU94977.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYV01960.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-3840]
 gb|EYV08453.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-3609]
 gb|EYV16417.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV17895.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV20145.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV23010.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV24807.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV44190.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV45928.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV46085.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV58969.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYV61820.1| 50S ribosomal protein L9 [Escherichia coli O103:H11 str.
           2010C-3214]
 gb|EYV67574.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV70382.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV80012.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2009EL1412]
 gb|EYV82820.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2009C-4659]
 gb|EYV84797.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5806]
 gb|EYV85858.1| 50S ribosomal protein L9 [Escherichia coli O6:H16 str. 99-3165]
 gb|EYV94249.1| 50S ribosomal protein L9 [Escherichia coli O86:H34 str. 99-3124]
 gb|EYV94852.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F7350]
 gb|EYW00318.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2312]
 gb|EYW10556.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2288]
 gb|EYW11578.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2289]
 gb|EYW16411.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2287]
 gb|EYW24283.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2114]
 gb|EYW26043.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2286]
 gb|EYW36059.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2113]
 gb|EYW39001.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2112]
 gb|EYW41026.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2111]
 gb|EYW47157.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2109]
 gb|EYW47666.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2108]
 gb|EYW55141.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2107]
 gb|EYW59571.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2106]
 gb|EYW68264.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2105]
 gb|EYW72092.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2104]
 gb|EYW79358.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2103]
 gb|EYW81082.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2101]
 gb|EYW85818.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2099]
 gb|EYW93075.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 08-4487]
 gb|EYW96616.1| 50S ribosomal protein L9 [Escherichia coli O118:H16 str. 08-3651]
 gb|EYW98486.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 08-4270]
 gb|EYW99987.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX09147.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX10632.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX16985.1| 50S ribosomal protein L9 [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX22613.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2098]
 gb|EYX28115.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2097]
 gb|EYX33761.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2096]
 gb|EYX39029.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2094]
 gb|EYX45754.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2093]
 gb|EYX49035.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2092]
 gb|EYX53701.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2091]
 gb|EYX58155.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2090]
 gb|EYX62698.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str.
           2011EL-1675A]
 gb|EYX69987.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-1107]
 gb|EYX71717.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX74612.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX86506.1| 50S ribosomal protein L9 [Escherichia coli O156:H25 str.
           2011C-3602]
 gb|EYX87140.1| 50S ribosomal protein L9 [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX90670.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYY00274.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3537]
 gb|EYY03580.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3500]
 gb|EYY06103.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY14476.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY14612.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3216]
 gb|EYY21064.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3108]
 gb|EYY27636.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3072]
 gb|EYY33215.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010EL1058]
 gb|EYY37791.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-4989]
 gb|EYY42303.1| 50S ribosomal protein L9 [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYY47069.1| 50S ribosomal protein L9 [Escherichia coli O165:H25 str.
           2010C-4874]
 gb|EYY49268.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2010C-4979C1]
 gb|EYY51192.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-4966]
 gb|EYY63334.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-4824]
 gb|EYY63461.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY71358.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY76201.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY83341.1| 50S ribosomal protein L9 [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY85226.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY89948.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-4732]
 gb|EYY95176.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYZ00281.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYZ06715.1| 50S ribosomal protein L9 [Escherichia coli O177:NM str. 2010C-4558]
 gb|EYZ07530.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ12937.1| 50S ribosomal protein L9 [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ17140.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str.
           2010C-4557C2]
 gb|EYZ24144.1| 50S ribosomal protein L9 [Escherichia coli O103:H25 str.
           2010C-4529]
 gb|EYZ31835.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ33636.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ38384.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ43555.1| 50S ribosomal protein L9 [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ46565.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ49379.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ56552.1| 50S ribosomal protein L9 [Escherichia coli O79:H7 str. 06-3501]
 gb|EYZ62470.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. 06-3555]
 gb|EYZ66428.1| 50S ribosomal protein L9 [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ69063.1| 50S ribosomal protein L9 [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ71819.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 06-3484]
 gb|EYZ84018.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ86762.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. 06-3003]
 gb|EYZ92412.1| 50S ribosomal protein L9 [Escherichia coli O118:H16 str. 06-3256]
 gb|EYZ99624.1| 50S ribosomal protein L9 [Escherichia coli O119:H4 str. 03-3458]
 gb|EZA01859.1| 50S ribosomal protein L9 [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA02211.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 03-3484]
 gb|EZA12267.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA15014.1| 50S ribosomal protein L9 [Escherichia coli O81:NM str. 02-3012]
 gb|EZA20014.1| 50S ribosomal protein L9 [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA21142.1| 50S ribosomal protein L9 [Escherichia coli O28ac:NM str. 02-3404]
 gb|EZA29541.1| 50S ribosomal protein L9 [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA35843.1| 50S ribosomal protein L9 [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA41427.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA42210.1| 50S ribosomal protein L9 [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA65448.1| 50S ribosomal protein L9 [Escherichia coli O104:H21 str. 94-3025]
 gb|EZA71510.1| 50S ribosomal protein L9 [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA76956.1| 50S ribosomal protein L9 [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA78287.1| 50S ribosomal protein L9 [Escherichia coli O25:NM str. E2539C1]
 gb|EZA84438.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F6142]
 gb|EZA88294.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. F6627]
 gb|EZA93974.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. F6714]
 gb|EZA99226.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F6749]
 gb|EZA99810.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F6750]
 gb|EZB10384.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F6751]
 gb|EZB14597.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F7384]
 gb|EZB16465.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F7377]
 gb|EZB23600.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. F7410]
 gb|EZB25130.1| 50S ribosomal protein L9 [Escherichia coli O169:H41 str. F9792]
 gb|EZB34668.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. G5303]
 gb|EZB42525.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. H2498]
 gb|EZB46410.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. H2495]
 gb|EZB48529.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1792]
 gb|EZB49886.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1420]
 gb|EZB51126.1| 50S ribosomal protein L9 [Escherichia coli O15:H18 str. K1516]
 gb|EZB59573.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1793]
 gb|EZB67546.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1845]
 gb|EZB74219.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1796]
 gb|EZB75118.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1795]
 gb|EZB79219.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1921]
 gb|EZB82692.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2188]
 gb|EZB86190.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K1927]
 gb|EZB92171.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2191]
 gb|EZB98058.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2324]
 gb|EZC06459.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2581]
 gb|EZC10523.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2192]
 gb|EZC13421.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2845]
 gb|EZC20927.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2622]
 gb|EZC23032.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K4396]
 gb|EZC29017.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K2854]
 gb|EZC41195.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K4405]
 gb|EZC43910.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K4406]
 gb|EZC48821.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K4527]
 gb|EZC53103.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. K5198]
 gb|EZC56711.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str. K5269]
 gb|EZC62721.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5418]
 gb|EZC64337.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5453]
 gb|EZC64878.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5449]
 gb|EZC71211.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5448]
 gb|EZC73394.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5460]
 gb|EZC80443.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5467]
 gb|EZC93065.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5607]
 gb|EZC96363.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5602]
 gb|EZC98964.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5852]
 gb|EZD02708.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K5609]
 gb|EZD15830.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K6676]
 gb|EZD16707.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K6590]
 gb|EZD18950.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K6687]
 gb|EZD24174.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6723]
 gb|EZD32644.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6722]
 gb|EZD36696.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6728]
 gb|EZD40950.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6890]
 gb|EZD43294.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6895]
 gb|EZD52985.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6898]
 gb|EZD54331.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6897]
 gb|EZD58540.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6904]
 gb|EZD66101.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6908]
 gb|EZD72013.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. K6915]
 gb|EZD75943.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. K7140]
 gb|EZD84060.1| 50S ribosomal protein L9 [Escherichia coli O39:NM str. F8704-2]
 gb|EZD84755.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD90815.1| 50S ribosomal protein L9 [Escherichia coli O157:NM str. 08-4540]
 gb|EZD94817.1| 50S ribosomal protein L9 [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZE03613.1| 50S ribosomal protein L9 [Escherichia coli O145:H28 str.
           2009C-3292]
 gb|EZE07437.1| 50S ribosomal protein L9 [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE12072.1| 50S ribosomal protein L9 [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE15885.1| 50S ribosomal protein L9 [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE20000.1| 50S ribosomal protein L9 [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE22434.1| 50S ribosomal protein L9 [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE23828.1| 50S ribosomal protein L9 [Escherichia coli O123:H11 str.
           2009C-3307]
 gb|EZE36124.1| 50S ribosomal protein L9 [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE38814.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE42862.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2009C-4050]
 gb|EZE48926.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE56501.1| 50S ribosomal protein L9 [Escherichia coli O118:H16 str.
           2009C-4446]
 gb|EZE59450.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE63898.1| 50S ribosomal protein L9 [Escherichia coli O91:H21 str. 2009C-4646]
 gb|EZE70248.1| 50S ribosomal protein L9 [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE76594.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2009C-4750]
 gb|EZE77681.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZE89376.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZE90141.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2009EL1302]
 gb|EZE90635.1| 50S ribosomal protein L9 [Escherichia coli O145:NM str. 2010C-3508]
 gb|EZF00035.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2010C-3794]
 gb|EZF05966.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2313]
 gb|EZF09433.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str.
           2011EL-2290]
 gb|EZG32819.1| 50S ribosomal protein L9 [Escherichia coli E1728]
 gb|EZG50128.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG50574.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG59591.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG60482.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG74532.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG76048.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG82325.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str.
           2010EL-1699]
 gb|EZG84538.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG89884.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZG90536.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZG98087.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZH12895.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH13680.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH14495.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH22133.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH22212.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH22694.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH37961.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH44792.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH49225.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH54063.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH54183.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZJ14437.1| ribosomal protein L9 [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ15243.1| ribosomal protein L9 [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ25651.1| ribosomal protein L9 [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ33043.1| ribosomal protein L9 [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ33665.1| ribosomal protein L9 [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ36772.1| ribosomal protein L9 [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ47497.1| ribosomal protein L9 [Escherichia coli 2-005-03_S4_C2]
 gb|EZJ50034.1| ribosomal protein L9 [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ57809.1| ribosomal protein L9 [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ64786.1| ribosomal protein L9 [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ65188.1| ribosomal protein L9 [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ65750.1| ribosomal protein L9 [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ79363.1| ribosomal protein L9 [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ81028.1| ribosomal protein L9 [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ87078.1| ribosomal protein L9 [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ91597.1| ribosomal protein L9 [Escherichia coli 1-182-04_S1_C3]
 gb|EZJ91739.1| ribosomal protein L9 [Escherichia coli 1-250-04_S1_C3]
 gb|EZK04782.1| ribosomal protein L9 [Escherichia coli 1-176-05_S1_C3]
 gb|EZK10211.1| ribosomal protein L9 [Escherichia coli 2-005-03_S1_C3]
 gb|EZK13430.1| ribosomal protein L9 [Escherichia coli 1-176-05_S1_C2]
 gb|EZK16155.1| ribosomal protein L9 [Escherichia coli 2-011-08_S1_C2]
 gb|EZK26006.1| ribosomal protein L9 [Escherichia coli 1-182-04_S1_C1]
 gb|EZK26470.1| ribosomal protein L9 [Escherichia coli 2-005-03_S1_C2]
 gb|EZK35976.1| ribosomal protein L9 [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ21871.1| 50S ribosomal protein L9 [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ26693.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str.
