BLASTX nr result
ID: Acanthopanax22_contig00000066
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax22_contig00000066
(430 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|WP_016159095.1| zinc ribbon-containing protein, partial [Esc... 292 e-100
ref|WP_100033710.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_097433056.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_096907961.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_001044880.1| MULTISPECIES: zinc ribbon-containing protein... 292 e-100
ref|WP_039022162.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_032223989.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_003919508.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
ref|WP_001044867.1| zinc ribbon-containing protein [Escherichia ... 292 e-100
gb|ELF89669.1| hypothetical protein WEQ_00502 [Escherichia coli ... 292 e-100
ref|WP_053903911.1| zinc ribbon-containing protein [Escherichia ... 292 1e-99
ref|WP_105076175.1| zinc ribbon-containing protein [Escherichia ... 291 1e-99
ref|WP_096973933.1| zinc ribbon-containing protein [Escherichia ... 291 1e-99
ref|WP_078045924.1| zinc ribbon-containing protein [Escherichia ... 291 1e-99
ref|WP_024164991.1| MULTISPECIES: zinc ribbon-containing protein... 291 1e-99
ref|WP_001044874.1| zinc ribbon-containing protein [Escherichia ... 291 1e-99
ref|WP_001044873.1| MULTISPECIES: zinc ribbon-containing protein... 291 1e-99
gb|AHE58715.1| hypothetical protein EAKF1_ch0809c [Escherichia a... 291 1e-99
ref|WP_060703588.1| zinc ribbon-containing protein [Escherichia ... 291 2e-99
ref|WP_104691520.1| zinc ribbon-containing protein [Escherichia ... 291 2e-99
>ref|WP_016159095.1| zinc ribbon-containing protein, partial [Escherichia coli]
gb|EOQ57230.1| hypothetical protein WEW_01991, partial [Escherichia coli KTE33]
Length = 152
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_100033710.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_097433056.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_096907961.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_001044880.1| MULTISPECIES: zinc ribbon-containing protein [Proteobacteria]
ref|NP_308708.1| hypothetical protein ECs0681 [Escherichia coli O157:H7 str. Sakai]
ref|NP_415176.1| DUF1451 family protein [Escherichia coli str. K-12 substr. MG1655]
ref|YP_402260.1| hypothetical protein SDY_0567 [Shigella dysenteriae Sd197]
ref|YP_002411496.1| hypothetical protein ECUMN_0737 [Escherichia coli UMN026]
ref|YP_006118951.1| hypothetical protein NRG857_02930 [Escherichia coli O83:H1 str. NRG
857C]
ref|YP_006780347.1| hypothetical protein O3K_18375 [Escherichia coli O104:H4 str.
2011C-3493]
sp|P0AAU1.1|YBEL_ECO57 RecName: Full=Uncharacterized protein YbeL
sp|P0AAU0.1|YBEL_ECOL6 RecName: Full=Uncharacterized protein YbeL
sp|P0AAT9.1|YBEL_ECOLI RecName: Full=Uncharacterized protein YbeL
gb|AAG54977.1|AE005243_6 putative alpha helical protein [Escherichia coli O157:H7 str.
EDL933]
gb|AAN79207.1|AE016757_111 Hypothetical protein ybeL [Escherichia coli CFT073]
gb|AAB40844.1| hypothetical protein [Escherichia coli]
gb|AAC73744.1| DUF1451 family protein [Escherichia coli str. K-12 substr. MG1655]
dbj|BAA35290.1| conserved hypothetical protein [Escherichia coli str. K-12 substr.
W3110]
dbj|BAB34104.1| putative alpha helical protein [Escherichia coli O157:H7 str.
Sakai]
gb|AAZ87363.1| putative alpha helical protein [Shigella sonnei Ss046]
gb|ABB60771.1| putative alpha helical protein [Shigella dysenteriae Sd197]
gb|ABB65207.1| putative alpha helical protein [Shigella boydii Sb227]
gb|ABE06146.1| conserved hypothetical protein [Escherichia coli UTI89]
gb|ABG68701.1| putative cytoplasmic protein [Escherichia coli 536]
gb|ABJ00058.1| conserved hypothetical protein [Escherichia coli APEC O1]
gb|ABV19790.1| conserved hypothetical protein [Escherichia coli O139:H28 str.
E24377A]
gb|ACB01764.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
gb|ACB01865.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
gb|ACB19135.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
gb|EDU31023.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4196]
gb|EDU62916.1| conserved hypothetical protein [Escherichia coli 53638]
gb|EDU71782.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4076]
gb|EDU73278.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4401]
gb|EDU82012.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4486]
gb|EDU83801.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4501]
gb|EDU91938.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC869]
gb|EDU93982.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC508]
gb|EDV61039.1| conserved hypothetical protein [Escherichia coli B7A]
gb|EDV65385.1| conserved hypothetical protein [Escherichia coli F11]
gb|EDV88100.1| conserved hypothetical protein [Escherichia coli E110019]
gb|EDX33423.1| conserved hypothetical protein [Shigella dysenteriae 1012]
gb|EDX37208.1| conserved hypothetical protein [Escherichia coli 101-1]
gb|EDZ75164.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4206]
gb|EDZ80696.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4045]
gb|EDZ84760.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4042]
gb|ACI36938.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
EC4115]
gb|ACI86831.1| putative alpha helical protein [Escherichia coli]
gb|ACI86832.1| putative alpha helical protein [Escherichia coli]
gb|ACI86833.1| putative alpha helical protein [Escherichia coli]
gb|ACI86834.1| putative alpha helical protein [Escherichia coli]
gb|ACI86835.1| putative alpha helical protein [Escherichia coli]
dbj|BAG76236.1| conserved hypothetical protein [Escherichia coli SE11]
emb|CAS08091.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
gb|EEC30970.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
TW14588]
emb|CAU96507.1| conserved hypothetical protein [Escherichia coli 55989]
emb|CAQ89960.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
emb|CAQ97497.1| conserved hypothetical protein [Escherichia coli IAI1]
emb|CAR02025.1| conserved hypothetical protein [Escherichia coli S88]
emb|CAR06847.1| conserved hypothetical protein [Escherichia coli ED1a]
emb|CAR11950.1| conserved hypothetical protein [Escherichia coli UMN026]
emb|CAP75142.1| Uncharacterized protein ybel [Escherichia coli LF82]
gb|EEH84852.1| hypothetical protein ESAG_00564 [Escherichia sp. 3_2_53FAA]
gb|EEJ48929.1| hypothetical protein HMPREF0358_0969 [Escherichia coli 83972]
gb|ACR62443.1| conserved protein [Escherichia coli BW2952]
emb|CAQ31118.1| conserved protein [Escherichia coli BL21(DE3)]
gb|ACT30017.1| protein of unknown function DUF1451 [Escherichia coli
'BL21-Gold(DE3)pLysS AG']
gb|ACT38297.1| hypothetical protein ECB_00612 [Escherichia coli B str. REL606]
gb|ACT42490.1| DUF1451 family protein [Escherichia coli BL21(DE3)]
gb|ACT70570.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
dbj|BAI24046.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
dbj|BAI34642.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
gb|ACX40612.1| protein of unknown function DUF1451 [Escherichia coli DH1]
dbj|BAI54123.1| conserved hypothetical protein [Escherichia coli SE15]
emb|CBG33504.1| conserved hypothetical protein [Escherichia coli 042]
gb|ADD55428.1| hypothetical protein G2583_0806 [Escherichia coli O55:H7 str.
CB9615]
gb|EFE64697.1| hypothetical protein ECCG_03639 [Escherichia coli B088]
gb|EFF01516.1| hypothetical protein ECGG_02283 [Escherichia coli FVEC1412]
gb|EFF14430.1| hypothetical protein ECEG_03716 [Escherichia coli B354]
gb|ADE90789.1| conserved hypothetical protein [Escherichia coli IHE3034]
gb|EFI20887.1| hypothetical protein ECFG_02475 [Escherichia coli FVEC1302]
gb|EFI86360.1| hypothetical protein HMPREF9551_04707 [Escherichia coli MS 196-1]
gb|EFJ54777.1| hypothetical protein HMPREF9549_03814 [Escherichia coli MS 185-1]
gb|EFJ58985.1| hypothetical protein HMPREF9553_04980 [Escherichia coli MS 200-1]
gb|EFJ63959.1| hypothetical protein HMPREF9547_04879 [Escherichia coli MS 175-1]
gb|EFJ71263.1| hypothetical protein HMPREF9552_05149 [Escherichia coli MS 198-1]
gb|EFJ79690.1| hypothetical protein HMPREF9534_04313 [Escherichia coli MS 69-1]
gb|EFJ83990.1| hypothetical protein HMPREF9536_05731 [Escherichia coli MS 84-1]
gb|EFJ90804.1| hypothetical protein HMPREF9531_04196 [Escherichia coli MS 45-1]
gb|EFJ95791.1| hypothetical protein HMPREF9540_04208 [Escherichia coli MS 115-1]
gb|EFK00100.1| hypothetical protein HMPREF9548_05229 [Escherichia coli MS 182-1]
gb|EFK13191.1| hypothetical protein HMPREF9541_04468 [Escherichia coli MS 116-1]
gb|EFK20601.1| hypothetical protein HMPREF9530_02795 [Escherichia coli MS 21-1]
gb|EFK24120.1| hypothetical protein HMPREF9550_03799 [Escherichia coli MS 187-1]
gb|EFK45459.1| hypothetical protein HMPREF9346_02899 [Escherichia coli MS 119-7]
gb|EFK50597.1| hypothetical protein HMPREF9345_02918 [Escherichia coli MS 107-1]
gb|EFK70436.1| hypothetical protein HMPREF9347_00691 [Escherichia coli MS 124-1]
gb|EFK72251.1| hypothetical protein HMPREF9535_03828 [Escherichia coli MS 78-1]
gb|EFK92518.1| hypothetical protein HMPREF9543_00621 [Escherichia coli MS 146-1]
gb|EFM54127.1| hypothetical protein ECNC101_13462 [Escherichia coli NC101]
gb|EFN37848.1| protein of unknown function DUF1451 [Escherichia coli W]
gb|ADN45288.1| putative alpha helical protein [Escherichia coli ABU 83972]
gb|ADN72223.1| hypothetical protein UM146_14300 [Escherichia coli UM146]
gb|EFO58127.1| hypothetical protein HMPREF9348_02704 [Escherichia coli MS 145-7]
gb|EFP71513.1| conserved hypothetical protein [Shigella dysenteriae 1617]
emb|CBJ00178.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
gb|ADR26017.1| hypothetical protein NRG857_02930 [Escherichia coli O83:H1 str. NRG
857C]
gb|ADT74225.1| conserved protein [Escherichia coli W]
dbj|BAJ42468.1| hypothetical protein ECDH1ME8569_0612 [Escherichia coli DH1]
gb|EFU35020.1| hypothetical protein HMPREF9350_03069 [Escherichia coli MS 85-1]
gb|EFU46499.1| hypothetical protein HMPREF9539_02973 [Escherichia coli MS 110-3]
gb|EFU51441.1| hypothetical protein HMPREF9544_03497 [Escherichia coli MS 153-1]
gb|EFU58437.1| hypothetical protein HMPREF9545_01770 [Escherichia coli MS 16-3]
gb|EFU97055.1| conserved hypothetical protein [Escherichia coli 3431]
gb|EFW50227.1| hypothetical protein SDB_02362 [Shigella dysenteriae CDC 74-1112]
gb|EFW53401.1| hypothetical protein SGB_04455 [Shigella boydii ATCC 9905]
gb|EFW60150.1| hypothetical protein SGF_02400 [Shigella flexneri CDC 796-83]
gb|EFW67690.1| hypothetical protein ECoD_00301 [Escherichia coli O157:H7 str.
EC1212]
gb|EFW68807.1| hypothetical protein EcoM_03607 [Escherichia coli WV_060327]
gb|EFW72836.1| hypothetical protein ECoL_04590 [Escherichia coli EC4100B]
gb|EFX07856.1| hypothetical protein ECO5101_11389 [Escherichia coli O157:H7 str.
G5101]
gb|EFX12668.1| hypothetical protein ECO9389_16682 [Escherichia coli O157:H- str.
493-89]
gb|EFX17460.1| hypothetical protein ECO2687_18117 [Escherichia coli O157:H- str. H
2687]
gb|EFX22466.1| hypothetical protein ECO7815_24908 [Escherichia coli O55:H7 str.
3256-97]
gb|EFX27630.1| hypothetical protein ECO5905_06207 [Escherichia coli O55:H7 str.
USDA 5905]
gb|EFX32032.1| hypothetical protein ECOSU61_10249 [Escherichia coli O157:H7 str.
LSU-61]
gb|EFZ39882.1| hypothetical protein ECEPECA14_4434 [Escherichia coli EPECa14]
gb|EFZ49713.1| hypothetical protein SS53G_5743 [Shigella sonnei 53G]
gb|EFZ65437.1| hypothetical protein ECOK1180_1289 [Escherichia coli OK1180]
gb|EFZ70369.1| hypothetical protein ECOK1357_1661 [Escherichia coli OK1357]
gb|EFZ76546.1| hypothetical protein ECRN5871_0571 [Escherichia coli RN587/1]
gb|ADX51806.1| protein of unknown function DUF1451 [Escherichia coli KO11FL]
gb|EGB34659.1| hypothetical protein ERCG_00441 [Escherichia coli E1520]
gb|EGB39217.1| hypothetical protein ERDG_00395 [Escherichia coli E482]
gb|EGB41180.1| hypothetical protein EREG_03302 [Escherichia coli H120]
gb|EGB48647.1| hypothetical protein ERKG_00552 [Escherichia coli H252]
gb|EGB54108.1| hypothetical protein ERLG_00392 [Escherichia coli H263]
gb|EGB58780.1| hypothetical protein ERGG_00398 [Escherichia coli H489]
gb|EGB63006.1| hypothetical protein ERJG_01168 [Escherichia coli M863]
gb|EGB67312.1| hypothetical protein ERHG_01911 [Escherichia coli TA007]
gb|EGB75524.1| hypothetical protein HMPREF9532_04025 [Escherichia coli MS 57-2]
gb|EGB79686.1| hypothetical protein HMPREF9533_05538 [Escherichia coli MS 60-1]
gb|EGB85291.1| hypothetical protein HMPREF9542_05307 [Escherichia coli MS 117-3]
gb|EGC08732.1| hypothetical protein ERIG_00758 [Escherichia fergusonii B253]
gb|EGC10632.1| hypothetical protein ERBG_03393 [Escherichia coli E1167]
gb|EGC96037.1| hypothetical protein ECD227_2275 [Escherichia fergusonii ECD227]
gb|EGD65186.1| hypothetical protein ECoA_03891 [Escherichia coli O157:H7 str.
1044]
gb|EGD69565.1| hypothetical protein ECF_00648 [Escherichia coli O157:H7 str. 1125]
gb|EGE65949.1| hypothetical protein ECSTEC7V_0780 [Escherichia coli STEC_7v]
gb|EGI10164.1| putative alpha helical protein [Escherichia coli H736]
gb|EGI21991.1| putative alpha helical protein [Escherichia coli M718]
gb|EGI26927.1| putative alpha helical protein [Escherichia coli TA206]
gb|EGI32394.1| putative alpha helical protein [Escherichia coli TA143]
gb|EGI38104.1| putative alpha helical protein [Escherichia coli TA271]
gb|EGI42012.1| putative alpha helical protein [Escherichia coli TA280]
gb|EGI47642.1| putative alpha helical protein [Escherichia coli H591]
gb|EGI51920.1| putative alpha helical protein [Escherichia coli H299]
gb|EGI99366.1| hypothetical protein SB521682_0651 [Shigella boydii 5216-82]
gb|EGJ01814.1| hypothetical protein SD15574_0932 [Shigella dysenteriae 155-74]
gb|EGJ02712.1| hypothetical protein SB359474_0542 [Shigella boydii 3594-74]
gb|EGJ07481.1| hypothetical protein SSJG_03531 [Escherichia coli D9]
gb|AEE55324.1| conserved hypothetical protein [Escherichia coli UMNK88]
gb|AEJ55276.1| hypothetical protein UMNF18_642 [Escherichia coli UMNF18]
gb|EGR64937.1| hypothetical protein HUSEC41_03165 [Escherichia coli O104:H4 str.
01-09591]
gb|EGR75830.1| hypothetical protein HUSEC_03353 [Escherichia coli O104:H4 str.
LB226692]
gb|EGT66783.1| hypothetical protein C22711_0811 [Escherichia coli O104:H4 str.
C227-11]
gb|EGU25171.1| hypothetical protein IAE_19584 [Escherichia coli XH140A]
gb|EGU97498.1| methyl-accepting chemotaxis protein [Escherichia coli MS 79-10]
gb|EGV46877.1| hypothetical protein IAM_14302 [Escherichia coli XH001]
gb|EGW73376.1| hypothetical protein ECSTECC16502_1054 [Escherichia coli
STEC_C165-02]
gb|EGW75931.1| hypothetical protein ECSTECB2F1_0558 [Escherichia coli STEC_B2F1]
gb|EGW77227.1| hypothetical protein EC253486_0923 [Escherichia coli 2534-86]
gb|EGW85702.1| hypothetical protein ECSTEC94C_0761 [Escherichia coli STEC_94C]
gb|EGW92268.1| hypothetical protein EC30301_0702 [Escherichia coli 3030-1]
gb|EGW96862.1| hypothetical protein ECSTECDG1313_1142 [Escherichia coli
STEC_DG131-3]
gb|EGW98247.1| hypothetical protein ECSTECEH250_0705 [Escherichia coli STEC_EH250]
gb|EGX09809.1| hypothetical protein ECSTECMHI813_0479 [Escherichia coli
STEC_MHI813]
gb|EGX12803.1| hypothetical protein ECG581_0832 [Escherichia coli G58-1]
gb|EGX20580.1| hypothetical protein ECSTECS1191_1008 [Escherichia coli STEC_S1191]
gb|EGX25009.1| hypothetical protein ECTX1999_0670 [Escherichia coli TX1999]
gb|EHF18898.1| hypothetical protein EUDG_03947 [Escherichia coli O104:H4 str.
04-8351]
gb|EHF19005.1| hypothetical protein EUAG_00927 [Escherichia coli O104:H4 str.
C227-11]
gb|EHF24778.1| hypothetical protein EUBG_00925 [Escherichia coli O104:H4 str.
C236-11]
gb|EHF37712.1| hypothetical protein EUEG_00912 [Escherichia coli O104:H4 str.
09-7901]
gb|EHF39488.1| hypothetical protein EUHG_00933 [Escherichia coli O104:H4 str.
11-4404]
gb|EHF43879.1| hypothetical protein EUFG_00928 [Escherichia coli O104:H4 str.
11-3677]
gb|EHF45842.1| hypothetical protein EUIG_00935 [Escherichia coli O104:H4 str.
11-4522]
gb|EHF48492.1| hypothetical protein EUJG_02825 [Escherichia coli O104:H4 str.
11-4623]
gb|EHF61843.1| hypothetical protein EUKG_00910 [Escherichia coli O104:H4 str.
11-4632 C1]
gb|EHF64623.1| hypothetical protein EULG_00927 [Escherichia coli O104:H4 str.
11-4632 C2]
gb|EHF67254.1| hypothetical protein EUMG_00928 [Escherichia coli O104:H4 str.
11-4632 C3]
gb|EHF77960.1| hypothetical protein EUOG_00929 [Escherichia coli O104:H4 str.
11-4632 C5]
gb|EHF81893.1| hypothetical protein EUNG_00429 [Escherichia coli O104:H4 str.
11-4632 C4]
gb|EHG02158.1| hypothetical protein i01_00846 [Escherichia coli cloneA_i1]
gb|AER83292.1| hypothetical protein i02_0703 [Escherichia coli str. 'clone D i2']
gb|AER88211.1| hypothetical protein i14_0703 [Escherichia coli str. 'clone D i14']
dbj|BAL37807.1| conserved protein [Escherichia coli str. K-12 substr. MDS42]
gb|EHN82647.1| hypothetical protein ESQG_03466 [Escherichia coli H494]
gb|EHN83852.1| hypothetical protein ESRG_03319 [Escherichia coli TA124]
gb|EHN99681.1| hypothetical protein ESPG_01792 [Escherichia coli H397]
gb|EHO02379.1| hypothetical protein ESOG_02368 [Escherichia coli E101]
gb|EHO04639.1| hypothetical protein ESNG_00525 [Escherichia coli B093]
gb|EHP67594.1| hypothetical protein HMPREF0986_00424 [Escherichia coli 4_1_47FAA]
gb|AEZ39406.1| hypothetical protein ECO55CA74_03955 [Escherichia coli O55:H7 str.