           2009EL-2169]
 gb|EZQ27321.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ38796.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ41770.1| 50S ribosomal protein L9 [Escherichia coli O111:H8 str. 2011C-3453]
 gb|EZQ47320.1| 50S ribosomal protein L9 [Escherichia coli O157: str. 2010EL-2044]
 gb|EZQ50356.1| 50S ribosomal protein L9 [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ57894.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 83]
 gb|EZQ67977.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 82]
 gb|AHY68051.1| LSU ribosomal protein L9p [Escherichia coli O145:H28 str. RM12761]
 gb|AHY73902.1| LSU ribosomal protein L9p [Escherichia coli O145:H28 str. RM12581]
 gb|KCW96163.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDA55222.1| ribosomal protein L9 [Escherichia coli 2-011-08_S1_C1]
 gb|KDA61180.1| ribosomal protein L9 [Escherichia coli 2-052-05_S1_C1]
 gb|KDA65889.1| ribosomal protein L9 [Escherichia coli 1-182-04_S1_C2]
 gb|KDA71004.1| ribosomal protein L9 [Escherichia coli 2-005-03_S3_C2]
 gb|KDA77056.1| ribosomal protein L9 [Escherichia coli 2-011-08_S3_C2]
 gb|KDA82349.1| ribosomal protein L9 [Escherichia coli 2-011-08_S3_C3]
 gb|KDA87399.1| ribosomal protein L9 [Escherichia coli 1-176-05_S4_C2]
 emb|CDP73166.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CDP65499.1| 50S ribosomal protein L9 [Escherichia coli D6-113.11]
 emb|CDP76199.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KDF70309.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 58]
 gb|KDF73097.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 59]
 gb|KDF79745.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 63]
 gb|KDF81535.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 62]
 gb|KDF87650.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 64]
 gb|KDF95488.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 65]
 gb|KDF96922.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 70]
 gb|KDF97645.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 71]
 gb|KDG06759.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 72]
 gb|KDG12820.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 73]
 gb|KDG17471.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 74]
 gb|KDG22863.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 75]
 gb|KDG24850.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 76]
 gb|KDG34024.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 77]
 gb|KDG38211.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 78]
 gb|KDG42295.1| 50S ribosomal protein L9 [Escherichia coli BIDMC 79]
 gb|KDG48176.1| 50S ribosomal protein L9 [Escherichia coli CHS 68]
 gb|KDG50914.1| 50S ribosomal protein L9 [Escherichia coli CHS 77]
 gb|KDG54601.1| 50S ribosomal protein L9 [Escherichia coli CHS 69]
 gb|KDG61387.1| 50S ribosomal protein L9 [Escherichia coli MGH 57]
 gb|KDG68404.1| 50S ribosomal protein L9 [Escherichia coli UCI 51]
 gb|KDG68874.1| 50S ribosomal protein L9 [Escherichia coli MGH 58]
 gb|KDG73849.1| 50S ribosomal protein L9 [Escherichia coli UCI 53]
 gb|KDG81343.1| 50S ribosomal protein L9 [Escherichia coli UCI 57]
 gb|KDG84206.1| 50S ribosomal protein L9 [Escherichia coli UCI 58]
 gb|KDG88804.1| 50S ribosomal protein L9 [Escherichia coli UCI 65]
 gb|KDG93097.1| 50S ribosomal protein L9 [Escherichia coli UCI 66]
 gb|KDM73125.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDM80953.1| 50S ribosomal protein L9 [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM84340.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDM87134.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDN04922.1| LSU ribosomal protein L9p [Escherichia coli]
 emb|CDN85083.1| 50S ribosomal subunit protein L9 [Escherichia coli O25b:H4-ST131]
 gb|KDO87999.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDP16652.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KDS94956.1| ribosomal protein L9 [Escherichia coli 2-011-08_S3_C1]
 gb|KDS95159.1| ribosomal protein L9 [Escherichia coli 2-011-08_S1_C3]
 gb|KDS99199.1| ribosomal protein L9 [Escherichia coli 2-011-08_S4_C1]
 gb|KDT09927.1| ribosomal protein L9 [Escherichia coli 2-052-05_S1_C3]
 gb|KDT12782.1| ribosomal protein L9 [Escherichia coli 2-011-08_S4_C3]
 gb|KDT14237.1| ribosomal protein L9 [Escherichia coli 2-052-05_S3_C1]
 gb|KDT24298.1| ribosomal protein L9 [Escherichia coli 2-052-05_S4_C1]
 gb|KDT30222.1| ribosomal protein L9 [Escherichia coli 3-105-05_S1_C1]
 gb|KDT39610.1| ribosomal protein L9 [Escherichia coli 3-105-05_S3_C1]
 gb|KDT44724.1| ribosomal protein L9 [Escherichia coli 3-105-05_S4_C2]
 gb|KDT50520.1| ribosomal protein L9 [Escherichia coli 3-105-05_S3_C2]
 gb|KDT56589.1| ribosomal protein L9 [Escherichia coli 3-105-05_S4_C3]
 gb|KDT58641.1| ribosomal protein L9 [Escherichia coli 3-267-03_S1_C3]
 gb|KDT66270.1| ribosomal protein L9 [Escherichia coli 3-373-03_S3_C1]
 gb|KDT66481.1| ribosomal protein L9 [Escherichia coli 3-267-03_S3_C1]
 gb|KDT75865.1| ribosomal protein L9 [Escherichia coli 3-373-03_S3_C3]
 gb|KDT80498.1| ribosomal protein L9 [Escherichia coli 3-373-03_S1_C2]
 gb|KDT87960.1| ribosomal protein L9 [Escherichia coli 3-475-03_S4_C1]
 gb|KDT88887.1| ribosomal protein L9 [Escherichia coli 3-475-03_S1_C1]
 gb|KDT94029.1| ribosomal protein L9 [Escherichia coli 3-105-05_S4_C1]
 gb|KDU00679.1| ribosomal protein L9 [Escherichia coli 3-267-03_S1_C2]
 gb|KDU02175.1| ribosomal protein L9 [Escherichia coli 3-267-03_S3_C2]
 gb|KDU06706.1| ribosomal protein L9 [Escherichia coli 3-105-05_S3_C3]
 gb|KDU12876.1| ribosomal protein L9 [Escherichia coli 3-373-03_S3_C2]
 gb|KDU17053.1| ribosomal protein L9 [Escherichia coli 3-267-03_S1_C1]
 gb|KDU23223.1| ribosomal protein L9 [Escherichia coli 3-267-03_S4_C2]
 gb|KDU31775.1| ribosomal protein L9 [Escherichia coli 3-373-03_S4_C2]
 gb|KDU38757.1| ribosomal protein L9 [Escherichia coli 3-073-06_S4_C1]
 gb|KDU41019.1| ribosomal protein L9 [Escherichia coli 3-373-03_S1_C3]
 gb|KDU48645.1| ribosomal protein L9 [Escherichia coli 3-373-03_S1_C1]
 gb|KDU49818.1| ribosomal protein L9 [Escherichia coli 3-475-03_S4_C2]
 gb|KDU54418.1| ribosomal protein L9 [Escherichia coli 3-373-03_S4_C1]
 gb|KDU61752.1| ribosomal protein L9 [Escherichia coli 4-203-08_S1_C1]
 gb|KDU66576.1| ribosomal protein L9 [Escherichia coli 4-203-08_S4_C3]
 gb|KDV17982.1| 50S ribosomal protein L9 [Escherichia coli O111:NM str. 01-3076]
 gb|KDV18047.1| 50S ribosomal protein L9 [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV26913.1| 50S ribosomal protein L9 [Escherichia coli O145:H25 str. 07-3858]
 gb|KDV32660.1| 50S ribosomal protein L9 [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV39987.1| 50S ribosomal protein L9 [Escherichia coli O146:H21 str.
           2010C-3325]
 gb|KDV42810.1| 50S ribosomal protein L9 [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV46049.1| 50S ribosomal protein L9 [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDV49473.1| 50S ribosomal protein L9 [Escherichia coli O121:H19 str.
           2011C-3609]
 gb|KDV62239.1| 50S ribosomal protein L9 [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV67756.1| 50S ribosomal protein L9 [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDV73416.1| 50S ribosomal protein L9 [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV76869.1| ribosomal protein L9 [Escherichia coli 2-052-05_S4_C3]
 gb|KDV77344.1| ribosomal protein L9 [Escherichia coli 2-052-05_S3_C3]
 gb|KDV77829.1| ribosomal protein L9 [Escherichia coli 2-052-05_S4_C2]
 gb|KDV96954.1| ribosomal protein L9 [Escherichia coli 2-156-04_S1_C3]
 gb|KDW02420.1| ribosomal protein L9 [Escherichia coli 2-156-04_S3_C1]
 gb|KDW02983.1| ribosomal protein L9 [Escherichia coli 2-156-04_S3_C3]
 gb|KDW03291.1| ribosomal protein L9 [Escherichia coli 2-156-04_S3_C3]
 gb|KDW12018.1| ribosomal protein L9 [Escherichia coli 2-177-06_S3_C1]
 gb|KDW13070.1| ribosomal protein L9 [Escherichia coli 2-156-04_S4_C1]
 gb|KDW13176.1| ribosomal protein L9 [Escherichia coli 2-156-04_S4_C1]
 gb|KDW13833.1| ribosomal protein L9 [Escherichia coli 2-177-06_S1_C1]
 gb|KDW27175.1| ribosomal protein L9 [Escherichia coli 2-156-04_S3_C2]
 gb|KDW27444.1| ribosomal protein L9 [Escherichia coli 2-177-06_S1_C2]
 gb|KDW36716.1| ribosomal protein L9 [Escherichia coli 2-177-06_S1_C3]
 gb|KDW45089.1| ribosomal protein L9 [Escherichia coli 2-177-06_S4_C2]
 gb|KDW50820.1| ribosomal protein L9 [Escherichia coli 1-392-07_S3_C2]
 gb|KDW54513.1| ribosomal protein L9 [Escherichia coli 2-210-07_S1_C3]
 gb|KDW57500.1| ribosomal protein L9 [Escherichia coli 2-005-03_S3_C1]
 gb|KDW66324.1| ribosomal protein L9 [Escherichia coli 2-005-03_S3_C3]
 gb|KDW75702.1| ribosomal protein L9 [Escherichia coli 1-392-07_S1_C1]
 gb|KDW78088.1| ribosomal protein L9 [Escherichia coli 2-005-03_S4_C1]
 gb|KDW82823.1| ribosomal protein L9 [Escherichia coli 1-392-07_S1_C2]
 gb|KDW87369.1| ribosomal protein L9 [Escherichia coli 2-210-07_S4_C1]
 gb|KDW93019.1| ribosomal protein L9 [Escherichia coli 2-210-07_S1_C2]
 gb|KDW94303.1| ribosomal protein L9 [Escherichia coli 2-210-07_S3_C2]
 gb|KDW97589.1| ribosomal protein L9 [Escherichia coli 1-392-07_S3_C1]
 gb|KDX05970.1| ribosomal protein L9 [Escherichia coli 2-177-06_S4_C3]
 gb|KDX22229.1| ribosomal protein L9 [Escherichia coli 2-210-07_S3_C3]
 gb|KDX22597.1| ribosomal protein L9 [Escherichia coli 2-156-04_S4_C2]
 gb|KDX23316.1| ribosomal protein L9 [Escherichia coli 1-250-04_S1_C2]
 gb|KDX28163.1| ribosomal protein L9 [Escherichia coli 1-250-04_S1_C1]
 gb|KDX37903.1| ribosomal protein L9 [Escherichia coli 2-156-04_S4_C3]
 gb|KDX44823.1| ribosomal protein L9 [Escherichia coli 2-177-06_S3_C2]
 gb|KDX49847.1| ribosomal protein L9 [Escherichia coli 2-177-06_S4_C1]
 gb|KDX56020.1| ribosomal protein L9 [Escherichia coli 2-210-07_S3_C1]
 gb|KDX60152.1| ribosomal protein L9 [Escherichia coli 2-210-07_S4_C2]
 gb|KDX69643.1| ribosomal protein L9 [Escherichia coli 2-222-05_S1_C1]
 gb|KDX71865.1| ribosomal protein L9 [Escherichia coli 2-210-07_S4_C3]
 gb|KDX77363.1| ribosomal protein L9 [Escherichia coli 2-222-05_S1_C2]
 gb|KDX79096.1| ribosomal protein L9 [Escherichia coli 2-222-05_S1_C3]
 gb|KDX88387.1| ribosomal protein L9 [Escherichia coli 2-222-05_S4_C2]
 gb|KDX88997.1| ribosomal protein L9 [Escherichia coli 2-222-05_S3_C3]
 gb|KDX98083.1| ribosomal protein L9 [Escherichia coli 2-316-03_S3_C1]
 gb|KDY01145.1| ribosomal protein L9 [Escherichia coli 2-316-03_S3_C2]
 gb|KDY06124.1| ribosomal protein L9 [Escherichia coli 2-316-03_S3_C3]
 gb|KDY08868.1| ribosomal protein L9 [Escherichia coli 2-316-03_S4_C1]
 gb|KDY17944.1| ribosomal protein L9 [Escherichia coli 2-316-03_S4_C3]
 gb|KDY20001.1| ribosomal protein L9 [Escherichia coli 2-316-03_S4_C2]
 gb|KDY25740.1| ribosomal protein L9 [Escherichia coli 2-427-07_S1_C2]
 gb|KDY33909.1| ribosomal protein L9 [Escherichia coli 2-427-07_S3_C3]
 gb|KDY34712.1| ribosomal protein L9 [Escherichia coli 2-427-07_S3_C1]
 gb|KDY43320.1| ribosomal protein L9 [Escherichia coli 2-427-07_S4_C2]
 gb|KDY49451.1| ribosomal protein L9 [Escherichia coli 2-427-07_S4_C1]
 gb|KDY55192.1| ribosomal protein L9 [Escherichia coli 2-460-02_S3_C1]
 gb|KDY65220.1| ribosomal protein L9 [Escherichia coli 2-460-02_S3_C2]
 gb|KDY67231.1| ribosomal protein L9 [Escherichia coli 2-460-02_S3_C3]
 gb|KDY70446.1| ribosomal protein L9 [Escherichia coli 2-460-02_S4_C2]
 gb|KDY76570.1| ribosomal protein L9 [Escherichia coli 2-460-02_S4_C3]
 gb|KDY80798.1| ribosomal protein L9 [Escherichia coli 2-474-04_S1_C1]
 gb|KDY88653.1| ribosomal protein L9 [Escherichia coli 2-474-04_S3_C1]
 gb|KDY92540.1| ribosomal protein L9 [Escherichia coli 2-427-07_S1_C3]
 gb|KDY97381.1| ribosomal protein L9 [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ02686.1| ribosomal protein L9 [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ02840.1| ribosomal protein L9 [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ10472.1| ribosomal protein L9 [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ17704.1| ribosomal protein L9 [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ24146.1| ribosomal protein L9 [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ27972.1| ribosomal protein L9 [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ32210.1| ribosomal protein L9 [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ39303.1| ribosomal protein L9 [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ42602.1| ribosomal protein L9 [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ53270.1| ribosomal protein L9 [Escherichia coli 3-073-06_S1_C1]
 gb|KDZ54394.1| ribosomal protein L9 [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ57949.1| ribosomal protein L9 [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ67993.1| ribosomal protein L9 [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ68768.1| ribosomal protein L9 [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ73878.1| ribosomal protein L9 [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ79868.1| ribosomal protein L9 [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ82685.1| ribosomal protein L9 [Escherichia coli 3-105-05_S1_C3]
 gb|KDZ88077.1| ribosomal protein L9 [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ96031.1| ribosomal protein L9 [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ04715.1| ribosomal protein L9 [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ05502.1| ribosomal protein L9 [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ20699.1| ribosomal protein L9 [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ21383.1| ribosomal protein L9 [Escherichia coli 2-316-03_S1_C2]
 gb|KEJ25282.1| ribosomal protein L9 [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ36854.1| ribosomal protein L9 [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ43014.1| ribosomal protein L9 [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ45648.1| ribosomal protein L9 [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ53576.1| ribosomal protein L9 [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ55930.1| ribosomal protein L9 [Escherichia coli 3-267-03_S4_C1]
 gb|KEJ64203.1| ribosomal protein L9 [Escherichia coli 3-020-07_S3_C2]
 gb|KEJ70903.1| ribosomal protein L9 [Escherichia coli 5-366-08_S1_C3]
 gb|KEJ73113.1| ribosomal protein L9 [Escherichia coli 6-175-07_S3_C2]
 gb|KEK75207.1| ribosomal protein L9 [Escherichia coli 3-475-03_S3_C1]
 gb|KEK84464.1| ribosomal protein L9 [Escherichia coli 3-475-03_S1_C2]
 gb|KEK86455.1| ribosomal protein L9 [Escherichia coli 3-475-03_S3_C2]
 gb|KEK93661.1| ribosomal protein L9 [Escherichia coli 4-203-08_S1_C2]
 gb|KEK99607.1| ribosomal protein L9 [Escherichia coli 4-203-08_S1_C3]
 gb|KEL02033.1| ribosomal protein L9 [Escherichia coli 4-203-08_S3_C3]
 gb|KEL08859.1| ribosomal protein L9 [Escherichia coli 4-203-08_S4_C2]
 gb|KEL14038.1| ribosomal protein L9 [Escherichia coli 4-203-08_S3_C2]
 gb|KEL17234.1| ribosomal protein L9 [Escherichia coli 4-203-08_S3_C1]
 gb|KEL26537.1| ribosomal protein L9 [Escherichia coli 3-373-03_S4_C3]
 gb|KEL29154.1| ribosomal protein L9 [Escherichia coli 5-172-05_S4_C2]
 gb|KEL33078.1| ribosomal protein L9 [Escherichia coli 5-366-08_S4_C2]
 gb|KEL41104.1| ribosomal protein L9 [Escherichia coli 5-172-05_S4_C1]
 gb|KEL43506.1| ribosomal protein L9 [Escherichia coli 5-172-05_S3_C3]
 gb|KEL52285.1| ribosomal protein L9 [Escherichia coli 6-175-07_S1_C1]
 gb|KEL53628.1| ribosomal protein L9 [Escherichia coli 5-172-05_S3_C1]
 gb|KEL61566.1| ribosomal protein L9 [Escherichia coli 5-172-05_S4_C3]
 gb|KEL66130.1| ribosomal protein L9 [Escherichia coli 5-172-05_S1_C3]
 gb|KEL72100.1| ribosomal protein L9 [Escherichia coli 5-366-08_S1_C1]
 gb|KEL74083.1| ribosomal protein L9 [Escherichia coli 5-366-08_S3_C3]
 gb|KEL83001.1| ribosomal protein L9 [Escherichia coli 5-366-08_S3_C2]
 gb|KEL88080.1| ribosomal protein L9 [Escherichia coli 6-175-07_S3_C1]
 gb|KEL92493.1| ribosomal protein L9 [Escherichia coli 5-366-08_S3_C1]
 gb|KEL97071.1| ribosomal protein L9 [Escherichia coli 6-175-07_S3_C3]
 gb|KEL99795.1| ribosomal protein L9 [Escherichia coli 6-175-07_S4_C2]
 gb|KEM00977.1| ribosomal protein L9 [Escherichia coli 6-175-07_S4_C1]
 gb|KEM08582.1| ribosomal protein L9 [Escherichia coli 6-319-05_S1_C2]
 gb|KEM18343.1| ribosomal protein L9 [Escherichia coli 6-319-05_S3_C1]
 gb|KEM21664.1| ribosomal protein L9 [Escherichia coli 6-319-05_S1_C3]
 gb|KEM25533.1| ribosomal protein L9 [Escherichia coli 6-319-05_S4_C2]
 gb|KEM25686.1| ribosomal protein L9 [Escherichia coli 6-319-05_S3_C2]
 gb|KEM36721.1| ribosomal protein L9 [Escherichia coli 6-537-08_S1_C1]
 gb|KEM44984.1| ribosomal protein L9 [Escherichia coli 6-175-07_S4_C3]
 gb|KEM48996.1| ribosomal protein L9 [Escherichia coli 6-175-07_S1_C3]
 gb|KEM55482.1| ribosomal protein L9 [Escherichia coli 6-319-05_S4_C3]
 gb|KEM56904.1| ribosomal protein L9 [Escherichia coli 6-319-05_S3_C3]
 gb|KEM57929.1| ribosomal protein L9 [Escherichia coli 7-233-03_S1_C2]
 gb|KEM68226.1| ribosomal protein L9 [Escherichia coli 7-233-03_S3_C1]
 gb|KEM71640.1| ribosomal protein L9 [Escherichia coli 6-537-08_S3_C1]
 gb|KEM79909.1| ribosomal protein L9 [Escherichia coli 6-537-08_S3_C3]
 gb|KEM85622.1| ribosomal protein L9 [Escherichia coli 2-222-05_S4_C1]
 gb|KEM87211.1| ribosomal protein L9 [Escherichia coli 6-537-08_S4_C1]
 gb|KEM96351.1| ribosomal protein L9 [Escherichia coli 7-233-03_S1_C3]
 gb|KEM96483.1| ribosomal protein L9 [Escherichia coli 6-319-05_S1_C1]
 gb|KEM97163.1| ribosomal protein L9 [Escherichia coli 7-233-03_S3_C3]
 gb|KEN08772.1| ribosomal protein L9 [Escherichia coli 7-233-03_S4_C2]
 gb|KEN13605.1| ribosomal protein L9 [Escherichia coli 6-537-08_S3_C2]
 gb|KEN18193.1| ribosomal protein L9 [Escherichia coli 7-233-03_S3_C2]
 gb|KEN19375.1| ribosomal protein L9 [Escherichia coli 8-415-05_S1_C1]
 gb|KEN30417.1| ribosomal protein L9 [Escherichia coli 8-415-05_S3_C3]
 gb|KEN36471.1| ribosomal protein L9 [Escherichia coli 8-415-05_S3_C1]
 gb|KEN37508.1| ribosomal protein L9 [Escherichia coli 7-233-03_S4_C1]
 gb|KEN41903.1| ribosomal protein L9 [Escherichia coli 6-537-08_S1_C2]
 gb|KEN49468.1| ribosomal protein L9 [Escherichia coli 6-537-08_S1_C3]
 gb|KEN50216.1| ribosomal protein L9 [Escherichia coli 7-233-03_S4_C3]
 gb|KEN57918.1| ribosomal protein L9 [Escherichia coli 6-537-08_S4_C2]
 gb|KEN62479.1| ribosomal protein L9 [Escherichia coli 1-392-07_S4_C3]
 gb|KEN68150.1| ribosomal protein L9 [Escherichia coli 8-415-05_S3_C2]
 gb|KEN71254.1| ribosomal protein L9 [Escherichia coli 2-052-05_S3_C2]
 gb|KEN84978.1| ribosomal protein L9 [Escherichia coli 2-222-05_S3_C1]
 gb|KEN85392.1| ribosomal protein L9 [Escherichia coli 2-474-04_S4_C1]
 gb|KEN93848.1| ribosomal protein L9 [Escherichia coli 2-222-05_S3_C2]
 gb|KEN95208.1| ribosomal protein L9 [Escherichia coli 1-392-07_S4_C1]
 gb|KEO04887.1| ribosomal protein L9 [Escherichia coli 8-415-05_S1_C2]
 gb|KEO05237.1| ribosomal protein L9 [Escherichia coli 2-177-06_S3_C3]
 gb|KEO11184.1| ribosomal protein L9 [Escherichia coli 2-222-05_S4_C3]
 gb|KEO20592.1| ribosomal protein L9 [Escherichia coli 5-366-08_S4_C1]
 gb|KEO24939.1| ribosomal protein L9 [Escherichia coli 1-250-04_S3_C2]
 gb|KEO25015.1| ribosomal protein L9 [Escherichia coli 2-460-02_S1_C1]
 gb|KEO35647.1| ribosomal protein L9 [Escherichia coli 2-460-02_S1_C2]
 gb|KEO35801.1| ribosomal protein L9 [Escherichia coli 2-460-02_S1_C2]
 gb|AID81418.1| 50S ribosomal protein L9 [Escherichia coli Nissle 1917]
 gb|KEO95394.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP01770.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP03888.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP12324.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP15142.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP21320.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KEP78920.1| 50S ribosomal protein L9 [Escherichia coli E1140]
 gb|AIF39453.1| 50S ribosomal protein L9 [Escherichia coli KLY]
 gb|AIF62445.1| 50S ribosomal protein L9 [Escherichia coli B7A]
 emb|CDU33206.1| 50S ribosomal protein L9 [Escherichia coli D6-113.11]
 emb|CDU40357.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AIF96855.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. SS17]
 gb|AIG71686.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. EDL933]
 gb|KFB91433.1| LSU ribosomal protein L9p [Escherichia coli DSM 30083 = JCM 1649 =
           ATCC 11775]
 gb|KFD77536.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFF39433.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFF54283.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFH75297.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFH82836.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFH83041.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFH91376.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFH95407.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFI00591.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AIL13981.1| ribosomal protein L9 [Escherichia coli ATCC 25922]
 gb|AIL38749.1| hypothetical protein SFy_6252 [Shigella flexneri 2003036]
 gb|AIL43690.1| hypothetical protein SFyv_6324 [Shigella flexneri Shi06HN006]
 gb|KFV23027.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFV27162.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFV33661.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KFV36133.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CEE04576.1| ribosomal protein L9 [Escherichia coli]
 gb|AIN34490.1| 50S ribosomal subunit protein L9 [Escherichia coli BW25113]
 gb|KFZ97322.1| ribosomal protein L9 [Shigella flexneri]
 gb|KGA85409.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CDY64189.1| 50S ribosomal subunit protein L9, subunit of ribosome [Escherichia
           coli]
 emb|CDZ22953.1| 50S ribosomal subunit protein L9, subunit of ribosome [Escherichia
           coli]
 dbj|GAL53608.1| 50S ribosomal protein L9 [Escherichia albertii NBRC 107761]
 gb|KGI49078.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|AIT32989.1| 50S ribosomal protein L9 [Escherichia coli FAP1]
 gb|KGL70601.1| 50S ribosomal subunit protein L9 [Escherichia coli NCTC 50110]
 gb|KGM58390.1| 50S ribosomal subunit protein L9 [Escherichia coli G3/10]
 gb|KGM63293.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KGM67698.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KGM72167.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KGM77499.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KGM80144.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KGP11805.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGP16147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGP18404.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGP39682.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGP47336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGP49379.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT07683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT14261.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT20121.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT23047.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT26864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KGT31719.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CDX09787.1| 50S ribosomal protein L9,50S ribosomal protein L9,50S ribosomal
           protein L9,Ribosomal protein L9,ribosomal protein
           L9,Ribosomal protein L9, C-terminal domain [Shigella
           flexneri]
 gb|AIX66268.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHD39136.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHD52934.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHD54026.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHD57547.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG77633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG80997.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG85347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG98519.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG99426.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHG99663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH10881.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH14910.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH15269.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH17314.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH26547.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH31845.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH37424.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH42307.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH44250.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH50585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH56906.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH61247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH61653.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH69433.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH75550.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH77042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH82438.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH95126.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH98025.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHH99694.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI04172.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI09981.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI15282.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI16883.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI23367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI31475.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI33717.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI40207.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI44213.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI48367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI51057.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI63105.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI64455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI69516.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI71771.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI76426.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI84897.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI87176.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI94882.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHI98367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ00871.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ08666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ13004.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ19447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ28646.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KHJ29916.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AIZ30701.1| 50S ribosomal subunit protein L9 [Escherichia coli ER2796]
 gb|AIZ54025.1| 50S ribosomal subunit protein L9 [Escherichia coli K-12]
 gb|AIZ80851.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AIZ85393.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AIZ93030.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AJA29349.1| LSU ribosomal protein L9p [Escherichia coli O157:H7 str. SS52]
 gb|KHO55909.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CEK04884.1| 50S ribosomal protein L9 [Escherichia coli O26:H11]
 gb|AJB37592.1| 50S ribosomal subunit protein L9 [Escherichia coli APEC IMT5155]
 gb|AJB54240.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CCQ31899.2| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KIE67864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIE72883.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIE79068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIE81213.1| 50S ribosomal protein L9 [Escherichia coli RS218]
 gb|KIG26509.1| 50S ribosomal protein L9 [Escherichia coli C691-71 (14b)]
 gb|KIG33162.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG41107.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG46877.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG48030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG49222.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG57101.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG60149.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG68404.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG73992.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG74555.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG83739.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG90237.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG91998.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIG94827.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH00092.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH01265.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH14458.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH16590.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH19317.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH23360.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH31173.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIH37891.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AJE58767.1| 50S ribosomal, subunit protein L9 [Escherichia coli]
 gb|KII04300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AJF59045.1| 50S ribosomal subunit protein L9 [Escherichia coli 1303]
 gb|AJF79312.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIN84237.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AJG11186.1| 50S ribosomal subunit protein L9 [Escherichia coli ECC-1470]
 gb|KIO40294.1| 50S ribosomal protein L9 [Escherichia coli O139:H28 str. E24377A]
 gb|AJH12828.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIO85945.1| ribosomal protein L9 [Escherichia coli 97.0264]
 gb|KIQ41356.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIQ46469.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AJM76468.1| 50S ribosomal protein L9 [Escherichia coli RS218]
 gb|AJO86322.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIY28834.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ11785.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ58994.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ59684.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ62346.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ74046.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ76721.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ83791.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ90884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ92955.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KIZ98125.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJA00423.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJA06576.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD65392.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD68856.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD81806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD82169.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD84518.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD89389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJD90333.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJG96663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJH00270.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJH09097.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJI01259.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJI10733.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJI23928.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJJ45976.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJJ72252.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KJJ78703.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KJW21390.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW27226.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW35402.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW39521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW44882.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW55288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW59052.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW66888.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW68523.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJW72312.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KJY11946.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKA93379.1| 50S ribosomal protein L9 [Escherichia coli VR50]
 emb|CQR83580.1| 50S ribosomal subunit protein L9 [Escherichia coli K-12]
 gb|KKA62302.1| ribosomal protein L9 [Escherichia coli 9.1649]
 gb|KKB14681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KKB22579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKC13650.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKD59400.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD63780.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD68149.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD72509.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD76866.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD81289.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD85652.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AKD90008.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|KKF80252.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|KKF81095.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|KKJ21537.1| 50S ribosomal protein L9 [Escherichia coli MRSN 10204]
 gb|AKE86283.1| 50S ribosomal protein L9 [Escherichia coli O104:H4 str. C227-11]
 gb|KKK00206.1| 50S ribosomal protein L9 [Escherichia coli NB8]
 gb|KKK30246.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KKO28322.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KKO32722.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KKO34601.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KKO40243.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKF23484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKF57922.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|AKF62061.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|AKF66200.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|AKF70340.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|AKF74478.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|KKY44832.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AKH24850.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLD45750.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLD51248.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG34791.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG36192.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG44913.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG48620.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG55478.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG56681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG63031.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG68131.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG78089.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG81653.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG92630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG93702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH00181.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH03422.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH08008.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH12071.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH12681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH25660.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH27549.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH33915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH40186.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH41990.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH47699.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH50262.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH59919.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH62025.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH63868.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH68451.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH81231.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH82633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH86121.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLH95056.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKI69202.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|AKK14137.1| 50S ribosomal subunit protein L9 protein [Escherichia coli K-12]
 gb|AKK16257.1| 50S ribosomal subunit protein L9 protein [Escherichia coli K-12]
 gb|AKK51144.1| 50S ribosomal subunit protein L9 [Escherichia coli PCN033]
 gb|AKK35802.1| 50S ribosomal protein L9 [Escherichia coli APEC O18]
 gb|AKK37234.1| 50S ribosomal protein L9 [Escherichia coli APEC O2-211]
 gb|AKK45430.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKK56743.1| 50S ribosomal protein L9 [Shigella flexneri G1663]
 gb|KLU98284.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLW98132.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX00526.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX09975.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX11072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX16642.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX25386.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX28023.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX28531.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX40203.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX41491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX50752.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX51027.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX63135.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX66391.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX72580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX72780.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX80189.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX83656.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX89374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX90475.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLX97976.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLY02387.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KME76484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKN50067.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKO55347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKP87237.1| 50S ribosomal protein L9 [Escherichia coli ACN001]
 emb|CEP59083.1| 50S ribosomal protein L9 [Shigella flexneri 2a]
 gb|KMV37176.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KMV41554.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KMV43072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KMV45438.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KMV55800.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KMV58644.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKR22978.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKR27329.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AKR31840.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNA43812.1| 50S ribosomal protein L9 [Escherichia coli M114]