RM12579]
gb|EHU13936.1| hypothetical protein ECDEC1A_0646 [Escherichia coli DEC1A]
gb|EHU16068.1| hypothetical protein ECDEC1C_0606 [Escherichia coli DEC1C]
gb|EHU18347.1| hypothetical protein ECDEC1B_0698 [Escherichia coli DEC1B]
gb|EHU27751.1| hypothetical protein ECDEC1D_1011 [Escherichia coli DEC1D]
gb|EHU31821.1| hypothetical protein ECDEC1E_0775 [Escherichia coli DEC1E]
gb|EHU33158.1| hypothetical protein ECDEC2A_0894 [Escherichia coli DEC2A]
gb|EHU43931.1| hypothetical protein ECDEC2B_0715 [Escherichia coli DEC2B]
gb|EHU48469.1| hypothetical protein ECDEC2D_0734 [Escherichia coli DEC2D]
gb|EHU49961.1| hypothetical protein ECDEC2C_0620 [Escherichia coli DEC2C]
gb|EHU62967.1| hypothetical protein ECDEC2E_0668 [Escherichia coli DEC2E]
gb|EHU64531.1| hypothetical protein ECDEC3A_0642 [Escherichia coli DEC3A]
gb|EHU66383.1| hypothetical protein ECDEC3B_0537 [Escherichia coli DEC3B]
gb|EHU77935.1| hypothetical protein ECDEC3C_0882 [Escherichia coli DEC3C]
gb|EHU82084.1| hypothetical protein ECDEC3D_0697 [Escherichia coli DEC3D]
gb|EHU84476.1| hypothetical protein ECDEC3E_0865 [Escherichia coli DEC3E]
gb|EHU95507.1| hypothetical protein ECDEC3F_0862 [Escherichia coli DEC3F]
gb|EHU97922.1| hypothetical protein ECDEC4A_0585 [Escherichia coli DEC4A]
gb|EHV03082.1| hypothetical protein ECDEC4B_0548 [Escherichia coli DEC4B]
gb|EHV13248.1| hypothetical protein ECDEC4C_0564 [Escherichia coli DEC4C]
gb|EHV14921.1| hypothetical protein ECDEC4D_0558 [Escherichia coli DEC4D]
gb|EHV17762.1| hypothetical protein ECDEC4E_0684 [Escherichia coli DEC4E]
gb|EHV28939.1| hypothetical protein ECDEC5A_0710 [Escherichia coli DEC5A]
gb|EHV31011.1| hypothetical protein ECDEC4F_0553 [Escherichia coli DEC4F]
gb|EHV35894.1| hypothetical protein ECDEC5B_0949 [Escherichia coli DEC5B]
gb|EHV43614.1| hypothetical protein ECDEC5C_0897 [Escherichia coli DEC5C]
gb|EHV43807.1| hypothetical protein ECDEC5D_1119 [Escherichia coli DEC5D]
gb|EHV50616.1| hypothetical protein ECDEC5E_0595 [Escherichia coli DEC5E]
gb|EHV62466.1| hypothetical protein ECDEC6A_0800 [Escherichia coli DEC6A]
gb|EHV64767.1| hypothetical protein ECDEC6B_0786 [Escherichia coli DEC6B]
gb|EHV66302.1| hypothetical protein ECDEC6C_0671 [Escherichia coli DEC6C]
gb|EHV76323.1| hypothetical protein ECDEC6D_0759 [Escherichia coli DEC6D]
gb|EHV79362.1| hypothetical protein ECDEC6E_0600 [Escherichia coli DEC6E]
gb|EHV81345.1| hypothetical protein ECDEC7A_0760 [Escherichia coli DEC7A]
gb|EHV90703.1| hypothetical protein ECDEC7C_0728 [Escherichia coli DEC7C]
gb|EHV95178.1| hypothetical protein ECDEC7D_0894 [Escherichia coli DEC7D]
gb|EHV99893.1| hypothetical protein ECDEC7B_0705 [Escherichia coli DEC7B]
gb|EHW04977.1| hypothetical protein ECDEC7E_0689 [Escherichia coli DEC7E]
gb|EHW14697.1| hypothetical protein ECDEC8A_0844 [Escherichia coli DEC8A]
gb|EHW18941.1| hypothetical protein ECDEC8B_0657 [Escherichia coli DEC8B]
gb|EHW24402.1| hypothetical protein ECDEC8C_0913 [Escherichia coli DEC8C]
gb|EHW30284.1| hypothetical protein ECDEC8D_1006 [Escherichia coli DEC8D]
gb|EHW34327.1| hypothetical protein ECDEC8E_0700 [Escherichia coli DEC8E]
gb|EHW42913.1| hypothetical protein ECDEC9A_0767 [Escherichia coli DEC9A]
gb|EHW44139.1| hypothetical protein ECDEC9B_0652 [Escherichia coli DEC9B]
gb|EHW51599.1| hypothetical protein ECDEC9C_0743 [Escherichia coli DEC9C]
gb|EHW56173.1| hypothetical protein ECDEC9D_0669 [Escherichia coli DEC9D]
gb|EHW63137.1| hypothetical protein ECDEC9E_0770 [Escherichia coli DEC9E]
gb|EHW68616.1| hypothetical protein ECDEC10A_0819 [Escherichia coli DEC10A]
gb|EHW77224.1| hypothetical protein ECDEC10B_0944 [Escherichia coli DEC10B]
gb|EHW79956.1| hypothetical protein ECDEC10C_1000 [Escherichia coli DEC10C]
gb|EHW82805.1| hypothetical protein ECDEC10D_0787 [Escherichia coli DEC10D]
gb|EHW94493.1| hypothetical protein ECDEC10E_0773 [Escherichia coli DEC10E]
gb|EHX00174.1| hypothetical protein ECDEC10F_1234 [Escherichia coli DEC10F]
gb|EHX50428.1| hypothetical protein ECDEC13A_0812 [Escherichia coli DEC13A]
gb|EHX64791.1| hypothetical protein ECDEC13B_0637 [Escherichia coli DEC13B]
gb|EHX68905.1| hypothetical protein ECDEC13D_0715 [Escherichia coli DEC13D]
gb|EHX69155.1| hypothetical protein ECDEC13C_0649 [Escherichia coli DEC13C]
gb|EHX79914.1| hypothetical protein ECDEC13E_0638 [Escherichia coli DEC13E]
gb|EHX82362.1| hypothetical protein ECDEC14A_0643 [Escherichia coli DEC14A]
gb|EHX85688.1| hypothetical protein ECDEC14B_0885 [Escherichia coli DEC14B]
gb|EHX93437.1| hypothetical protein ECDEC14C_0740 [Escherichia coli DEC14C]
gb|EHX96701.1| hypothetical protein ECDEC14D_0596 [Escherichia coli DEC14D]
gb|EHY04788.1| hypothetical protein ECDEC15A_0640 [Escherichia coli DEC15A]
gb|EHY10600.1| hypothetical protein ECDEC15B_0498 [Escherichia coli DEC15B]
gb|EHY11525.1| hypothetical protein ECDEC15C_0449 [Escherichia coli DEC15C]
gb|EHY17312.1| hypothetical protein ECDEC15D_0430 [Escherichia coli DEC15D]
gb|EHY20952.1| hypothetical protein ECDEC15E_0727 [Escherichia coli DEC15E]
gb|EIA37813.1| hypothetical protein OQA_03178 [Escherichia coli SCI-07]
gb|AFG39502.1| hypothetical protein P12B_c0625 [Escherichia coli P12b]
gb|AFH19055.1| hypothetical protein KO11_20455 [Escherichia coli KO11FL]
gb|AFH10361.1| hypothetical protein WFL_03465 [Escherichia coli W]
gb|EID66388.1| hypothetical protein ECW26_31540 [Escherichia coli W26]
gb|EIE35982.1| hypothetical protein OQE_32220 [Escherichia coli J53]
gb|EIE54334.1| hypothetical protein ECAI27_34990 [Escherichia coli AI27]
gb|EIF16662.1| hypothetical protein UWO_18109 [Escherichia coli O32:H37 str. P4]
gb|EIF86928.1| hypothetical protein ESMG_01155 [Escherichia coli M919]
gb|EIG44943.1| hypothetical protein ESTG_03049 [Escherichia coli B799]
gb|EIG49692.1| hypothetical protein ESSG_00927 [Escherichia coli H730]
gb|EIG71817.1| hypothetical protein ESBG_02145 [Escherichia sp. 4_1_40B]
gb|EIG79571.1| PF07295 family protein [Escherichia coli 1.2741]
gb|EIH03224.1| PF07295 family protein [Escherichia coli 5.0588]
gb|EIH13603.1| PF07295 family protein [Escherichia coli 97.0259]
gb|EIH26359.1| PF07295 family protein [Escherichia coli 1.2264]
gb|EIH36487.1| PF07295 family protein [Escherichia coli 96.0497]
gb|EIH43426.1| PF07295 family protein [Escherichia coli 99.0741]
gb|EIH79003.1| PF07295 family protein [Escherichia coli 4.0522]
gb|EIH90666.1| PF07295 family protein [Escherichia coli JB1-95]
gb|EIH99056.1| PF07295 family protein [Escherichia coli 96.154]
gb|EII10618.1| PF07295 family protein [Escherichia coli 5.0959]
gb|EII19892.1| PF07295 family protein [Escherichia coli 9.0111]
gb|EII45029.1| PF07295 family protein [Escherichia coli 2.3916]
gb|EII57947.1| PF07295 family protein [Escherichia coli 3.3884]
gb|EII65465.1| PF07295 family protein [Escherichia coli 2.4168]
gb|EII79111.1| PF07295 family protein [Escherichia coli 3.2303]
gb|EII84162.1| PF07295 family protein [Escherichia coli 3003]
gb|EII93841.1| PF07295 family protein [Escherichia coli TW07793]
gb|EIJ05117.1| PF07295 family protein [Escherichia coli B41]
gb|EIJ17638.1| PF07295 family protein [Escherichia coli 900105 (10e)]
gb|AFJ27714.1| hypothetical protein CDCO157_0668 [Escherichia coli Xuzhou21]
gb|EIL08406.1| hypothetical protein ECO9340_00946 [Escherichia coli O103:H25 str.