 emb|CTD35416.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD34552.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ01094.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD29225.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS61870.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD27062.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR95606.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP29994.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ60971.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ74626.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP69876.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP65716.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG61681.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD20328.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP67360.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG39772.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ56332.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF11496.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP80877.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE46778.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD09489.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ43219.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ51017.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN97313.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS11496.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH74448.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP55992.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR84018.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO37714.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR06160.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR29772.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE71077.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE39707.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE86606.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN91891.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE59478.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ18365.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN87736.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ07233.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS34835.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO00789.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP30087.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG47534.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF55276.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF78726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO29387.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF41736.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ88640.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP56962.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP23640.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ67339.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR10014.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE63986.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ30278.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF07173.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR75531.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD14234.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR79086.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR14648.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ44278.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE98111.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG20139.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF09354.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG12665.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG35568.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST32865.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF51763.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO90260.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE93842.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ43132.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS61201.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE99563.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP73428.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ61705.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO52912.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST68218.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO83526.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG22831.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR01140.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP59298.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG53367.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN83503.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ01217.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR85125.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR45254.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS43864.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN25393.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ82991.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO43230.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN43158.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP20595.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP44493.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE43712.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO06275.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO43537.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP28646.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO27079.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL08116.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST70944.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS13038.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE60769.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF35445.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN65634.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO55801.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP57591.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP11105.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN80675.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP34409.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU18799.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ45386.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO88468.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP11055.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ97540.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST62937.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP73569.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN43418.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG19715.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ25383.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ85089.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP99616.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK50727.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK26610.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR85222.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST21457.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS56941.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ27568.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST41220.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW75396.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP02465.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN32836.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF09577.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM10286.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF45174.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTP73508.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF79494.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV52639.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST46911.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST23302.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW42855.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL62533.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF94980.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF67727.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW28147.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO08352.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL60792.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP01409.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST33071.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ28732.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO73561.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU20359.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE45224.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP91506.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS62268.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST31574.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST97942.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF83338.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO51301.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS04727.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS07205.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW22652.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF98535.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF82511.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG70270.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN60581.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP95316.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP10810.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM68661.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI99109.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW83404.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE38973.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV97533.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC58667.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF44768.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC67714.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX71367.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG07882.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ81984.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA30033.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW74895.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL51645.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR92576.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST48991.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV47079.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTP75775.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG01862.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS36871.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR85956.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS96154.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF96651.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM56956.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST80882.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS78559.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN66677.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ97050.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL86731.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ21516.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV48027.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST82589.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH06382.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW19785.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW11080.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV87134.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM10522.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW96420.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ11759.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST41057.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX18546.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS37144.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY95033.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU80514.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR30073.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL36958.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW68372.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS31511.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY55027.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ83339.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO29701.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF80102.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX51124.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW07518.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ77250.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK81523.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST14195.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV93727.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL45847.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU24979.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTP73506.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI83386.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO20933.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW81965.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH06277.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY46299.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK94960.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST12141.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA07565.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL34232.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW49185.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV59174.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ99267.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF91844.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU32082.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY07546.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL39595.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ30844.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX37921.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK91855.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSE65490.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS52694.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN57843.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM33458.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS87278.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW07685.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW20550.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK08854.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY61402.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSQ79325.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK36942.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL04039.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY79786.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI45167.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ40151.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV79825.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK31778.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI95804.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL21317.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB51726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU56611.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR99510.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN02685.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR72050.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK74102.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU60424.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI81919.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU05481.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL16072.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK93210.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL37084.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST02392.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK98850.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX72255.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU18241.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ17886.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK39867.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX81207.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW06664.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL86721.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX88838.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG15479.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB01419.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV29283.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS23626.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH97343.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR87332.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL22099.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSL82643.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST91654.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW19935.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB84531.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ36897.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ79133.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF57312.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK38047.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV19962.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW61660.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY65358.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW20709.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX85952.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI67073.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK64863.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK09118.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ02491.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ63215.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY62815.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF97596.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG60828.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW08756.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN17465.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR24448.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC12183.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC61432.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY96436.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV49583.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA07608.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ16929.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB81258.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW32515.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY66641.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW50543.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM91721.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ96948.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY51134.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF77284.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ58912.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH32542.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ87376.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST95419.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSF34421.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI91848.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM54128.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTE12454.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM26102.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW12987.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ48112.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST05037.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ00381.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH01385.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI74450.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV46489.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN09350.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV68968.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN76015.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST08504.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW10944.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM67722.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI19390.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV60447.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY52319.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY63881.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY84476.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX94988.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ61936.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP26882.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC21754.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO80035.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ76040.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY36896.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM46628.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW82611.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH20919.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB84397.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY57919.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD95548.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV50157.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST90770.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX28878.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV14096.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA20931.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW31265.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSO34865.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR42600.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX71972.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSR18378.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ66851.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI15573.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB83335.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI03301.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX28826.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI33728.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX74726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY77069.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC07031.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ51042.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH99113.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX46945.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX86265.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN33941.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSP55732.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI11877.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU91721.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK67046.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK07761.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD11870.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV48283.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ53695.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB72119.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV49525.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY33831.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX46726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI26113.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS69997.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB90933.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS63237.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV75770.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB96977.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI69231.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM87511.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI13560.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ65440.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH49640.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA28395.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN20255.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM04747.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ21475.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK34212.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ73868.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ12947.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN33765.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC26252.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB74311.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTE32361.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC54710.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB79399.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC47173.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM34517.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY49296.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ96822.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY86726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH46180.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC30296.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX62295.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU97015.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ78785.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC34243.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI15099.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST17786.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST63657.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM73795.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC76996.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU83193.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV31327.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ06756.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ13692.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY56136.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST97522.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB91100.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ46044.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH41814.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU29959.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC92459.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY64278.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX53805.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH64320.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG86046.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI85721.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH16602.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV46441.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG60714.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK49124.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSZ21813.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC41528.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN07367.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ95278.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY78957.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ92823.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSU97930.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV80462.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG78411.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV34396.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI35243.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH99249.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSV70550.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSW93629.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSX89949.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH28460.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG77353.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSG74123.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB18120.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB10162.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA07772.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB05498.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA55036.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA40080.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI17927.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI24537.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN52864.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST12999.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH71570.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN49276.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY79817.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH68654.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM52986.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSS50806.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM96151.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA65247.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN09950.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN02957.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM71386.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB38321.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI13629.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM52070.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB53354.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN12892.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI10800.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CST19882.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN20083.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA29864.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN06392.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA82511.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB58318.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA37574.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN13675.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK02638.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK14371.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH95562.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSM65475.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSJ60207.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB77302.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSN09547.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB82744.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA77853.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB13935.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH71532.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA73381.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB52539.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA80856.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC46359.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSH75045.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSI53194.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA46481.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA92945.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB27732.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA57630.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTB89384.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTA78789.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK47574.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK46732.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK94112.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTC26162.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK87111.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK90685.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSK59351.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CSY79168.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|KNF12779.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF17300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF19752.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF27272.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF27802.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF43188.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF45178.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF47369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF56139.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF60667.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF66102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF70557.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF75872.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF76417.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF86920.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF93908.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNF99387.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG02172.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG05171.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG06244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG12532.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG25571.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG27753.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG30592.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG39424.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNG40892.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNX99180.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY54374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY62484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY66990.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY69011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY73249.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY81494.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY84069.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY87234.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNY99974.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ02040.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ03300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ13354.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ13763.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ21676.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ27078.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KNZ97715.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOA25431.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOA31715.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOA35799.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX19144.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX19065.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX00200.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW88264.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW94294.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX24604.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW73302.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW90624.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR14250.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR15466.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU15079.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU66922.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR17348.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU58708.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS27951.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR14417.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR15773.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU54936.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR18611.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV52097.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT07676.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV42142.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT82598.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW13852.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS60691.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU25283.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT68910.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU46782.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR36542.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW12326.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT95977.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW21490.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR40990.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR98359.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU98776.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU23767.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV84230.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR59323.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS49681.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU30636.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS65373.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU73752.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW09199.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT27861.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS32217.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT57831.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR38650.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV97244.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV60237.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV00754.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW37448.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW35579.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT10826.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV95624.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW76077.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT40077.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV81579.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR81272.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT34161.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT15916.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV33199.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV37400.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT21218.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU08861.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW23911.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT30741.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT35875.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU85468.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS32265.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS80160.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU10491.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS25599.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR81399.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR89388.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV95178.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW97895.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS64611.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU84463.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT77622.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW79360.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU24453.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW09494.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT99473.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW61571.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT69139.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV09535.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS36513.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT00933.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT13893.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU46480.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV95450.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV64874.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT02648.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU78759.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW58644.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV92059.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS81123.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS97278.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS19540.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU30987.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT79758.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW12187.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT33314.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW34960.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS02144.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV96833.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW16522.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT05246.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV24921.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS33276.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT39938.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTR95010.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS26187.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV80230.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV65991.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS47279.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT74366.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV28691.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV61903.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT69915.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTV96313.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT37058.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTU81390.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT30382.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTW44972.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTS86513.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTT81842.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY86788.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY61259.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX50644.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX92753.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ50461.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY40660.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY62932.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY71339.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ14247.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ10678.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ43509.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY37500.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ35940.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY82998.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ16142.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ53289.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY08104.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY33567.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY82693.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY24921.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ17413.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX44266.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ17706.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ80591.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY29633.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ21888.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ03618.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY35371.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ06280.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ04759.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ10258.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY80343.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX91789.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ07270.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY89029.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ20276.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY13127.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ92158.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY45646.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX67223.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ14647.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ04212.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ87903.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ72685.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ92394.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA04035.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ99275.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTZ99997.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA11414.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA31111.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA59654.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA50459.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA56491.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA51573.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA32981.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA34773.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA39555.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUA48834.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOR05878.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALB34198.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALD27108.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALD41785.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALD32216.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALD36929.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUH58426.1| 50S ribosomal subunit protein L9 [Escherichia coli KRX]
 gb|KOZ13374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ13540.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ14486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ20400.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ26521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ28423.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ37074.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ42847.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ46803.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ51391.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ63251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ63657.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ73180.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ75011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ82020.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ85596.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ90153.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KOZ94381.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUK03249.1| 50S ribosomal protein L9 [Achromobacter sp. ATCC35328]
 gb|KPH33459.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPH39575.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPH45819.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPH47421.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUQ94895.1| LSU ribosomal protein L9p [Escherichia coli]
 emb|CTX40640.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX90819.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX92395.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX30292.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX43523.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX41621.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY08605.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTY47879.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX47716.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTX81609.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTD75968.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD80871.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTD46404.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|CTX39650.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALH93516.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|ALI38142.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|ALI42540.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALI46938.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO06529.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO08339.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO13366.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO19186.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO28061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO29455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO31210.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO37557.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO44702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO53545.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO54218.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO58306.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO68633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO71977.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO79225.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO83964.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO86349.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO95146.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPO98985.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP02129.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP07887.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP16194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP27339.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP29994.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP32872.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP40366.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP45339.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP47708.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPP54045.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KPQ50130.1| 50S ribosomal protein L9 [Escherichia coli TW10598]
 gb|KQB27712.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQC27015.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI76737.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI82484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI87027.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI91771.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI93891.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQI97821.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ02711.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ08337.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ14874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ14893.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ15138.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ31334.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ34859.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ40936.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ43720.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQJ50819.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALL87539.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALL91581.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KQL76407.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KRQ04676.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 dbj|BAT37721.1| 50S ribosomal subunit protein L9 [Escherichia albertii]
 dbj|BAT41940.1| 50S ribosomal subunit protein L9 [Escherichia albertii]
 gb|KRR54313.1| 50S ribosomal protein L9 [Escherichia coli VL2732]
 gb|KRR59769.1| 50S ribosomal protein L9 [Escherichia coli K71]
 gb|KRR63777.1| 50S ribosomal protein L9 [Escherichia coli VL2874]
 gb|ALN48342.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KRT21992.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KRV63891.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KRV95021.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KRW03827.1| 50S ribosomal protein L9 [Escherichia coli]
 dbj|BAT46254.1| 50S ribosomal subunit protein L9 [Escherichia albertii]
 gb|KST26686.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KST30236.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALQ60969.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALQ74252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSW93623.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSX67355.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSX87126.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY00459.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY04631.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY09059.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY35679.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY52768.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY55534.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY78684.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY83776.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY91008.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSY97938.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KSZ10553.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CRL87709.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALT52148.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG69635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG70346.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG71416.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG80646.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG81866.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG82033.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG94532.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUG96135.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH00656.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH07242.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH11180.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH16036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH17556.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH23948.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUH29320.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALV67309.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALX55108.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALX60369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALX65072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALY15886.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUW81312.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUR30375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUR34878.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ALZ58523.1| LSU ribosomal protein L9p [Shigella sonnei]
 gb|KUR86617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUR89582.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUR93699.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUR98234.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS00699.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS12020.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS17064.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS18199.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS20434.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS22832.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS25363.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS43152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS44611.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS49047.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS59035.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS62418.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS63805.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS64284.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS69579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS79744.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS85714.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS86277.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS87028.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS97852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUS97934.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT02678.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT12213.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT18211.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT23677.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT27116.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT27275.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT30313.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT37682.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT47224.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT50141.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT51266.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT59585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT66108.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT67712.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT75298.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT83643.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT85499.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT86190.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT92338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUT94830.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU04440.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU06417.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU10143.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU21046.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU21606.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU26546.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU40064.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU42498.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU44774.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU48903.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU50475.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU54247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU70852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU81811.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU83064.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU83300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU93772.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU93996.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUU96802.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV09846.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV16408.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV19236.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV23341.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV31415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV38222.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV39375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV45052.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV47773.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV50804.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV52049.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV56638.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV66617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV70194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV77522.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV81304.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV82183.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV87823.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV92258.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUV96068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW01055.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW08308.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW13842.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW23987.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW27218.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW30005.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW30767.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW38359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW44610.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW46400.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW50993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW56942.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW60968.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW62571.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW76501.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW78308.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW80790.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW81219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW89979.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW90117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUW94274.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX03690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX07708.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX16358.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX18558.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX20750.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX21599.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX40046.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX42949.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX44383.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX48632.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX58765.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX65884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX69851.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX73279.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX83981.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX90320.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX91548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX95920.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUX96431.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUY04933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KUY10701.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KVI19581.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KVI21154.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KWV17966.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMB55990.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KWV99596.1| 50S ribosomal protein L9 [Escherichia fergusonii]
 gb|KWW00147.1| 50S ribosomal protein L9 [Escherichia fergusonii]
 gb|KWW03774.1| 50S ribosomal protein L9 [Escherichia fergusonii]
 gb|AMC97058.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|KXC12710.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMG16879.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|AMG80451.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AMH20802.1| 50S ribosomal protein L9 [Escherichia coli B]
 gb|AMH25011.1| 50S ribosomal protein L9 [Escherichia coli B]
 gb|AMH32772.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|AMH37492.1| 50S ribosomal protein L9 [Escherichia coli K-12]
 gb|KXG55690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXG58341.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXG66347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXG69398.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMF89243.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXG90162.1| ribosomal protein L9 [Escherichia coli]
 gb|KXG97341.1| ribosomal protein L9 [Escherichia coli]
 gb|KXH96454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXH98983.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXH99374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXI05991.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUW24808.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMK99338.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AML07495.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AML12140.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AML17198.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AML22102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXK74815.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXK77338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXK77647.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXK97048.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL01243.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL04195.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL07210.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL14395.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL17228.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL20663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL23007.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL30255.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL32614.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL37044.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL55442.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL56261.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL65155.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL72088.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL73246.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL78462.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL91658.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXL96687.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM00529.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM09204.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM16715.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM18052.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM21463.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM28514.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM33649.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM45362.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM48546.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM48896.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM57010.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM57346.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM68669.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM74115.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM76068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM80690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM86126.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM87965.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXM94219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN02000.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN10617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN14770.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN19238.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN25028.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN31521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN44445.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN44760.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN51794.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN52262.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN57054.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXN57967.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP21060.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP22627.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP24320.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP39175.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP39744.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP40560.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP46309.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP52975.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP53149.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP59074.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP64363.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP65703.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP77192.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP79099.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP79943.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP90598.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP90872.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP95094.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXP98177.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ02241.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ07489.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ08250.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ18984.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ22296.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ27944.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ29711.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ36949.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ41236.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ44799.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ45030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ53359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ61826.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ64573.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ67806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ73489.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ78597.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ83593.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ87857.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ90656.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ93839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXQ96436.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR06260.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR06681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR12426.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR24202.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR25281.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR32710.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR34061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR37224.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR44530.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR45244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR53238.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR59453.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR59545.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR65029.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR68351.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR75550.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR77928.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR83888.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR91070.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR98676.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXR99181.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMM39207.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMM76712.1| 50S ribosomal protein L9 [Shigella flexneri 1a]
 emb|CUU96633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMN60613.1| 50S ribosomal protein L9 [Shigella flexneri 2a]
 gb|AMN65440.1| 50S ribosomal protein L9 [Shigella flexneri 4c]
 gb|KXU68163.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXU72889.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KXU74457.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CUX85139.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMQ54025.1| 50S ribosomal protein L9 [Escherichia coli JJ1887]
 gb|AMR21610.1| 50S ribosomal protein L9 [Shigella sp. PAMC 28760]
 gb|KYL37651.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYN53527.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYN54459.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYO73549.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYO73799.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR04644.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR05733.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR14676.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR22074.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR31708.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR33320.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR37723.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR41272.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR48345.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR51789.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR59170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR60110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR71496.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR72355.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR76874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR82194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR83304.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR93959.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYR94271.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS02285.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS04902.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS15157.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS24054.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS25067.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS27064.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS35323.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS35486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS35754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS45524.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS53623.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS61712.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS68370.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS69084.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS74554.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS80823.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS85922.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYS89623.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT00276.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT05645.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT10455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT15443.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT19801.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT23499.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT30513.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT34943.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT39062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT39535.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT53665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT55198.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT57340.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT61745.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT63807.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT65065.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT79493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT80908.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT82667.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT92564.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYT94387.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU02251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU05731.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU10747.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU16458.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU25337.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU30010.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU30257.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU41652.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU43850.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU48706.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU54372.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU56733.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU66173.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU69774.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU74761.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU81189.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU82854.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU86499.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYU95919.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV00177.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV05072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV06263.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV15487.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV18275.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV25944.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV34933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV36584.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV42223.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV44305.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV52912.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV57540.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV57884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV58570.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV75479.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV77321.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV80862.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV81738.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYV92393.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW00579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW03867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW05754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW13463.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW17887.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW26388.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW32685.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW33598.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW41895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW44412.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW55457.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW56711.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW65159.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW67683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW73439.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW75421.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYW78030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMU84857.1| 50S ribosomal protein L9 [Escherichia coli str. Sanji]
 gb|KYZ89303.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KYZ90170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZA01049.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMW44051.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMW49454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMX13102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMX31798.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMX38139.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AMX42305.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZF27274.1| 50S ribosomal protein L9 [Escherichia coli APEC O2]
 gb|KZG99788.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH02752.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH08431.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH12714.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH21368.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH25743.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH27655.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH32290.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH33356.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH41951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH45415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH45783.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH59170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH63296.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH65602.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH66655.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH80354.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH90554.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZH92724.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI00599.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI04421.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI10773.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI13838.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI17100.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI18998.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI23112.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI28407.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI33252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI43701.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI48150.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI49951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI49980.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI56778.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI60348.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI69625.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI76610.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI78988.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI82573.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI89336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZI90887.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ01852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ06356.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ09267.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ14409.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ19686.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ25845.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ26195.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ35242.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ37346.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ39167.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ45583.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ50027.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ62583.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ66495.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ68554.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ78408.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ80117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ82447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ87280.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ93786.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ95755.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZJ98343.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO62769.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO66214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO71229.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO74003.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO78677.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO84235.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZO85737.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZP35729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZP39952.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KZP44442.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAB99890.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC00430.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC08615.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC09881.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC16871.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC20692.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC28214.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC31390.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC37698.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAC38910.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OAE54864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAE67141.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF23760.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF26920.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF31214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF40842.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF45640.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF46948.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF47537.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF50471.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAF89809.1| 50S ribosomal protein L9 [Escherichia coli PCN079]
 gb|OAF89922.1| 50S ribosomal protein L9 [Escherichia coli PCN009]
 gb|OAI35874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANE60503.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANE65312.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAJ80335.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAJ84897.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAM47567.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SBL11266.1| 50S ribosomal protein L9 [Klebsiella oxytoca]