CVM9340]
gb|EIL12741.1| hypothetical protein ECO9534_02454 [Escherichia coli O111:H11 str.
CVM9534]
gb|EIL19947.1| hypothetical protein ECO9574_26612 [Escherichia coli O111:H8 str.
CVM9574]
gb|EIL22275.1| hypothetical protein ECO9570_23093 [Escherichia coli O111:H8 str.
CVM9570]
gb|EIL24680.1| hypothetical protein ECO9545_03701 [Escherichia coli O111:H11 str.
CVM9545]
gb|EIL42289.1| hypothetical protein ECO10026_10394 [Escherichia coli O26:H11 str.
CVM10026]
gb|EIL45835.1| hypothetical protein ECKD1_18997 [Escherichia coli KD1]
gb|EIL55991.1| hypothetical protein ECKD2_04576 [Escherichia coli KD2]
gb|EIL61818.1| hypothetical protein EC5761_21801 [Escherichia coli 576-1]
gb|EIL61857.1| hypothetical protein EC75_17822 [Escherichia coli 75]
gb|EIL64865.1| hypothetical protein EC5411_12278 [Escherichia coli 541-1]
gb|EIL75721.1| hypothetical protein ECHM605_15073 [Escherichia coli HM605]
gb|EIL80470.1| hypothetical protein ECMT8_05373 [Escherichia coli CUMT8]
gb|EIN29040.1| hypothetical protein ECFRIK1996_0852 [Escherichia coli FRIK1996]
gb|EIN30833.1| hypothetical protein ECFDA517_0903 [Escherichia coli FDA517]
gb|EIN31262.1| hypothetical protein ECFDA505_0711 [Escherichia coli FDA505]
gb|EIN46248.1| hypothetical protein EC93001_0842 [Escherichia coli 93-001]
gb|EIN48988.1| hypothetical protein ECFRIK1990_0740 [Escherichia coli FRIK1990]
gb|EIN49684.1| hypothetical protein ECFRIK1985_0747 [Escherichia coli FRIK1985]
gb|EIN63574.1| hypothetical protein ECPA3_0854 [Escherichia coli PA3]
gb|EIN66647.1| hypothetical protein ECPA9_0868 [Escherichia coli PA9]
gb|EIN67494.1| hypothetical protein ECPA5_0668 [Escherichia coli PA5]
gb|EIN81509.1| hypothetical protein ECPA10_0798 [Escherichia coli PA10]
gb|EIN83001.1| hypothetical protein ECPA15_0871 [Escherichia coli PA15]
gb|EIN84821.1| hypothetical protein ECPA14_0726 [Escherichia coli PA14]
gb|EIN92962.1| hypothetical protein ECPA22_0934 [Escherichia coli PA22]
gb|EIO04818.1| hypothetical protein ECPA25_0541 [Escherichia coli PA25]
gb|EIO04974.1| hypothetical protein ECPA24_0705 [Escherichia coli PA24]
gb|EIO07832.1| hypothetical protein ECPA28_0877 [Escherichia coli PA28]
gb|EIO21662.1| hypothetical protein ECPA31_0669 [Escherichia coli PA31]
gb|EIO22043.1| hypothetical protein ECPA32_0709 [Escherichia coli PA32]
gb|EIO24256.1| hypothetical protein ECPA33_0709 [Escherichia coli PA33]
gb|EIO31879.1| hypothetical protein ECPA40_0942 [Escherichia coli PA40]
gb|EIO43967.1| hypothetical protein ECPA41_0755 [Escherichia coli PA41]
gb|EIO45517.1| hypothetical protein ECPA42_0867 [Escherichia coli PA42]
gb|EIO50872.1| hypothetical protein ECPA39_0736 [Escherichia coli PA39]
gb|EIO53107.1| hypothetical protein ECTW06591_0467 [Escherichia coli TW06591]
gb|EIO59339.1| hypothetical protein ECTW10246_2288 [Escherichia coli TW10246]
gb|EIO69061.1| hypothetical protein ECTW11039_0910 [Escherichia coli TW11039]
gb|EIO76254.1| hypothetical protein ECTW07945_0832 [Escherichia coli TW07945]
gb|EIO78288.1| hypothetical protein ECTW09109_0906 [Escherichia coli TW09109]
gb|EIO85429.1| hypothetical protein ECTW10119_1214 [Escherichia coli TW10119]
gb|EIO88935.1| hypothetical protein ECTW09098_0820 [Escherichia coli TW09098]
gb|EIP01420.1| hypothetical protein ECEC4203_0727 [Escherichia coli EC4203]
gb|EIP03897.1| hypothetical protein ECEC4196_0719 [Escherichia coli EC4196]
gb|EIP05307.1| hypothetical protein ECTW09195_0760 [Escherichia coli TW09195]
gb|EIP18141.1| hypothetical protein ECTW14301_0717 [Escherichia coli TW14301]
gb|EIP21675.1| hypothetical protein ECEC4421_0719 [Escherichia coli EC4421]
gb|EIP21974.1| hypothetical protein ECTW14313_0701 [Escherichia coli O157:H7 str.
TW14313]
gb|EIP32862.1| hypothetical protein ECEC4422_0870 [Escherichia coli EC4422]
gb|EIP36966.1| hypothetical protein ECEC4013_0940 [Escherichia coli EC4013]
gb|EIP46122.1| hypothetical protein ECEC4402_0729 [Escherichia coli EC4402]
gb|EIP47810.1| hypothetical protein ECEC4439_0729 [Escherichia coli EC4439]
gb|EIP53905.1| hypothetical protein ECEC4436_0710 [Escherichia coli EC4436]
gb|EIP56593.1| hypothetical protein ECEC1738_5662 [Escherichia coli EC1738]
gb|EIP68307.1| hypothetical protein ECEC1734_2019 [Escherichia coli EC1734]
gb|EIP68957.1| hypothetical protein ECEC4437_0836 [Escherichia coli EC4437]
gb|EIP73524.1| hypothetical protein ECEC4448_0729 [Escherichia coli EC4448]
gb|EIP82497.1| hypothetical protein ECEC1863_0514 [Escherichia coli EC1863]
gb|EIP83659.1| hypothetical protein ECEC1845_0719 [Escherichia coli EC1845]
gb|EIQ15596.1| hypothetical protein SFCCH060_0646 [Shigella flexneri CCH060]
gb|EIQ26504.1| hypothetical protein SFK315_0509 [Shigella flexneri K-315]
gb|EIQ34692.1| hypothetical protein SB96558_0800 [Shigella boydii 965-58]
gb|EIQ46899.1| hypothetical protein SS322685_1111 [Shigella sonnei 3226-85]
gb|EIQ47011.1| hypothetical protein SB444474_0504 [Shigella boydii 4444-74]
gb|EIQ47971.1| hypothetical protein SS323385_0677 [Shigella sonnei 3233-85]
gb|EIQ54426.1| hypothetical protein SS482266_0709 [Shigella sonnei 4822-66]
gb|EIQ63993.1| hypothetical protein SD22575_0765 [Shigella dysenteriae 225-75]
gb|EIQ66785.1| hypothetical protein ECEPECA12_0634 [Escherichia coli EPECa12]
gb|EJE68720.1| hypothetical protein ECO9602_02085 [Escherichia coli O111:H8 str.
CVM9602]
gb|EJE70909.1| hypothetical protein ECO10224_02180 [Escherichia coli O26:H11 str.
CVM10224]
gb|EJE75567.1| hypothetical protein ECO9634_08027 [Escherichia coli O111:H8 str.
CVM9634]
gb|EJE77756.1| hypothetical protein ECO10021_23462 [Escherichia coli O26:H11 str.
CVM10021]
gb|EJE83142.1| hypothetical protein ECO9553_18077 [Escherichia coli O111:H11 str.
CVM9553]
gb|EJE95466.1| hypothetical protein ECO9455_11841 [Escherichia coli O111:H11 str.
CVM9455]
gb|EJF03849.1| hypothetical protein ECO10030_16639 [Escherichia coli O26:H11 str.
CVM10030]
gb|EJF05587.1| hypothetical protein ECO9952_20998 [Escherichia coli O26:H11 str.
CVM9952]
gb|EJK97524.1| hypothetical protein ECSTECO31_0565 [Escherichia coli STEC_O31]
gb|EJL19517.1| hypothetical protein SSMOSELEY_0843 [Shigella sonnei str. Moseley]
gb|EJZ49397.1| hypothetical protein ESCG_02670 [Escherichia sp. 1_1_43]
gb|EJZ68109.1| hypothetical protein SF148580_0641 [Shigella flexneri 1485-80]
gb|AFS58337.1| hypothetical protein O3M_18355 [Escherichia coli O104:H4 str.
2009EL-2050]
gb|AFS75546.1| hypothetical protein O3K_18375 [Escherichia coli O104:H4 str.
2011C-3493]
gb|AFS85153.1| hypothetical protein O3O_06920 [Escherichia coli O104:H4 str.
2009EL-2071]
gb|EKH06410.1| hypothetical protein ECPA7_1227 [Escherichia coli PA7]
gb|EKH09763.1| hypothetical protein ECFRIK920_0779 [Escherichia coli FRIK920]
gb|EKH19460.1| hypothetical protein ECPA34_0875 [Escherichia coli PA34]
gb|EKH23255.1| hypothetical protein ECFDA506_1190 [Escherichia coli FDA506]
gb|EKH28370.1| hypothetical protein ECFDA507_0726 [Escherichia coli FDA507]
gb|EKH34648.1| hypothetical protein ECFDA504_0864 [Escherichia coli FDA504]
gb|EKH41760.1| hypothetical protein ECFRIK1999_0940 [Escherichia coli FRIK1999]
gb|EKH47797.1| hypothetical protein ECFRIK1997_0874 [Escherichia coli FRIK1997]
gb|EKH52787.1| hypothetical protein ECNE1487_1018 [Escherichia coli NE1487]
gb|EKH60278.1| hypothetical protein ECNE037_0917 [Escherichia coli NE037]
gb|EKH62192.1| hypothetical protein ECFRIK2001_1136 [Escherichia coli FRIK2001]
gb|EKH70760.1| hypothetical protein ECPA4_0863 [Escherichia coli PA4]
gb|EKH78798.1| hypothetical protein ECPA23_0684 [Escherichia coli PA23]
gb|EKH81133.1| hypothetical protein ECPA49_0877 [Escherichia coli PA49]
gb|EKH85814.1| hypothetical protein ECPA45_0870 [Escherichia coli PA45]
gb|EKH94237.1| hypothetical protein ECTT12B_0869 [Escherichia coli TT12B]
gb|EKH99063.1| hypothetical protein ECMA6_1010 [Escherichia coli MA6]
gb|EKI01479.1| hypothetical protein EC5905_0992 [Escherichia coli 5905]
gb|EKI12879.1| hypothetical protein ECCB7326_0729 [Escherichia coli CB7326]
gb|EKI17228.1| hypothetical protein ECEC96038_0661 [Escherichia coli EC96038]
gb|EKI17446.1| hypothetical protein EC5412_0782 [Escherichia coli 5412]
gb|EKI23617.1| hypothetical protein ECTW15901_0600 [Escherichia coli TW15901]
gb|EKI30604.1| hypothetical protein ECTW00353_0649 [Escherichia coli TW00353]
gb|EKI31688.1| hypothetical protein ECARS42123_0666 [Escherichia coli ARS4.2123]
gb|EKI42880.1| hypothetical protein EC3006_0710 [Escherichia coli 3006]
gb|EKI45751.1| hypothetical protein EC07798_0749 [Escherichia coli 07798]
gb|EKI54948.1| hypothetical protein ECN1_0581 [Escherichia coli N1]
gb|EKI55851.1| hypothetical protein ECPA38_0759 [Escherichia coli PA38]
gb|EKI61691.1| hypothetical protein ECEC1735_0821 [Escherichia coli EC1735]
gb|EKI70878.1| hypothetical protein ECEC1736_0711 [Escherichia coli EC1736]
gb|EKI74363.1| hypothetical protein ECEC1737_0685 [Escherichia coli EC1737]
gb|EKI80293.1| hypothetical protein ECEC1846_0712 [Escherichia coli EC1846]
gb|EKI88661.1| hypothetical protein ECEC1847_0711 [Escherichia coli EC1847]
gb|EKI90119.1| hypothetical protein ECEC1848_0928 [Escherichia coli EC1848]
gb|EKI98486.1| hypothetical protein ECEC1849_0713 [Escherichia coli EC1849]
gb|EKJ04063.1| hypothetical protein ECEC1850_0882 [Escherichia coli EC1850]
gb|EKJ06406.1| hypothetical protein ECEC1856_0732 [Escherichia coli EC1856]
gb|EKJ18033.1| hypothetical protein ECEC1862_0712 [Escherichia coli EC1862]
gb|EKJ18462.1| hypothetical protein ECEC1864_0884 [Escherichia coli EC1864]
gb|EKJ26796.1| hypothetical protein ECEC1865_0728 [Escherichia coli EC1865]
gb|EKJ33587.1| hypothetical protein ECEC1868_0880 [Escherichia coli EC1868]
gb|EKJ33789.1| hypothetical protein ECEC1866_0544 [Escherichia coli EC1866]
gb|EKJ46476.1| hypothetical protein ECEC1869_0872 [Escherichia coli EC1869]
gb|EKJ51342.1| hypothetical protein ECNE098_0871 [Escherichia coli NE098]
gb|EKJ52691.1| hypothetical protein ECEC1870_0554 [Escherichia coli EC1870]
gb|EKJ61699.1| hypothetical protein EC01288_0663 [Escherichia coli 0.1288]
gb|EKJ64304.1| hypothetical protein ECFRIK523_0737 [Escherichia coli FRIK523]
gb|EKJ66546.1| hypothetical protein EC01304_0775 [Escherichia coli 0.1304]
gb|EKJ81689.1| hypothetical protein ECAD30_31150 [Escherichia coli AD30]
gb|EKK34738.1| hypothetical protein EC52239_0917 [Escherichia coli 5.2239]
gb|EKK35259.1| hypothetical protein EC34870_0862 [Escherichia coli 3.4870]
gb|EKK36257.1| hypothetical protein EC60172_0862 [Escherichia coli 6.0172]
gb|EKK48669.1| hypothetical protein EC80566_0644 [Escherichia coli 8.0566]
gb|EKK49200.1| hypothetical protein EC80569_0653 [Escherichia coli 8.0569]
gb|EKK60042.1| hypothetical protein EC80586_0881 [Escherichia coli 8.0586]
gb|EKK64596.1| hypothetical protein EC82524_0756 [Escherichia coli 8.2524]
gb|EKK66252.1| hypothetical protein EC100833_0949 [Escherichia coli 10.0833]
gb|EKK77629.1| hypothetical protein EC100869_0638 [Escherichia coli 10.0869]
gb|EKK78985.1| hypothetical protein EC80416_0697 [Escherichia coli 8.0416]
gb|EKK83471.1| hypothetical protein EC880221_0942 [Escherichia coli 88.0221]
gb|EKK90064.1| hypothetical protein EC100821_0866 [Escherichia coli 10.0821]
emb|CCK45809.1| putative alpha helical protein [Escherichia coli chi7122]
emb|CCJ43109.1| putative alpha helical protein [Escherichia coli]
gb|EKT98358.1| hypothetical protein CFSAN001629_13474 [Escherichia coli O26:H11
str. CFSAN001629]
gb|EKU03360.1| hypothetical protein CFSAN001630_13043 [Escherichia coli O111:H11
str. CFSAN001630]
gb|EKU03672.1| hypothetical protein CFSAN001632_02376 [Escherichia coli O111:H8
str. CFSAN001632]
gb|EKV83668.1| hypothetical protein EC881042_0877 [Escherichia coli 88.1042]
gb|EKV85520.1| hypothetical protein EC890511_0742 [Escherichia coli 89.0511]
gb|EKV85864.1| hypothetical protein EC881467_0902 [Escherichia coli 88.1467]
gb|EKW01323.1| hypothetical protein EC902281_0862 [Escherichia coli 90.2281]
gb|EKW01461.1| hypothetical protein EC900039_0723 [Escherichia coli 90.0039]
gb|EKW03564.1| hypothetical protein EC900091_0916 [Escherichia coli 90.0091]
gb|EKW17888.1| hypothetical protein EC930056_0864 [Escherichia coli 93.0056]
gb|EKW19313.1| hypothetical protein EC930055_0733 [Escherichia coli 93.0055]
gb|EKW20338.1| hypothetical protein EC940618_0726 [Escherichia coli 94.0618]
gb|EKW35051.1| hypothetical protein EC950943_0864 [Escherichia coli 95.0943]
gb|EKW35269.1| hypothetical protein EC950183_0871 [Escherichia coli 95.0183]
gb|EKW40155.1| hypothetical protein EC951288_0729 [Escherichia coli 95.1288]
gb|EKW50034.1| hypothetical protein EC960428_0869 [Escherichia coli 96.0428]
gb|EKW55227.1| hypothetical protein EC960427_0727 [Escherichia coli 96.0427]
gb|EKW56831.1| hypothetical protein EC960939_0804 [Escherichia coli 96.0939]
gb|EKW67219.1| hypothetical protein EC970003_0852 [Escherichia coli 97.0003]
gb|EKW68691.1| hypothetical protein EC960932_0984 [Escherichia coli 96.0932]
gb|EKW72676.1| hypothetical protein EC960107_0821 [Escherichia coli 96.0107]
gb|EKW82921.1| hypothetical protein EC971742_0703 [Escherichia coli 97.1742]
gb|EKW83605.1| hypothetical protein EC970007_0666 [Escherichia coli 97.0007]
gb|EKW94979.1| hypothetical protein EC990713_0940 [Escherichia coli 99.0713]
gb|EKW95140.1| hypothetical protein EC990678_0922 [Escherichia coli 99.0678]
gb|EKW97631.1| hypothetical protein EC990672_0746 [Escherichia coli 99.0672]
gb|EKY43549.1| hypothetical protein EC960109_0738 [Escherichia coli 96.0109]
gb|EKY45074.1| hypothetical protein EC970010_0714 [Escherichia coli 97.0010]
gb|EKY88451.1| hypothetical protein C212_04558 [Escherichia coli O104:H4 str.
11-02030]
gb|EKY88583.1| hypothetical protein C213_04561 [Escherichia coli O104:H4 str.
11-02033-1]
gb|EKY89901.1| hypothetical protein C214_04546 [Escherichia coli O104:H4 str.
11-02092]
gb|EKZ03706.1| hypothetical protein C215_04525 [Escherichia coli O104:H4 str.
11-02093]
gb|EKZ04608.1| hypothetical protein C216_04561 [Escherichia coli O104:H4 str.
11-02281]
gb|EKZ07077.1| hypothetical protein C217_04553 [Escherichia coli O104:H4 str.
11-02318]
gb|EKZ19362.1| hypothetical protein C218_04559 [Escherichia coli O104:H4 str.
11-02913]
gb|EKZ21585.1| hypothetical protein C221_04554 [Escherichia coli O104:H4 str.
11-03943]
gb|EKZ22107.1| hypothetical protein C219_04563 [Escherichia coli O104:H4 str.
11-03439]
gb|EKZ33694.1| hypothetical protein C220_04553 [Escherichia coli O104:H4 str.
11-04080]
gb|EKZ35043.1| hypothetical protein MO3_00890 [Escherichia coli O104:H4 str.
Ec11-9450]
gb|EKZ35125.1| hypothetical protein MO5_03857 [Escherichia coli O104:H4 str.
Ec11-9990]
gb|EKZ45854.1| hypothetical protein O7C_04177 [Escherichia coli O104:H4 str.
Ec11-4984]
gb|EKZ47929.1| hypothetical protein O7G_04998 [Escherichia coli O104:H4 str.
Ec11-4986]
gb|EKZ54605.1| hypothetical protein O7I_03861 [Escherichia coli O104:H4 str.
Ec11-4987]
gb|EKZ64161.1| hypothetical protein O7M_00943 [Escherichia coli O104:H4 str.
Ec11-5603]
gb|EKZ65670.1| hypothetical protein O7K_00399 [Escherichia coli O104:H4 str.
Ec11-4988]
gb|EKZ71767.1| hypothetical protein O7E_04184 [Escherichia coli O104:H4 str.
Ec11-5604]
gb|EKZ75402.1| hypothetical protein S7Y_00938 [Escherichia coli O104:H4 str.
Ec12-0465]
gb|EKZ80835.1| hypothetical protein O7O_03489 [Escherichia coli O104:H4 str.
Ec11-6006]
gb|EKZ86364.1| hypothetical protein S91_04275 [Escherichia coli O104:H4 str.