 gb|OAN06422.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OAO39913.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO44477.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO44520.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO54073.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO59182.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO63056.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO71315.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAO73424.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANG71715.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|ANG77215.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|ANG82894.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OAP72545.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAR90029.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAR92490.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAR98080.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAS83704.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAT64920.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAV57108.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANJ37053.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANJ40794.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OAY12796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANK04971.1| rplI [Escherichia coli O25b:H4]
 gb|ANK10963.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTQ84849.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANK51468.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANM85010.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANK35042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OBU92783.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANO92155.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANP10220.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANP21042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANP30857.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANO80740.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANQ03564.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANO31338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANR84097.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OBZ40527.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OBZ41021.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OBZ41272.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCC36633.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC42546.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC42963.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC50710.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC53928.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC55270.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC59832.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC64202.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC67910.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC73622.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC78358.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC81444.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC89958.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC91771.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC92408.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCC94945.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD03516.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD07309.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD17409.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD18263.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD19883.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD22238.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD29629.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD30922.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD34737.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD35356.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD44625.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD48571.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD56840.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD58811.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD69084.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD69248.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD70533.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD74733.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD75388.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD81507.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD87605.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD93480.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD97308.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCD99998.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE04566.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE04890.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE13808.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE18007.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE20967.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE25018.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE29643.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE35686.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE45977.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE47342.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE51300.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE51775.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE56577.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE63929.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE64919.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE66554.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE71748.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE76976.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE83438.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE84257.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE94557.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE98516.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCE99076.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCF01631.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCF06881.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCF07582.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCF14091.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OCF18656.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SCA74154.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCJ84503.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCJ89391.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCJ95091.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCJ98114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCK02716.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANV94993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCK72034.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANW29053.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ANW43198.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OCO27030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCQ17021.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCQ27363.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCQ27624.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCQ47474.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS57153.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS66045.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS66314.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS68831.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS75486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCS80319.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCT03799.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCT08468.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCW51839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OCW78775.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOD08650.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODA86291.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODB44550.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODB52994.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODG69522.1| 50S ribosomal protein L9 [Shigella sp. FC1661]
 gb|ODG72056.1| 50S ribosomal protein L9 [Shigella sp. FC2045]
 gb|ODG77505.1| 50S ribosomal protein L9 [Shigella sp. FC1764]
 gb|ODG77568.1| 50S ribosomal protein L9 [Shigella sp. FC1882]
 gb|ODG78127.1| 50S ribosomal protein L9 [Shigella sp. FC2928]
 gb|ODH16527.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODH23537.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODH31302.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODH35079.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODH41881.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODJ27166.1| 50S ribosomal protein L9 [Shigella sp. FC1180]
 gb|ODJ27208.1| 50S ribosomal protein L9 [Shigella sp. FC1172]
 gb|ODJ28150.1| 50S ribosomal protein L9 [Shigella sp. FC2833]
 gb|ODJ29715.1| 50S ribosomal protein L9 [Shigella sp. FC2383]
 gb|ODJ34969.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODJ38486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOM48443.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|AOM55146.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOM60725.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOM72825.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ODQ02287.1| 50S ribosomal protein L9 [Shigella sp. FC569]
 gb|ODQ03216.1| 50S ribosomal protein L9 [Shigella sp. FC1544]
 gb|ODQ08871.1| 50S ribosomal protein L9 [Shigella sp. FC1056]
 gb|ODQ14287.1| 50S ribosomal protein L9 [Shigella sp. FC1139]
 gb|AOO72372.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEB97995.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEG24984.1| 50S ribosomal protein L9 [Shigella sp. FC2175]
 gb|OEG25008.1| 50S ribosomal protein L9 [Shigella sp. FC2117]
 gb|OEG25032.1| 50S ribosomal protein L9 [Shigella sp. FC2125]
 gb|OEG36689.1| 50S ribosomal protein L9 [Shigella sp. FC2531]
 gb|OEG37862.1| 50S ribosomal protein L9 [Shigella sp. FC2541]
 gb|OEG38543.1| 50S ribosomal protein L9 [Shigella sp. FC2710]
 gb|OEG49236.1| 50S ribosomal protein L9 [Shigella sp. FC3196]
 gb|OEG64351.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOR18214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI00365.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI07360.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI11951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI14372.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI22991.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI25026.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI30461.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI37615.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI39582.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI42074.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI52513.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI61651.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI62648.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI64102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEI90818.1| 50S ribosomal protein L9 [Shigella sp. FC1567]
 gb|OEI91104.1| 50S ribosomal protein L9 [Shigella sp. FC1708]
 gb|OEI96227.1| 50S ribosomal protein L9 [Shigella sp. FC1737]
 gb|OEL42031.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL49147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL54098.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL54593.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL57297.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL68880.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL74988.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL75390.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL76996.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL82952.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL90170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL92129.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEL98485.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM00985.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM07121.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM10362.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM18801.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM28354.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM30702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM38062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM38445.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM48952.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM53120.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM59769.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM60700.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM62929.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM72741.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM74338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM81343.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM84336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM91635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEM94960.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN04419.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN04755.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN10464.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN11601.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN11875.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN24993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN27241.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN34196.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN34844.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN40233.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN46957.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN50806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN57419.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN65202.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN68153.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN76228.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN81344.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN85217.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN88410.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN90761.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEN97076.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEO02528.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEO08462.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEO09286.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEO19296.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OEO22415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOT34742.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|AOV23838.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV29192.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV34556.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV39977.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV45320.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV50732.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|AOV56086.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OFE23463.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SDP07451.1| LSU ribosomal protein L9P [Shigella sonnei]
 gb|AOX54492.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AOX59884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OHV09605.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OHW33671.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SEP70914.1| LSU ribosomal protein L9P [Escherichia coli]
 gb|APA28068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII47061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII52429.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APA44460.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII79947.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII83661.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII91121.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OII99689.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIJ02991.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIJ03136.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SCQ08833.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIU81463.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIU82036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APC54332.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr. W3110]
 gb|OIY25642.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY33526.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY43536.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY45361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY47223.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY51529.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY52262.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY53683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY64083.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY67254.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY82499.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY83576.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY84360.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY86019.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIY95966.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ04162.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ08162.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ09449.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ11654.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ16869.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ23938.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ24730.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ69000.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ73575.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ80908.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ89092.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OIZ93729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF19951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF20776.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF22286.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF35021.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF37094.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF45680.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF51345.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF51618.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF62373.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJF86006.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SHD60530.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APE55919.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APE60869.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APE65750.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APE70585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APE81972.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|APE93978.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|OJH22885.1| 50S ribosomal protein L9 [Escherichia coli NA114]
 gb|APG33873.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API01358.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API06978.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API12551.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API18117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API23762.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API29251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API34928.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API40489.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|API45516.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK15378.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK18491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK19293.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK29495.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK31089.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK35336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK45289.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK50043.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK55874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK59214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK61572.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK69248.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK72707.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK77949.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK82191.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK89699.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK90775.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJK98739.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL08867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL10328.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL19081.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL24415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL27283.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL33573.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL39015.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL43490.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL45025.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL58334.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL59942.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL60563.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL65280.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL72008.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL77851.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL82381.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL90737.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJL96486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM00296.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM02796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM03957.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM20041.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM23907.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM25630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM27660.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM28374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM31987.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM43627.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM47092.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM56103.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM65070.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM66818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM71463.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM73777.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM76415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM85277.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM86617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJM88580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN04051.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN06983.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN09638.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN13975.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN20724.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN25238.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN32730.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN45692.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN48848.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN55506.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN57152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN57845.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN67270.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN75225.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN77803.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN81851.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN91036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN94011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJN94164.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO06249.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO08514.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO19807.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO20585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO23773.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO27228.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO29250.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO40958.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO44006.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO54585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO56565.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO58806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO70079.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO71449.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO80032.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO83852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO91515.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO92213.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJO99295.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP04069.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP05848.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP14383.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP17244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP27012.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP28142.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP33716.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP39924.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP46014.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP47465.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP55384.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP58369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP65345.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP71108.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP73803.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP77409.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP83466.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP86265.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP91608.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP95212.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJP98467.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ03427.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ10156.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ17694.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ22067.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ24951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ29487.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ30342.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ41196.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ51702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ53122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ58494.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ62916.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ66371.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ72369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ75518.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ76618.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ85141.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ91277.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ96799.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJQ98610.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR07234.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR09630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR18216.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR22033.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR25294.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR28005.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR30802.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR39834.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR46178.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR52289.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR54500.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR59036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR67624.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR74214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR77627.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR80689.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR86751.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR96211.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJR99732.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS03910.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS07556.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS11821.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS17472.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS23754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS31399.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS31779.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS33688.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS39455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS46273.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS50548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS60208.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS60688.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS68644.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS75751.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS77548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS83002.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJS91143.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OJZ36867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ56647.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ62997.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ65765.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ74358.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ75823.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ80398.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ88737.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ90722.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APJ95665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK01003.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK08080.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK08915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK13958.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK21883.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK24551.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK29406.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK35504.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK37537.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK45577.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK49337.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK56485.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK61586.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK68546.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK71271.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK74128.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK82459.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK83754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK91402.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK95188.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APK98342.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL05954.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL07671.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL15628.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL19364.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL24512.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL30450.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL34264.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL39500.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL44440.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL48886.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL58175.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL62404.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL65948.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL68450.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL72927.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL74710.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL84026.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL89864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APL50882.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKA61184.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKB72361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKB80326.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKB82204.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKB85566.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKB90220.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKL77611.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKL98336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKO61278.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKP62893.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKS67960.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKS90176.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT03644.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT04799.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT06760.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT10773.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT11967.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT13210.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT22796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT31937.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT33779.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT37466.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT41623.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT48194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT50014.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT57531.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT66829.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT70427.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT75298.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT87737.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT91153.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT95930.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKT99539.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU02275.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU05927.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU09381.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU17539.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU30437.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU32031.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU34490.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU35544.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU43484.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU50542.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU54581.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU55769.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU66295.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU72099.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU75447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU79711.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU86930.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU91524.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU94598.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKU94905.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV06413.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV17605.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV22651.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV27603.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV29633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV37112.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV41978.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV50706.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV51887.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV57617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV59399.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV74572.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV82159.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV84389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV84899.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV91880.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV99051.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKV99332.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW10626.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW11797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW15652.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW22927.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW25066.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW30588.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW33714.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW40695.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW43577.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW58575.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW59585.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW72815.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW75937.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW78839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW83187.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW85792.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKW92885.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX00042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX10621.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX16210.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX17592.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX20324.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX29687.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX34241.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX39205.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX39717.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX49841.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX56323.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX57927.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX67733.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OKX72611.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APQ23419.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLL61686.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APT04692.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLN79062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLO98242.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APT64344.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLR36309.1| 50S ribosomal protein L9 [Escherichia coli O25b:H4-ST131]
 gb|OLR85226.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS67122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS68060.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS68367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS82409.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS85359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLS94410.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLT06754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLY57219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OLY89268.1| 50S ribosomal protein L9 [Escherichia coli O157:H43]
 gb|OMG97779.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OMH01192.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|APW93353.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OMI43762.1| 50S ribosomal protein L9 [Escherichia coli N37058PS]
 gb|OMI48814.1| 50S ribosomal protein L9 [Escherichia coli N37122PS]
 gb|OMI56474.1| 50S ribosomal protein L9 [Escherichia coli N40607]
 gb|OMI57315.1| 50S ribosomal protein L9 [Escherichia coli N40513]
 gb|OMI65542.1| 50S ribosomal protein L9 [Escherichia coli N37139PS]
 gb|OMI66442.1| 50S ribosomal protein L9 [Escherichia coli N36410PS]
 gb|OMI71108.1| 50S ribosomal protein L9 [Escherichia coli N36254PS]