Ec12-0466]
gb|EKZ92529.1| hypothetical protein MO7_04164 [Escherichia coli O104:H4 str.
Ec11-9941]
gb|ELC02142.1| hypothetical protein WCA_01531 [Escherichia coli KTE2]
gb|ELC03096.1| hypothetical protein WCC_00903 [Escherichia coli KTE4]
gb|ELC11733.1| hypothetical protein WCM_02540 [Escherichia coli KTE10]
gb|ELC12592.1| hypothetical protein WCE_00442 [Escherichia coli KTE5]
gb|ELC22065.1| hypothetical protein WCO_00410 [Escherichia sp. KTE11]
gb|ELC23119.1| hypothetical protein WCQ_00634 [Escherichia coli KTE12]
gb|ELC30937.1| hypothetical protein WCY_01306 [Escherichia coli KTE16]
gb|ELC32837.1| hypothetical protein WCU_00434 [Escherichia coli KTE15]
gb|ELC38723.1| hypothetical protein WEI_01457 [Escherichia coli KTE25]
gb|ELC43018.1| hypothetical protein WE9_00954 [Escherichia coli KTE21]
gb|ELC49111.1| hypothetical protein WEK_00966 [Escherichia coli KTE26]
gb|ELC52818.1| hypothetical protein WEO_00654 [Escherichia coli KTE28]
gb|ELC58848.1| hypothetical protein WG9_01144 [Escherichia coli KTE39]
gb|ELC64053.1| hypothetical protein WGI_01074 [Escherichia coli KTE44]
gb|ELC66910.1| hypothetical protein A137_01141 [Escherichia coli KTE178]
gb|ELC75017.1| hypothetical protein A13K_01001 [Escherichia coli KTE187]
gb|ELC77335.1| hypothetical protein A139_00233 [Escherichia coli KTE181]
gb|ELC84189.1| hypothetical protein A13M_00947 [Escherichia coli KTE188]
gb|ELC86371.1| hypothetical protein A13O_00810 [Escherichia coli KTE189]
gb|ELC90982.1| hypothetical protein A13W_04404 [Escherichia coli KTE193]
gb|ELC92708.1| hypothetical protein A13S_01130 [Escherichia coli KTE191]
gb|ELD02010.1| hypothetical protein A15C_01319 [Escherichia coli KTE201]
gb|ELD08026.1| hypothetical protein A15I_00531 [Escherichia coli KTE204]
gb|ELD13649.1| hypothetical protein A15K_00569 [Escherichia coli KTE205]
gb|ELD16181.1| hypothetical protein A15M_00913 [Escherichia coli KTE206]
gb|ELD23738.1| hypothetical protein A15Q_00887 [Escherichia coli KTE208]
gb|ELD24488.1| hypothetical protein A15U_01139 [Escherichia coli KTE210]
gb|ELD31588.1| hypothetical protein A15Y_00818 [Escherichia coli KTE212]
gb|ELD37224.1| hypothetical protein A171_00103 [Escherichia coli KTE213]
gb|ELD41033.1| hypothetical protein A173_01630 [Escherichia coli KTE214]
gb|ELD44739.1| hypothetical protein A177_00956 [Escherichia coli KTE216]
gb|ELD52805.1| hypothetical protein A17E_00354 [Escherichia coli KTE220]
gb|ELD54697.1| hypothetical protein A17M_00712 [Escherichia coli KTE224]
gb|ELD55110.1| hypothetical protein A17U_04343 [Escherichia coli KTE228]
gb|ELD64445.1| hypothetical protein A17Y_00861 [Escherichia coli KTE230]
gb|ELD72960.1| hypothetical protein A193_01244 [Escherichia coli KTE234]
gb|ELD80712.1| hypothetical protein A195_00271 [Escherichia coli KTE235]
gb|ELD84534.1| hypothetical protein A197_00574 [Escherichia coli KTE236]
gb|ELD90981.1| hypothetical protein A199_00806 [Escherichia coli KTE237]
gb|ELD92918.1| hypothetical protein A1S3_00999 [Escherichia coli KTE47]
gb|ELD99722.1| hypothetical protein A1S7_01278 [Escherichia coli KTE49]
gb|ELE04779.1| hypothetical protein A1SA_01183 [Escherichia coli KTE51]
gb|ELE07945.1| hypothetical protein A1SE_01011 [Escherichia coli KTE53]
gb|ELE12977.1| hypothetical protein A1SK_03065 [Escherichia coli KTE56]
gb|ELE14859.1| hypothetical protein A1SI_01286 [Escherichia coli KTE55]
gb|ELE22744.1| hypothetical protein A1SM_01944 [Escherichia coli KTE57]
gb|ELE26842.1| hypothetical protein A1SO_01260 [Escherichia coli KTE58]
gb|ELE35163.1| hypothetical protein A1SS_01133 [Escherichia coli KTE60]
gb|ELE35444.1| hypothetical protein A1SW_01247 [Escherichia coli KTE62]
gb|ELE42475.1| hypothetical protein A1U7_01481 [Escherichia coli KTE67]
gb|ELE45310.1| hypothetical protein A1U5_01027 [Escherichia coli KTE66]
gb|ELE52195.1| hypothetical protein A1UG_00689 [Escherichia coli KTE72]
gb|ELE57979.1| hypothetical protein A1UM_00899 [Escherichia coli KTE75]
gb|ELE62872.1| hypothetical protein A1UO_00593 [Escherichia coli KTE76]
gb|ELE65691.1| hypothetical protein A1UQ_01028 [Escherichia coli KTE77]
gb|ELE73927.1| hypothetical protein A1UW_00644 [Escherichia coli KTE80]
gb|ELE74271.1| hypothetical protein A1UY_01276 [Escherichia coli KTE81]
gb|ELE83651.1| hypothetical protein A1W5_00841 [Escherichia coli KTE86]
gb|ELE84519.1| hypothetical protein A1W1_00666 [Escherichia coli KTE83]
gb|ELE92838.1| hypothetical protein A1W7_01121 [Escherichia coli KTE87]
gb|ELE93557.1| hypothetical protein A1WE_01002 [Escherichia coli KTE93]
gb|ELF01920.1| hypothetical protein A1WY_01287 [Escherichia coli KTE111]
gb|ELF02494.1| hypothetical protein A1Y3_01478 [Escherichia coli KTE116]
gb|ELF11167.1| hypothetical protein A1Y7_01091 [Escherichia coli KTE119]
gb|ELF15437.1| hypothetical protein A1YU_00171 [Escherichia coli KTE142]
gb|ELF21703.1| hypothetical protein A1YW_00834 [Escherichia coli KTE143]
gb|ELF22084.1| hypothetical protein A31A_01310 [Escherichia coli KTE156]
gb|ELF26802.1| hypothetical protein A31G_02761 [Escherichia coli KTE161]
gb|ELF31849.1| hypothetical protein A31I_00868 [Escherichia coli KTE162]
gb|ELF40945.1| hypothetical protein A31M_00717 [Escherichia coli KTE169]
gb|ELF41097.1| hypothetical protein A31Q_01064 [Escherichia coli KTE171]
gb|ELF45629.1| hypothetical protein WCG_02767 [Escherichia coli KTE6]
gb|ELF52206.1| hypothetical protein WCI_00686 [Escherichia coli KTE8]
gb|ELF58243.1| hypothetical protein WCK_01324 [Escherichia coli KTE9]
gb|ELF59680.1| hypothetical protein WE1_01196 [Escherichia coli KTE17]
gb|ELF66457.1| hypothetical protein WE3_01148 [Escherichia coli KTE18]
gb|ELF69236.1| hypothetical protein WGK_01165 [Escherichia coli KTE45]
gb|ELF77360.1| hypothetical protein WEE_01074 [Escherichia coli KTE23]
gb|ELF77576.1| hypothetical protein WGE_01392 [Escherichia coli KTE42]
gb|ELF85241.1| hypothetical protein WGG_00710 [Escherichia coli KTE43]
gb|ELF94108.1| hypothetical protein WEA_00383 [Escherichia coli KTE22]
gb|ELF99780.1| hypothetical protein A1S1_00528 [Escherichia coli KTE46]
gb|ELG01068.1| hypothetical protein A1S5_01530 [Escherichia coli KTE48]
gb|ELG05947.1| hypothetical protein A1S9_02294 [Escherichia coli KTE50]
gb|ELG08022.1| hypothetical protein A1SG_01908 [Escherichia coli KTE54]
gb|ELG17429.1| hypothetical protein A1SQ_01203 [Escherichia coli KTE59]
gb|ELG19465.1| hypothetical protein A1SY_01333 [Escherichia coli KTE63]
gb|ELG28472.1| hypothetical protein A1U3_00462 [Escherichia coli KTE65]
gb|ELG29194.1| hypothetical protein A1US_01081 [Escherichia coli KTE78]
gb|ELG32235.1| hypothetical protein A1UU_02570 [Escherichia coli KTE79]
gb|ELG37881.1| hypothetical protein A1W3_01142 [Escherichia coli KTE84]
gb|ELG43761.1| hypothetical protein A1WM_03934 [Escherichia coli KTE101]
gb|ELG43868.1| hypothetical protein A1WA_00626 [Escherichia coli KTE91]
gb|ELG54170.1| hypothetical protein A1Y1_00583 [Escherichia coli KTE115]
gb|ELG56723.1| hypothetical protein A1Y5_01527 [Escherichia coli KTE118]
gb|ELG59930.1| hypothetical protein A1YA_02845 [Escherichia coli KTE123]
gb|ELG64768.1| hypothetical protein A1YM_02414 [Escherichia coli KTE135]
gb|ELG71912.1| hypothetical protein A1YO_01018 [Escherichia coli KTE136]
gb|ELG75110.1| hypothetical protein A1YQ_01159 [Escherichia coli KTE140]
gb|ELG80874.1| hypothetical protein A1YS_01034 [Escherichia coli KTE141]
gb|ELG85043.1| hypothetical protein A1YY_00450 [Escherichia coli KTE144]
gb|ELG88622.1| hypothetical protein A313_03854 [Escherichia coli KTE147]
gb|ELG91215.1| hypothetical protein A311_01169 [Escherichia coli KTE146]
gb|ELG96501.1| hypothetical protein A317_03199 [Escherichia coli KTE154]
gb|ELH01753.1| hypothetical protein A31C_01306 [Escherichia coli KTE158]
gb|ELH11455.1| hypothetical protein A13U_01132 [Escherichia coli KTE192]
gb|ELH18048.1| hypothetical protein A13Y_00973 [Escherichia coli KTE194]
gb|ELH25301.1| hypothetical protein A13Q_01086 [Escherichia coli KTE190]
gb|ELH27417.1| hypothetical protein A133_01178 [Escherichia coli KTE173]
gb|ELH29292.1| hypothetical protein A135_01228 [Escherichia coli KTE175]
gb|ELH34054.1| hypothetical protein A13C_04371 [Escherichia coli KTE183]
gb|ELH37364.1| hypothetical protein A13E_01980 [Escherichia coli KTE184]
gb|ELH42703.1| hypothetical protein A153_01324 [Escherichia coli KTE196]
gb|ELH50197.1| hypothetical protein A155_01313 [Escherichia coli KTE197]
gb|ELH53772.1| hypothetical protein A15G_01842 [Escherichia coli KTE203]
gb|ELH58000.1| hypothetical protein A15E_01250 [Escherichia coli KTE202]
gb|ELH62134.1| hypothetical protein A15S_03231 [Escherichia coli KTE209]
gb|ELH65578.1| hypothetical protein A15O_01338 [Escherichia coli KTE207]
gb|ELH73710.1| hypothetical protein A15W_01237 [Escherichia coli KTE211]
gb|ELH77383.1| hypothetical protein A179_01485 [Escherichia coli KTE217]
gb|ELH84647.1| hypothetical protein A175_00744 [Escherichia coli KTE215]
gb|ELH87981.1| hypothetical protein A17A_01476 [Escherichia coli KTE218]
gb|ELH92228.1| hypothetical protein A17K_01146 [Escherichia coli KTE223]
gb|ELH94979.1| hypothetical protein A17S_01686 [Escherichia coli KTE227]
gb|ELH97009.1| hypothetical protein A17W_04103 [Escherichia coli KTE229]
gb|ELI11496.1| hypothetical protein WI5_00662 [Escherichia coli KTE104]
gb|ELI12897.1| hypothetical protein WI7_00670 [Escherichia coli KTE105]
gb|ELI15778.1| hypothetical protein WI9_00627 [Escherichia coli KTE106]
gb|ELI20368.1| hypothetical protein WIA_00734 [Escherichia coli KTE109]
gb|ELI28996.1| hypothetical protein WIE_00944 [Escherichia coli KTE113]
gb|ELI32731.1| hypothetical protein WIC_00742 [Escherichia coli KTE112]
gb|ELI33313.1| hypothetical protein WIG_00688 [Escherichia coli KTE117]
gb|ELI44781.1| hypothetical protein WII_00753 [Escherichia coli KTE120]
gb|ELI46739.1| hypothetical protein WIM_00735 [Escherichia coli KTE124]
gb|ELI47910.1| hypothetical protein WIK_00791 [Escherichia coli KTE122]
gb|ELI58937.1| hypothetical protein WIO_00715 [Escherichia coli KTE125]
gb|ELI61354.1| hypothetical protein WIQ_00785 [Escherichia coli KTE128]
gb|ELI63378.1| hypothetical protein WIS_00685 [Escherichia coli KTE129]
gb|ELI70898.1| hypothetical protein WIU_00672 [Escherichia coli KTE131]
gb|ELI74778.1| hypothetical protein WIW_00685 [Escherichia coli KTE133]
gb|ELI78637.1| hypothetical protein WIY_00715 [Escherichia coli KTE137]
gb|ELI83525.1| hypothetical protein WK1_00620 [Escherichia coli KTE138]
gb|ELI88524.1| hypothetical protein WK3_00744 [Escherichia coli KTE139]
gb|ELI91084.1| hypothetical protein WK5_00726 [Escherichia coli KTE145]
gb|ELI99461.1| hypothetical protein WK9_00797 [Escherichia coli KTE150]
gb|ELJ02540.1| hypothetical protein WK7_00627 [Escherichia coli KTE148]
gb|ELJ05173.1| hypothetical protein WKA_00734 [Escherichia coli KTE153]
gb|ELJ16136.1| hypothetical protein WKC_00651 [Escherichia coli KTE157]
gb|ELJ17611.1| hypothetical protein WKE_00662 [Escherichia coli KTE160]
gb|ELJ18621.1| hypothetical protein WKG_00745 [Escherichia coli KTE163]
gb|ELJ29195.1| hypothetical protein WKI_00759 [Escherichia coli KTE166]
gb|ELJ31928.1| hypothetical protein WKM_00508 [Escherichia coli KTE167]
gb|ELJ32528.1| hypothetical protein WKO_00774 [Escherichia coli KTE168]
gb|ELJ43036.1| hypothetical protein WKQ_00718 [Escherichia coli KTE174]
gb|ELJ44343.1| hypothetical protein WKS_00683 [Escherichia coli KTE176]
gb|ELJ47166.1| hypothetical protein WKU_00702 [Escherichia coli KTE177]
gb|ELJ57265.1| hypothetical protein WKW_00654 [Escherichia coli KTE179]
gb|ELJ58883.1| hypothetical protein WKY_00722 [Escherichia coli KTE180]
gb|ELJ61183.1| hypothetical protein WGQ_00744 [Escherichia coli KTE232]
gb|ELJ73587.1| hypothetical protein WGS_00522 [Escherichia coli KTE88]
gb|ELJ74101.1| hypothetical protein WGM_00793 [Escherichia coli KTE82]
gb|ELJ75647.1| hypothetical protein WGO_00654 [Escherichia coli KTE85]
gb|ELJ84873.1| hypothetical protein WGU_00909 [Escherichia coli KTE90]
gb|ELJ89276.1| hypothetical protein WGW_00775 [Escherichia coli KTE94]
gb|ELJ89521.1| hypothetical protein WGY_00720 [Escherichia coli KTE95]
gb|ELJ96326.1| hypothetical protein WI1_00553 [Escherichia coli KTE97]
gb|ELJ99529.1| hypothetical protein WI3_00701 [Escherichia coli KTE99]
gb|ELL42500.1| hypothetical protein B185_007698 [Escherichia coli J96]
emb|CCP98643.1| COG2433: Uncharacterized conserved protein [Escherichia coli
O10:K5(L):H4 str. ATCC 23506]
emb|CCQ00659.1| COG2433: Uncharacterized conserved protein [Escherichia coli
O5:K4(L):H4 str. ATCC 23502]
emb|CCQ07648.1| COG2433: Uncharacterized conserved protein [Escherichia coli Nissle
1917]
gb|AGC86092.1| hypothetical protein APECO78_06795 [Escherichia coli APEC O78]
gb|ELV21643.1| hypothetical protein EC990814_0739 [Escherichia coli 99.0814]
gb|ELV28540.1| hypothetical protein EC09BKT78844_0811 [Escherichia coli
09BKT078844]
gb|ELV29491.1| hypothetical protein EC990815_0710 [Escherichia coli 99.0815]
gb|ELV41548.1| hypothetical protein EC990839_0711 [Escherichia coli 99.0839]
gb|ELV43622.1| hypothetical protein EC990816_0699 [Escherichia coli 99.0816]
gb|ELV47554.1| hypothetical protein EC990848_0724 [Escherichia coli 99.0848]
gb|ELV57853.1| hypothetical protein EC991753_0743 [Escherichia coli 99.1753]
gb|ELV60531.1| hypothetical protein EC991775_0719 [Escherichia coli 99.1775]
gb|ELV61386.1| hypothetical protein EC991793_0823 [Escherichia coli 99.1793]
gb|ELV74292.1| hypothetical protein ECATCC700728_0764 [Escherichia coli ATCC
700728]
gb|ELV74639.1| hypothetical protein ECPA11_0833 [Escherichia coli PA11]
gb|ELV82467.1| hypothetical protein EC991805_0691 [Escherichia coli 99.1805]
gb|ELV88425.1| hypothetical protein ECPA13_0615 [Escherichia coli PA13]
gb|ELV88624.1| hypothetical protein ECPA19_0742 [Escherichia coli PA19]
gb|ELV96926.1| hypothetical protein ECPA2_0863 [Escherichia coli PA2]
gb|ELW05685.1| hypothetical protein ECPA48_0645 [Escherichia coli PA48]
gb|ELW05981.1| hypothetical protein ECPA47_0704 [Escherichia coli PA47]
gb|ELW10268.1| hypothetical protein ECPA8_0858 [Escherichia coli PA8]
gb|ELW20227.1| hypothetical protein EC71982_0846 [Escherichia coli 7.1982]
gb|ELW22630.1| hypothetical protein EC991781_0827 [Escherichia coli 99.1781]
gb|ELW26055.1| hypothetical protein EC991762_0861 [Escherichia coli 99.1762]
gb|ELW34597.1| hypothetical protein ECPA35_0916 [Escherichia coli PA35]
gb|ELW38855.1| hypothetical protein EC34880_0758 [Escherichia coli 3.4880]
gb|ELW44255.1| hypothetical protein EC950083_0714 [Escherichia coli 95.0083]
gb|ELW45857.1| hypothetical protein EC990670_0853 [Escherichia coli 99.0670]
gb|EMD12407.1| hypothetical protein C202_03010 [Escherichia coli O08]
gb|EMD14594.1| hypothetical protein A364_03723 [Escherichia coli SEPT362]
gb|EMD14668.1| hypothetical protein C201_02768 [Escherichia coli S17]
gb|EMR97941.1| hypothetical protein C4893_05400 [Escherichia coli ONT:H33 str.
C48/93]
gb|EMS04779.1| hypothetical protein E9211_06250 [Escherichia coli O104:H4 str.
E92/11]
gb|EMS08261.1| hypothetical protein E11210_06240 [Escherichia coli O104:H4 str.
E112/10]
gb|EMS10103.1| hypothetical protein C4390_06480 [Escherichia coli O127:H27 str.