 emb|SIY11742.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX70790.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD57267.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC72403.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB77444.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD03852.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY40688.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK13269.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY26969.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH77392.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD39288.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB88298.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC86181.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD10919.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX53206.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB57986.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC34354.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC94562.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC76796.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC37763.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY08892.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC62330.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB87240.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX93201.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI93593.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY30612.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI12474.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB36836.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI41522.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB83911.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH96846.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX90876.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH97237.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB82324.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB76405.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC08182.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC13946.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB91088.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC56184.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI48792.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD06312.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC15786.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI51312.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY19649.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC47432.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ78797.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX42504.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY14324.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX73559.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX84377.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX44562.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ55896.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI79933.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX93203.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA82293.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA65271.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK12834.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD74156.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX92881.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA46728.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG89604.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI38385.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG26206.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI44012.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY35163.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB78659.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH93585.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI70355.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH53223.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX39746.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB59133.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH04776.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI41860.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD04039.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC70442.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC49556.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG80747.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA48652.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH52088.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH33377.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ80456.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK35788.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA61687.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX85239.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG56712.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA72622.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA29767.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA82077.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH09681.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH62383.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ73108.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA06500.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK61067.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA89780.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC19371.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ25210.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB82086.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF73627.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY40786.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX72207.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA48229.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA73238.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI07947.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ43259.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY00386.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA59340.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY29081.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI48508.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ73643.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK61115.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX92071.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC07704.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH72402.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK32010.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH37099.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK72296.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY45687.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX95767.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ03533.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB41635.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK69168.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK72538.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ20483.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY08695.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ71654.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ38539.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX90275.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ27338.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI69407.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI94997.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX77158.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA08475.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ82957.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI86484.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY42463.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG69417.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ46552.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB95408.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA04800.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB94273.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY53752.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC87242.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ50021.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI80838.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH86297.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK08041.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX87552.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK56184.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI88669.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY06501.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ68322.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK05067.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA29726.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ80813.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX80411.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY26224.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI97327.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ07692.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC03199.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK05809.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ46888.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH34334.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG69156.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ73887.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB42140.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB62001.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX83983.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ85338.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK34740.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY58836.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX71812.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG97563.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX43217.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ24723.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ82737.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA33284.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG96743.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH37486.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ40610.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ22070.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK54947.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI12662.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC46855.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ96109.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX93403.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY63572.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF22956.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ42850.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ50525.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ81211.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK59645.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF75596.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA86435.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA35705.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB24672.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ14589.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ49197.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK39109.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY58299.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ94312.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ69884.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH40252.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJA90893.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ45327.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG94549.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK04297.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI27691.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ88345.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG73879.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB62307.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB99840.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC41146.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ57608.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF44864.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ38194.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK46516.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG65882.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF86113.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD54298.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF36588.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB45525.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF69267.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG77535.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB07548.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK33279.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ47804.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC67626.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG24666.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF72535.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC75204.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK10829.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH01850.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJJ56177.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ97761.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG61074.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH07643.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF53529.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC02718.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK19791.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX52688.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH31452.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF04306.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF42967.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF34809.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG65610.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG30545.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJB80362.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH03244.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK69378.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY16418.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE13990.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX48495.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJC57336.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY60192.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF69365.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIY58571.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE24526.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG80561.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF46087.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG51549.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH00875.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ56533.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJI89826.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH04815.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE14210.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ98032.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD98672.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH67336.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE20942.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG26580.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE99934.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE31572.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE04947.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF07435.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJH16631.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIX92523.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG27331.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK70343.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK37683.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SIZ82375.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG83591.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK58721.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE05857.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE56497.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE13991.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE81490.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD42976.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD63353.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD45384.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD87709.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF10612.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG64637.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD70976.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE45320.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE93698.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG08406.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF30475.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJG28365.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE18903.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE95950.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE01851.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE74121.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE37040.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE51317.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE87693.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE85078.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE04673.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJK42705.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE56838.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD55105.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD98302.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD57923.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJF07944.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJD62649.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE53274.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJE68002.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ONF82187.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONG24796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONG27952.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONG32260.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONG36440.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SJK91187.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONK39829.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ONK42731.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SJM07163.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJM07025.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJM07189.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJM08032.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJM07354.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SJM08265.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ONN30906.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SJM23925.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OOC70034.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOC70912.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOC79592.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOD56849.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQP94114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOG30389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOH58054.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOH63318.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOH64871.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOH72398.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI14739.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI17572.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI20894.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI31068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI32879.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI38708.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI44052.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI45864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI54587.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI59369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI60378.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI66859.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI74724.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI74996.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI84658.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI88869.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI92122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOI95480.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ01427.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ03117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ12855.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ14498.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ22993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ26919.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ28011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ36329.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ41366.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ46911.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ53293.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ59830.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ60291.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ71097.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ74042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ78558.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ79348.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ86077.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ92288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOJ95079.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK01174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK01362.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK12768.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK18325.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK20185.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK30175.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK35936.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK36861.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOK47894.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOM85775.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OON52533.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OON79952.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQU02043.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQU95454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOO75465.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OOO80044.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OOO86921.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OOO88844.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|OOO91015.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|OOO96643.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|OOP00867.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP04513.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP05073.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP16041.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP16280.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP17726.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP26651.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP29737.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OOP33383.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OOP37959.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|AQV22411.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV26225.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV30351.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV35630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV39630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV48792.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV53072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV57683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV64568.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV68284.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV74814.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV80631.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV85818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQV88681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQW04062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQW06574.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQW11221.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQW19229.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOV72842.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOW20660.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOW21577.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OOW25174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQW75966.1| 50S ribosomal protein L9 [Escherichia coli M8]
 gb|AQX99520.1| 50S ribosomal protein L9 [Escherichia coli NU14]
 gb|OPH64503.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OPH69791.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OPH73088.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OPI26180.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI33603.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI42114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI48001.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI52773.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI56096.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI58507.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI72498.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI72686.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI76410.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI80356.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI85014.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPI93318.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ01895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ07456.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ10922.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ13888.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ15608.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ18287.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ24061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ34329.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ35037.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ50361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ50837.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OPJ54152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQZ27986.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQZ79471.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AQZ88302.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA04757.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA05975.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA17336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA32015.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA36580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARA65936.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OQK68794.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ARD54007.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARD79502.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARD83368.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARE49292.1| 50S ribosomal protein L9 [Escherichia coli C]
 dbj|BAX13730.1| 50S ribosomal protein L9 [Escherichia coli]
 dbj|BAX18940.1| 50S ribosomal protein L9 [Escherichia coli]
 dbj|BAX23817.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORC95037.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORC97975.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD00263.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD12107.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD17406.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD17719.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD31252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD34630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD35158.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD49867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD61042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD64869.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD65667.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD83455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD86010.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORD89261.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORE79155.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORE84145.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARH99867.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ORJ73022.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORR77588.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORR77963.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORR85893.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORR89248.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORR89716.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS01147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS01943.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS03083.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS14625.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS16114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS16915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS28152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS29230.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS30161.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS47760.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS49163.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS52529.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS57622.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS59339.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS66630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS69880.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS70824.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS78675.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS85378.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS85475.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS97604.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORS98277.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT00797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT12059.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT13995.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT14375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT27011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT29146.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT36874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ORT42034.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SMB35677.1| LSU ribosomal protein L9p [Escherichia coli]
 emb|SMB35679.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|OSB90208.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSB92696.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSC01899.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSC15104.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSC20973.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SMH61153.1| LSU ribosomal protein L9P [Escherichia coli]
 gb|ARJ98024.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSK02560.1| 50S ribosomal subunit protein L9 [Escherichia coli SHECO001]
 gb|OSK08488.1| ribosomal protein L9 [Escherichia coli FVEC1465]
 gb|OSK16462.1| ribosomal protein L9 [Escherichia coli M056]
 gb|OSK17593.1| hypothetical protein EAOG_03074 [Escherichia coli R527]
 gb|OSK19678.1| ribosomal protein L9 [Escherichia coli TA144]
 gb|OSK21576.1| ribosomal protein L9 [Escherichia coli B574]
 gb|OSK33378.1| ribosomal protein L9 [Escherichia coli E267]
 gb|OSK35225.1| ribosomal protein L9 [Escherichia coli B108]
 gb|OSK44943.1| ribosomal protein L9 [Escherichia coli B671]
 gb|OSK46538.1| ribosomal protein L9 [Escherichia coli H588]
 gb|OSK47573.1| ribosomal protein L9 [Escherichia coli H413]
 gb|OSK57453.1| ribosomal protein L9 [Escherichia coli B921]
 gb|OSK58303.1| ribosomal protein L9 [Escherichia coli E560]
 gb|OSK65219.1| ribosomal protein L9 [Escherichia coli E1114]
 gb|OSK70271.1| ribosomal protein L9 [Escherichia coli H223]
 gb|OSK72241.1| ribosomal protein L9 [Escherichia coli H001]
 gb|OSK80915.1| ribosomal protein L9 [Escherichia coli H378]
 gb|OSK91513.1| ribosomal protein L9 [Escherichia coli B367]
 gb|OSK94185.1| ribosomal protein L9 [Escherichia coli E1002]
 gb|OSK98458.1| ribosomal protein L9 [Escherichia coli TA447]
 gb|OSL00069.1| ribosomal protein L9 [Escherichia coli H386]
 gb|OSL02416.1| ribosomal protein L9 [Escherichia coli H296]
 gb|OSL07154.1| ribosomal protein L9 [Escherichia coli H305]
 gb|OSL20481.1| ribosomal protein L9 [Escherichia coli TA255]
 gb|OSL22886.1| ribosomal protein L9 [Escherichia coli H617]
 gb|OSL23202.1| ribosomal protein L9 [Escherichia coli B175]
 gb|OSL36348.1| ribosomal protein L9 [Escherichia albertii B156]
 gb|OSL41104.1| ribosomal protein L9 [Escherichia coli TA464]
 gb|OSL47001.1| ribosomal protein L9 [Escherichia coli H605]
 gb|OSL48710.1| ribosomal protein L9 [Escherichia coli H461]
 gb|OSL51254.1| ribosomal protein L9 [Escherichia coli H383]
 gb|OSL54283.1| ribosomal protein L9 [Escherichia coli H420]
 gb|OSL61029.1| ribosomal protein L9 [Escherichia coli H454]
 gb|OSL65736.1| ribosomal protein L9 [Escherichia coli TA008]
 gb|OSL66306.1| ribosomal protein L9 [Escherichia coli TA054]
 gb|OSL70217.1| ribosomal protein L9 [Escherichia coli TA014]
 gb|OSL83351.1| ribosomal protein L9 [Escherichia coli T426]
 gb|OSL83979.1| ribosomal protein L9 [Escherichia coli E704]
 gb|OSL90585.1| ribosomal protein L9 [Escherichia coli TA249]
 gb|OSM08988.1| ribosomal protein L9 [Escherichia coli R424]
 gb|OSM86508.1| 50S ribosomal subunit protein L9 [Escherichia coli SHECO003]
 gb|OSM93449.1| 50S ribosomal subunit protein L9 [Escherichia coli SHECO002]
 gb|OSP28292.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARM40438.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSQ34240.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARM81621.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OSY86341.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARQ23611.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTA13485.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB24923.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB28024.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB35974.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB37627.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB46175.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB47308.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB53487.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB60187.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB67040.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB72669.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB77234.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB81525.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB86049.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB88857.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTB99776.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC05889.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC08124.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC11204.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC15346.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC22478.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC27098.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC34674.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC37928.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC42591.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC52033.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC54454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC57449.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC66812.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC69793.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC72560.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC82556.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC88588.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC93120.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC99496.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTC99848.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD06869.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD14370.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD17324.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD25611.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD30110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD32233.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD41003.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD45338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD52749.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD53545.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD58106.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD66416.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD69862.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD75279.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD83572.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD87364.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD92045.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD93221.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTD99264.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE07827.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE12422.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE16095.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE23211.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE27293.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE32987.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE39345.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE44000.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE47710.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE55822.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE60564.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE65946.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE67790.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE76056.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE81036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE85184.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTE94397.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARR32476.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARR41756.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ARR59014.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARR66746.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV01595.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV07797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV10377.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV16047.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV19778.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV22655.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV40638.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OTV41656.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUD18237.1| 50S ribosomal protein L9 [Escherichia coli M4]
 gb|ARS06435.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OUF53521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF57627.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF68661.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF71637.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF79688.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF82294.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF86549.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF94831.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF96364.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUF99319.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG06124.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG12681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG15001.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG21379.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG24425.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG29754.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUG33007.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUJ66989.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUJ69711.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUJ77279.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUJ89335.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUK52171.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUK56169.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUK69178.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUK86334.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUK94838.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUL01401.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUL13297.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ART19692.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ART27474.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ART46015.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|OUP43487.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUR40216.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUR46957.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUR50002.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARV30355.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARV35152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARV49503.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARV56026.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OUZ43532.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ43887.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ48342.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ57090.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OUZ65088.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OUZ70992.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ72285.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ80475.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ85260.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ87745.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OUZ92842.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OUZ96675.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OVA44411.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA45130.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA49715.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA55912.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA64195.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA65724.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA74367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA76730.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA80399.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA89532.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA95626.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVA95680.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB06660.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB10997.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB13533.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB21697.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB30934.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB33642.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB40604.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB42093.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB49465.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB54447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB61709.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB64485.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB67811.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB78877.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB80745.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB85143.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB94047.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVB94487.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC01331.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC09131.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC12392.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC18806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC26786.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC30413.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC37352.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC39456.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC43122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC52569.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC58361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC63132.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC68327.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC77211.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC79442.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC82428.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC93868.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVC96998.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD01388.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD08666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD10950.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD18564.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD23177.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD26857.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD32486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD42603.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD43347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD49183.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD49397.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD56848.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD62547.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD64434.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD75747.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD83511.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD87733.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVD94307.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVE05684.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVE05883.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVE23582.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVE32445.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVE32632.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARW86209.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARW94628.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARX15965.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARX24311.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARX32224.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARX58359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVF98242.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVG51153.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVJ43765.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OVY44272.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWB88540.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWB91561.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC00447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC03202.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC08114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC14951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC18648.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC25461.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC26537.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC28581.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC34104.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC42128.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC46313.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC49244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC53435.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC60632.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC66666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC68768.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC77635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC80745.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC86768.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC87521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC96222.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWC96579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD00823.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD05918.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD08029.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD14361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD19020.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD25367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD32963.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD33122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD45190.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD45795.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD47428.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD58312.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD59933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD62935.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD65700.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD67271.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD78669.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD89347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD92999.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD95852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWD99659.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE01606.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE08344.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE12729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE14375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE20925.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE30249.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE35070.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE36861.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE44818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE51977.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE57798.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE59864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE64860.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE66760.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE71550.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE79343.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE79472.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE83413.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE91882.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE93101.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWE99470.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF06435.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF16294.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF19483.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF21032.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF21493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWF30256.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARZ83402.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ARZ88552.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASA44673.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG42845.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG43188.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG51518.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG59863.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG61218.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG68152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG73932.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG80086.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG83417.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG88813.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG91050.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWG96949.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH02371.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH04970.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH14054.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH16174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH20491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWH26322.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASA60240.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASA67682.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASB77663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASC17480.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWP89234.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWR24651.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OWR36899.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWS82336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWS84991.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASE47385.1| 50S ribosomal protein L9 [Escherichia coli O157]
 gb|ASF05137.1| 50S ribosomal protein L9 [Escherichia coli O104:H4]
 gb|ASG51588.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWW51635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWW56960.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWX78573.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWX78922.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWX89035.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OWY50589.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASI18260.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASI53049.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|ASJ28048.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASJ36575.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASJ46094.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXB26062.1| 50S ribosomal protein L9 [Shigella flexneri 2a str. 301]
 gb|ASL30493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASL61842.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|OXJ44442.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ52066.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ54064.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ62045.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ65252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ72178.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ76024.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ78712.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ86759.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ92060.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ92298.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXJ95802.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK08007.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK11183.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK17543.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK19616.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK23928.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK29110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK34046.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK43812.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK47029.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK49665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK56378.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK64326.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK67622.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK72767.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK72884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK84800.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK88181.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK94574.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXK97154.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL02602.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASN31348.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ASN36322.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ASN42807.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXL48941.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL54811.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL54924.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL60815.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL65173.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL75822.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXL76797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASO03261.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASO81219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASO86122.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASO90916.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASO95679.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXU92708.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXU93440.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASQ51681.1| 50S ribosomal protein L9 [Shigella flexneri 4c]
 gb|ASQ59536.1| 50S ribosomal protein L9 [Shigella flexneri 4c]
 gb|ASQ60923.1| 50S ribosomal protein L9 [Shigella flexneri 1a]
 gb|ASQ69873.1| 50S ribosomal subunit protein L9 [Escherichia coli NCCP15648]
 gb|ASQ83633.1| 50S ribosomal protein L9 [Shigella flexneri 1a]
 gb|OXV15797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXV16618.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXV35744.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXV40531.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXV42762.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXW56895.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW60139.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW63914.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXW70132.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW73057.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW79483.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXW84194.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW90049.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OXW90714.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXW98422.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXX03206.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXX07426.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXX11209.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|OXX16276.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OXZ48304.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ52185.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ63170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ65415.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ65659.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ71895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ80284.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ84080.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ87424.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ94649.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ96657.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OXZ97966.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA09221.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA12251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA12606.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA23055.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA28600.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA31369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA35587.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA38908.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA43081.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA51472.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA53344.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA58454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA65215.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA73369.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA74922.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA79401.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA82141.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA89839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA96794.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYA99700.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB00479.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB03631.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB11599.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB17635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB17732.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB21841.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB31011.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB31896.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB36864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB46702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB47396.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB47629.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB60888.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB61796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB67331.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB74458.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB76247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB81804.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB89849.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB91240.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYB99471.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC01938.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC02444.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC11796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC12679.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC17112.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC25490.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC27785.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC34216.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC43933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC45796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC50457.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC54628.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC56435.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC63782.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC65032.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC72898.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC74665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYC82550.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYD29756.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYE20852.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYE25328.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYE49608.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYE62175.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYE65203.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYE78414.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYF34399.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYF59057.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYF64602.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYF91683.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG12903.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG64667.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG65613.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYG75017.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG78823.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG81841.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYG86339.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG88535.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYG97965.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI01818.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI03328.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI13749.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI29797.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI35900.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI44299.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI48533.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYI55246.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI59572.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI61239.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI65827.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI66272.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI78165.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI82299.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYI82616.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYJ05951.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYJ19649.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ31213.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ31974.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ35258.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYJ46760.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYJ47092.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ49808.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ55221.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYJ70821.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYJ71337.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYJ77627.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK21936.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK26806.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK30575.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK33539.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYK35832.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYK48651.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYK48848.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK54643.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK60159.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK68803.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYK71034.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYK77502.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYL17841.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL26606.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL30204.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL33583.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYL36985.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL50033.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYL59045.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL64546.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYL71059.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYL96068.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|OYN28002.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|OYN39379.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYN48110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYN71304.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AST63294.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OYQ60003.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SNW15746.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZC26987.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZG35656.1| 50S ribosomal protein L9 [Escherichia coli O157:H7]
 gb|OZM88276.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZM93417.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZM98666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZN01314.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZN08875.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO54890.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO59933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO64690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO70295.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO74684.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO79818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO85155.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO89925.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO94535.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZO99469.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP04434.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP10041.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP14303.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP19456.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP24069.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP28176.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZP34575.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZQ55917.1| 50S ribosomal protein L9 [Klebsiella pneumoniae]
 gb|OZR93768.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZR98816.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZS04114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZS08070.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZS13568.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX62519.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX68729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX72388.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX78972.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX82687.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX89579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX92688.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZX92942.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZY03222.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZY11227.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZY13943.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZY21288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|OZY22077.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB70100.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB77940.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB83458.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB88583.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB90954.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAB92829.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAC04353.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAC15740.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAL31543.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAL35318.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAL43462.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAL46056.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAL50287.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ21219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ29211.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ29387.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ34409.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ37641.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ45912.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ50291.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ50433.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ57861.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ66486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ75513.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ75729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ84666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ88099.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ90909.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAQ96194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAR03904.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS47082.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS49993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS52816.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS59256.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS65167.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS70410.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS74636.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS76053.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAS81588.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|CTP95072.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|ASW62579.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|ASX08114.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAT81310.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAT83521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAT86692.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAT92447.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAT99579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU08015.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU12329.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU15348.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU19844.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU30196.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAU31633.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAX43160.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAX48525.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAX55117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASZ44174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ASZ48665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAY70326.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PAY70526.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PAY78972.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PAY90234.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PAY93459.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PAY93667.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PAY99299.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PAZ24999.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ29965.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ34743.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ37934.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ46856.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ52671.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ54000.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ58195.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ63405.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ71062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ75419.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ78054.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ84641.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ91311.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PAZ96303.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB11204.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB16381.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK09389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK15214.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK20839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK26005.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK27719.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK34622.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK37244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBK46942.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB75066.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB80171.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB84859.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB89944.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB94819.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATB99724.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATC06025.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATC14398.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATC19174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN53971.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN63648.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN64304.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN68890.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN77164.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN79118.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN85981.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBN87562.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO14723.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PBO45884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO49589.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO56100.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO61635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO62997.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO63119.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO75837.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO78687.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO95078.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBO95639.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PBO96406.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PBP09380.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PBP11234.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PBQ37801.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ40668.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ48825.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ50566.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ57105.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ60100.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ68761.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ70674.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ78373.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ83493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ88895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBQ93859.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR00066.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR01698.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR07937.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR12461.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR17610.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR26156.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR31638.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR33769.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR40950.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR46090.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR50251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR58117.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR60772.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR66076.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR69759.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR77451.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR85219.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR89452.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBR91075.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS00992.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS02886.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS08915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS21244.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS26033.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS30884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS38494.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS42548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS48028.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS51246.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS55591.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS60194.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS66410.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS72181.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS77348.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS82322.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS85915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS88922.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS96789.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBS98739.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT05338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT10398.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT15790.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT19264.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT24023.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT27702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT32352.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT37794.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT38583.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT49437.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT53149.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT53865.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT62696.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT67796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT73273.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT75738.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT82616.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT86084.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT89619.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT94238.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBT97261.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU02644.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU08597.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU10474.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU18075.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU21932.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU26493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU31580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU36796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU45858.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU47012.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU52074.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU56105.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU61230.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU69827.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU73256.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU79865.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU84167.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU88239.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PBU90665.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCD51350.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCD53290.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCD73473.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG24617.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG30350.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG34389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG40081.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG44559.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG50580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCG55233.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATG07740.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATG13123.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATG60254.1| 50S ribosomal protein L9 [Escherichia coli O104:H21 str.
           CFSAN002236]
 gb|PCM05516.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM10532.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM17521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM20843.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM29239.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM34360.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCM34407.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO25679.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO33877.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO54226.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO60824.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO76102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO81819.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO88565.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCO99864.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCP03451.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCQ53397.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCQ82590.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCQ88771.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCQ94856.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCR55753.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCR57273.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCR65271.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCR71273.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCR75035.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS33062.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS35934.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS41454.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS45556.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS50507.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS57491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS61818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS66713.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS73758.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS78141.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS78805.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS87675.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS93076.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCS97450.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT03694.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT12505.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT16719.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT24511.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT28119.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT33291.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PCT36630.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATH70440.1| 50S ribosomal protein L9 [Shigella flexneri 1c]
 gb|ATH90066.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|ATI04469.1| 50S ribosomal protein L9 [Escherichia coli M12]
 gb|PDM31703.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDM46604.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDM87663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDM94366.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDM97504.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDN04093.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDN89526.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDN90983.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDN92728.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO04732.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO13702.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO20071.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO26006.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO33139.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO36235.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO40247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO41800.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO49161.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO55222.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO57732.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO62933.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDO69917.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDS09125.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDS14035.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDS19356.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDT94158.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDT99465.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU04839.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU10472.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU17359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU20860.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU26042.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU31602.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU37318.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU43300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU49675.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU55654.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU61058.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU66129.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU71612.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU77184.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU82915.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU88230.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDU94660.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV01554.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV08268.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV12091.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV19509.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV20687.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV27067.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV35745.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV41246.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV44895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV52333.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV58727.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV61636.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV67744.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV69225.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV77843.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV80919.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PDV93288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PEG22084.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PEH59486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PEH94895.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PEH99634.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PEI19683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PFF95623.1| 50S ribosomal protein L9 [Escherichia albertii]
 gb|PGF62053.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF65482.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF65936.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF72387.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF83755.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF85729.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF89147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGF95259.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG03755.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG05548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG13819.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG15364.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG15751.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG22937.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG26540.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG35436.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG40657.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG46223.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG49280.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG53707.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG61726.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG67680.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PGG68576.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHG88871.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHG91536.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHH28589.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATM11085.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATM25930.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATM82243.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHK63041.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHK70068.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL25428.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL28622.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL35886.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL40867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL46930.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL48797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL55028.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL59742.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL64854.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL72091.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHL93853.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHM01017.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHN15444.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATO78923.1| 50S ribosomal protein L9 [Escherichia coli O91 str. RM7190]
 gb|PHU42869.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PHU47370.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PHU51828.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PHU56366.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PHU61538.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PHU65908.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PHU69073.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PHU74626.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PHU78998.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PHU82144.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PHU87642.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PHU90846.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PHU97009.1| 50S ribosomal protein L9 [Shigella boydii]
 emb|SLM09354.1| 50S ribosomal protein L9 [Escherichia coli O127:H6]
 emb|SNU18844.1| 50S ribosomal protein L9 [Escherichia coli O127:H6]
 gb|ATP23758.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHW94063.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PHW98744.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIA90084.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM10579.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM13586.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM18980.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM23629.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM28134.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM33914.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM37879.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM44485.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM46543.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM58450.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIM61046.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATU36641.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATV11686.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATV48270.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATV77508.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PIS77443.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. USDA 5905]
 gb|ATW95203.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX09556.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX13125.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX18779.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX41607.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX49084.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX52137.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX57914.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF58020.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF62549.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF67239.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF71031.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF74149.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF80969.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF86238.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF87752.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF92885.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJF96965.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG01620.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG08441.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG12765.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG18533.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG25150.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG29728.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG34439.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJG75005.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATY21129.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATY26066.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJH99693.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJI59844.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJI64909.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJN73873.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJO16541.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATX37374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATZ36092.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJR33667.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. TW14313]
 gb|PJR39525.1| 50S ribosomal protein L9 [Escherichia coli O55:H7 str. TB182A]
 gb|PJR45089.1| 50S ribosomal protein L9 [Escherichia coli O157:H7 str. EC1825]
 gb|PJW26417.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW31518.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW36386.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW42589.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW50170.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW55411.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW59362.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW65347.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW70063.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW77251.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW79580.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW83376.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJW88496.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX00098.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX03650.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ATZ32169.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX78798.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX84390.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX90077.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX98386.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJX99796.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY08248.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY11330.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY19424.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY23016.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY26530.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY33202.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY41196.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY47095.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY51698.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY54427.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY59641.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PJY89479.1| 50S ribosomal protein L9 [Shigella sonnei]
 emb|SMZ47147.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|AUA42052.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUA44894.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD55265.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD56063.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD67721.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD70808.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD73288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD81147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD91495.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKD94199.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE01374.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE15207.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE80180.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE86093.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE90896.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE95716.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKE98306.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKF11212.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKF11634.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKF53147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKG07577.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKI92663.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKI95917.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKI97548.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ06441.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ12059.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ18726.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ23558.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ25848.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ33300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ35953.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ44247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKJ48283.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUF77425.1| 50S ribosomal protein L9 [Escherichia coli O121:H19]
 gb|AUG18887.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|PKQ96963.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKR64951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKR67662.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKR75287.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUG67450.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUG96327.1| 50S ribosomal subunit protein L9 [Escherichia coli]
 gb|PKZ11255.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKZ33797.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKZ48941.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PKZ76147.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLA93787.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB02291.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB58359.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB63669.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB65690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB70613.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLB78657.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUJ93050.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUJ94490.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUK03029.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUK08247.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUK13525.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUK18742.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUK23905.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLJ83493.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLJ84072.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLJ89488.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLK02918.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLK04624.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLK10249.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLK12109.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PLR15282.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUF93764.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUL65455.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUL67400.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUL87089.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUL88252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUM09964.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUM24445.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUN49384.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PMB58513.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PMD83135.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PMD86229.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PMD91316.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PME06270.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ97423.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ89744.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOR04042.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ87100.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ61556.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ69399.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ79707.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ84139.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOQ74015.1| 50S ribosomal protein L9 [Escherichia coli]
 emb|SOR06375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUO35081.1| ribosomal protein L9 [Escherichia coli]
 gb|AUO40999.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUO59297.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNB91295.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNB96544.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNC16245.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUQ40071.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PND69535.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PND74067.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PND79173.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PND85745.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PND97309.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNL71580.1| 50S ribosomal protein L9 [Escherichia coli O157]
 gb|PNM74926.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PNN27890.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNO48938.1| 50S ribosomal protein L9 [Shigella sonnei]
 gb|PNO97486.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNP03680.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PNP66262.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUP44036.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUS40091.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUS68178.1| 50S ribosomal protein L9 [Escherichia albertii]
 gb|PNR02127.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNR08227.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNR15901.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNR19430.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNR23158.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNS25376.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUT11001.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUN93110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUT28961.1| 50S ribosomal protein L9 [Escherichia marmotae]
 gb|PNY40694.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNY54092.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNY56798.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PNY68323.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUV21332.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUV31288.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POF69313.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POF72030.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POF78939.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POF83164.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUU33383.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|POH47936.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POH78375.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POH90206.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POH97191.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POH99091.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POI07681.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POI10284.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL47061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL53491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL58385.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL60673.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL68039.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL76204.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL77071.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL87824.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL87961.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POL96675.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POM00070.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POM02163.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUX04623.1| LSU ribosomal protein L9p [Escherichia coli]
 gb|POO34725.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POO43683.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POO47202.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUY02795.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUY45437.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUY30962.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POR89633.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|POR92844.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|POS18110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS20416.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS23569.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS30926.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS35245.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS38300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS44177.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS49767.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS53906.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POS59710.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT06324.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT08521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT08776.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT18163.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT21496.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POT22901.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POU29510.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POV28891.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AUZ91783.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|POZ11495.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVB47383.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPA52800.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVD31420.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE10308.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE15521.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE20354.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE28986.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE29389.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE35024.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE43661.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE47831.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE52130.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPE92788.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVE96500.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVG01831.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPI96300.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPO19119.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPO97885.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPQ51803.1| 50S ribosomal protein L9 [Escherichia albertii]
 gb|PPV50829.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV51152.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV55833.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV60405.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV66496.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV69082.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV76545.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV83874.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV90544.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPV96407.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW04771.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW06087.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW09394.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW16806.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW21841.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW25731.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW27750.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW34032.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW37102.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW48201.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW48844.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW55445.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW57355.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW64860.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW67759.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW71893.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW80303.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW86525.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW91106.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW99155.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPW99338.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX02252.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX11817.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX18077.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX19604.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX24992.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX26028.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX33891.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX40361.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX45254.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX49675.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX52717.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX60061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPX64965.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY62656.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY66413.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY67991.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY72269.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY85984.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY88614.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY88884.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPY99845.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ00951.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ03608.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ13507.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ13674.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ20336.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ24877.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ32168.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ37767.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ41236.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ52555.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PPZ97061.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA07174.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA08522.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA13248.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA24110.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA24491.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA28622.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA29991.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA35916.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA45651.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA45870.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA57249.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA66429.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQA67635.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQH11296.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQI96785.1| 50S ribosomal protein L9 [Escherichia fergusonii]
 gb|PQJ01279.1| 50S ribosomal protein L9 [Escherichia fergusonii]
 gb|PQK20732.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK24908.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK35083.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK38063.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK38714.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK44887.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK52867.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK57862.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK62852.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQK65690.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVI54350.1| 50S ribosomal protein L9 [Escherichia coli str. K-12 substr.
           MG1655]
 gb|AVJ11700.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQM82386.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQM84500.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN02719.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN06205.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN10903.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|PQN21314.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN23860.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN23931.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN33322.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PQN34250.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN41763.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN50663.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|PQN58723.1| 50S ribosomal protein L9 [Shigella boydii]
 gb|PQN65432.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN67928.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN68724.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN73321.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN79682.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN85077.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN87584.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQN96936.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQO01962.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQO08590.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|PQO10900.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQO17544.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQO21433.1| 50S ribosomal protein L9 [Shigella flexneri]
 gb|PQO69176.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQO74362.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQO77368.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQO84195.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQO90552.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQO94264.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQP11666.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQP28769.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVJ72595.1| ribosomal protein L9 [Escherichia coli]
 gb|AVJ74196.1| ribosomal protein L9 [Escherichia coli]
 gb|PQV20372.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQV28471.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQV36981.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PQV41324.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRB40297.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRC30058.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVL32286.1| 50S ribosomal protein L9 [Escherichia coli O104:H4]
 gb|AVM03945.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRO98629.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP01391.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP09795.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP10971.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP19441.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP21127.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP31023.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP35040.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP37654.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP40355.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRP41525.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVN02996.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVN12217.1| ribosomal protein L9 [Escherichia coli]
 gb|AVL09161.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVN37019.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRT62367.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PRW36034.1| ribosomal protein L9 [Escherichia coli]
 gb|PRW49523.1| ribosomal protein L9 [Escherichia coli]
 gb|PRW51956.1| ribosomal protein L9 [Escherichia coli]
 gb|PSB93257.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF25459.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF26094.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF40025.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF43591.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF47210.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF55605.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF56593.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF61863.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF71008.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF71910.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF75530.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF85818.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF89325.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF91100.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSF98861.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG03593.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG08051.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG16416.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG18979.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG22264.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG27270.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG32027.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG36731.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG42149.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG46179.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG53343.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG55853.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG67604.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG74413.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSG80041.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|AVP28235.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSK08993.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSK26156.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSL65860.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSL68101.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSL68752.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|PSL78406.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_001196060.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 ref|YP_405750.1| 50S ribosomal protein L9 [Shigella dysenteriae Sd197]
 sp|Q328J6.1|RL9_SHIDS RecName: Full=50S ribosomal protein L9
 gb|ABB64259.1| 50S ribosomal subunit protein L9 [Shigella dysenteriae Sd197]
 gb|EFP69976.1| ribosomal protein L9 [Shigella dysenteriae 1617]
 gb|AHA68562.1| LSU ribosomal protein L9P [Shigella dysenteriae 1617]
 gb|ESU81905.1| LSU ribosomal protein L9P [Shigella dysenteriae WRSd5]
 gb|ESU82062.1| LSU ribosomal protein L9P [Shigella dysenteriae WRSd3]
 gb|PQN20103.1| 50S ribosomal protein L9 [Shigella dysenteriae]
 gb|PQN52979.1| 50S ribosomal protein L9 [Shigella dysenteriae]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKIDALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_050009916.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEVKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_024234165.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAVANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_016232414.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|EOU54113.1| 50S ribosomal protein L9 [Escherichia coli KTE14]
 gb|OEM18668.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLATANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_003582865.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|END49269.1| ribosomal protein L9 [Escherichia coli MP020980.1]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 122/149 (81%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        +LETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINSLETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_001591419.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|ELG39383.1| 50S ribosomal protein L9 [Escherichia coli KTE84]
          Length = 149

 Score =  224 bits (571), Expect = 6e-68
 Identities = 123/149 (82%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAEANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


>ref|WP_044810929.1| 30S ribosomal protein S6 [Escherichia coli]
          Length = 126

 Score =  223 bits (568), Expect = 8e-68
 Identities = 112/120 (93%), Positives = 112/120 (93%)
 Frame = -2

Query: 1455 MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYV 1276
            MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYV
Sbjct: 1    MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYV 60

Query: 1275 LMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKXXXXXXXXDFANET 1096
            LMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAK        DFANET
Sbjct: 61   LMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANET 120


>ref|WP_047088328.1| 50S ribosomal protein L9 [Escherichia coli]
 gb|KLG65216.1| 50S ribosomal protein L9 [Escherichia coli]
          Length = 149

 Score =  224 bits (570), Expect = 9e-68
 Identities = 122/149 (81%), Positives = 123/149 (82%)
 Frame = -2

Query: 465 MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFXXXXXXXXXXXXX 286
           MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFF             
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 285 XXXXXXXXXXXXXALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 106
                        ALETVTIASKAGDEGKLFGS+GTRDIADAVTAAGVEVAKSEVRLPNG
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSVGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 105 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 19
           VLRTTGEHEVSFQVHSEVFAKVIVNVVAE
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


Top