C43/90]
gb|EMU65031.1| hypothetical protein ECMP0215527_0654 [Escherichia coli MP021552.7]
gb|EMU66676.1| hypothetical protein ECMP02155211_0594 [Escherichia coli
MP021552.11]
gb|EMU71718.1| hypothetical protein ECMP02155212_0757 [Escherichia coli
MP021552.12]
gb|EMU84210.1| hypothetical protein ECMP0210179_0686 [Escherichia coli MP021017.9]
gb|EMU85748.1| hypothetical protein ECMP0210176_0682 [Escherichia coli MP021017.6]
gb|EMU87813.1| hypothetical protein ECMP0210175_0589 [Escherichia coli MP021017.5]
gb|EMU98689.1| hypothetical protein ECMP0210174_0584 [Escherichia coli MP021017.4]
gb|EMV00264.1| hypothetical protein ECMP0210173_0680 [Escherichia coli MP021017.3]
gb|EMV02149.1| hypothetical protein ECMP0210172_0679 [Escherichia coli MP021017.2]
gb|EMV09641.1| hypothetical protein ECMP02101710_0689 [Escherichia coli
MP021017.10]
gb|EMV13858.1| hypothetical protein ECMP02101711_0681 [Escherichia coli
MP021017.11]
gb|EMV24037.1| hypothetical protein ECC34666_0704 [Escherichia coli C-34666]
gb|EMV26300.1| hypothetical protein ECBCE034MS14_0683 [Escherichia coli
BCE034_MS-14]
gb|EMV29011.1| hypothetical protein ECMP02101712_0557 [Escherichia coli
MP021017.12]
gb|EMV35745.1| hypothetical protein ECBCE002MS12_0678 [Escherichia coli
BCE002_MS12]
gb|EMV47471.1| hypothetical protein ECBCE019MS13_0649 [Escherichia coli
BCE019_MS-13]
gb|EMV48840.1| hypothetical protein EC2872800_0731 [Escherichia coli 2872800]
gb|EMV62805.1| hypothetical protein EC2867750_0655 [Escherichia coli 2867750]
gb|EMV78178.1| hypothetical protein EC2866550_0659 [Escherichia coli 2866550]
gb|EMV78611.1| hypothetical protein EC2866450_0683 [Escherichia coli 2866450]
gb|EMV80391.1| hypothetical protein EC2866750_0676 [Escherichia coli 2866750]
gb|EMV89763.1| hypothetical protein EC2861200_0647 [Escherichia coli 2861200]
gb|EMV94647.1| hypothetical protein EC2865200_0721 [Escherichia coli 2865200]
gb|EMV98111.1| hypothetical protein EC2860050_0609 [Escherichia coli 2860050]
gb|EMW08035.1| hypothetical protein EC2853500_0672 [Escherichia coli 2853500]
gb|EMW08231.1| hypothetical protein EC2851500_0660 [Escherichia coli 2851500]
gb|EMW11401.1| hypothetical protein EC2850750_0705 [Escherichia coli 2850750]
gb|EMW24244.1| hypothetical protein EC2845650_0624 [Escherichia coli 2845650]
gb|EMW28418.1| hypothetical protein EC2848050_0719 [Escherichia coli 2848050]
gb|EMW36955.1| hypothetical protein EC2845350_0658 [Escherichia coli 2845350]
gb|EMW37380.1| hypothetical protein EC2785200_0620 [Escherichia coli 2785200]
gb|EMW43700.1| hypothetical protein EC2788150_0692 [Escherichia coli 2788150]
gb|EMW52635.1| hypothetical protein EC2780750_0768 [Escherichia coli 2780750]
gb|EMW56619.1| hypothetical protein EC2770900_0654 [Escherichia coli 2770900]
gb|EMW71029.1| hypothetical protein EC2749250_0681 [Escherichia coli 2749250]
gb|EMW80001.1| hypothetical protein EC2747800_0736 [Escherichia coli 2747800]
gb|EMW84217.1| hypothetical protein EC180600_0619 [Escherichia coli 180600]
gb|EMW86566.1| hypothetical protein EC2731150_0695 [Escherichia coli 2731150]
gb|EMX01492.1| hypothetical protein ECTHROOPD_0729 [Escherichia coli ThroopD]
gb|EMX04303.1| hypothetical protein ECP03047771_0402 [Escherichia coli P0304777.1]
gb|EMX10316.1| hypothetical protein ECP03023081_1003 [Escherichia coli P0302308.1]
gb|EMX11470.1| hypothetical protein EC174750_0618 [Escherichia coli 174750]
gb|EMX17565.1| hypothetical protein ECP03022932_0685 [Escherichia coli P0302293.2]
gb|EMX21920.1| hypothetical protein ECP03018671_0828 [Escherichia coli P0301867.1]
gb|EMX26667.1| hypothetical protein ECMP0215661_1108 [Escherichia coli MP021566.1]
gb|EMX32531.1| hypothetical protein ECMP0215612_1132 [Escherichia coli MP021561.2]
gb|EMX42064.1| hypothetical protein ECMP0210171_0683 [Escherichia coli MP021017.1]
gb|EMX43596.1| hypothetical protein ECMP0215528_0689 [Escherichia coli MP021552.8]
gb|EMX55226.1| hypothetical protein ECMP0209802_1113 [Escherichia coli MP020980.2]
gb|EMX60053.1| hypothetical protein ECMP0209401_0834 [Escherichia coli MP020940.1]
gb|EMX65698.1| hypothetical protein ECJURUA1811_0724 [Escherichia coli Jurua
18/11]
gb|EMX72200.1| hypothetical protein ECENVIRA101_1888 [Escherichia coli Envira
10/1]
gb|EMX77753.1| hypothetical protein ECENVIRA811_0831 [Escherichia coli Envira
8/11]
gb|EMX80567.1| hypothetical protein EC2726800_0801 [Escherichia coli 2726800]
gb|EMX90246.1| hypothetical protein EC2719100_0859 [Escherichia coli 2719100]
gb|EMX93460.1| hypothetical protein ECBCE001MS16_0551 [Escherichia coli
BCE001_MS16]
gb|EMX96321.1| hypothetical protein EC2720900_0905 [Escherichia coli 2720900]
gb|EMZ47847.1| hypothetical protein C827_00413 [Escherichia coli SWW33]
gb|EMZ68935.1| hypothetical protein EC174900_0713 [Escherichia coli 174900]
gb|EMZ71862.1| hypothetical protein EC2735000_0635 [Escherichia coli 2735000]
gb|EMZ74853.1| hypothetical protein EC2846750_0619 [Escherichia coli 2846750]
gb|EMZ82797.1| hypothetical protein EC1999001_0807 [Escherichia coli 199900.1]
gb|EMZ87909.1| hypothetical protein ECP03052931_0693 [Escherichia coli p0305293.1]
gb|EMZ88149.1| hypothetical protein EC2722950_0673 [Escherichia coli 2722950]
gb|EMZ95152.1| hypothetical protein ECP03052601_0512 [Escherichia coli P0305260.1]
gb|EMZ99665.1| hypothetical protein ECP03048161_0514 [Escherichia coli P0304816.1]
gb|ENA07715.1| hypothetical protein ECP02994382_0269 [Escherichia coli P0299438.2]
gb|ENA07819.1| hypothetical protein ECP02999171_1993 [Escherichia coli P0299917.1]
gb|ENA19007.1| hypothetical protein ECBCE008MS13_0686 [Escherichia coli
BCE008_MS-13]
gb|ENA22207.1| hypothetical protein ECP02989421_1169 [Escherichia coli P0298942.1]
gb|ENA24857.1| hypothetical protein EC2016001_1098 [Escherichia coli 201600.1]
gb|ENA34654.1| hypothetical protein ECBCE007MS11_0875 [Escherichia coli
BCE007_MS-11]
gb|ENA41455.1| hypothetical protein ECP03018674_0771 [Escherichia coli P0301867.4]
gb|ENA47360.1| hypothetical protein ECP03018672_0768 [Escherichia coli P0301867.2]
gb|ENA55782.1| hypothetical protein EC2729250_0637 [Escherichia coli 2729250]
gb|ENA56718.1| hypothetical protein EC2726950_0681 [Escherichia coli 2726950]
gb|ENA66488.1| hypothetical protein EC178900_0666 [Escherichia coli 178900]
gb|ENA69619.1| hypothetical protein EC179550_0640 [Escherichia coli 179550]
gb|ENA71411.1| hypothetical protein EC180200_0631 [Escherichia coli 180200]
gb|ENA83642.1| hypothetical protein EC2730450_0704 [Escherichia coli 2730450]
gb|ENA85410.1| hypothetical protein EC2741950_0680 [Escherichia coli 2741950]
gb|ENA87135.1| hypothetical protein EC2730350_0648 [Escherichia coli 2730350]
gb|ENA99545.1| hypothetical protein EC2864350_0640 [Escherichia coli 2864350]
gb|ENB00049.1| hypothetical protein EC2860650_0636 [Escherichia coli 2860650]
gb|ENB02623.1| hypothetical protein EC2862600_0665 [Escherichia coli 2862600]
gb|ENB10524.1| hypothetical protein EC2866350_0646 [Escherichia coli 2866350]
gb|ENB15591.1| hypothetical protein EC2875150_0652 [Escherichia coli 2875150]
gb|ENB20765.1| hypothetical protein ECBCE008MS01_0593 [Escherichia coli
BCE008_MS-01]
gb|ENB24782.1| hypothetical protein ECBCE011MS01_0666 [Escherichia coli
BCE011_MS-01]
gb|ENB40506.1| hypothetical protein ECBCE032MS12_0660 [Escherichia coli
BCE032_MS-12]
gb|ENB42747.1| hypothetical protein ECMP0215613_0657 [Escherichia coli MP021561.3]
gb|ENB45062.1| hypothetical protein ECP029894210_0665 [Escherichia coli
P0298942.10]
gb|ENB51106.1| hypothetical protein ECP029894211_0677 [Escherichia coli
P0298942.11]
gb|ENB66350.1| hypothetical protein ECP029894215_0692 [Escherichia coli
P0298942.15]
gb|ENB69998.1| hypothetical protein ECP02989422_0628 [Escherichia coli P0298942.2]
gb|ENB81552.1| hypothetical protein ECP02989427_0672 [Escherichia coli P0298942.7]
gb|ENB83398.1| hypothetical protein ECP02989428_0666 [Escherichia coli P0298942.8]
gb|ENB87159.1| hypothetical protein ECP02989429_0604 [Escherichia coli P0298942.9]
gb|ENB90154.1| hypothetical protein ECP029943810_0664 [Escherichia coli
P0299438.10]
gb|ENB98502.1| hypothetical protein ECP029943811_0657 [Escherichia coli
P0299438.11]
gb|ENC03679.1| hypothetical protein ECP02994383_0592 [Escherichia coli P0299438.3]
gb|ENC07451.1| hypothetical protein ECP02994384_0727 [Escherichia coli P0299438.4]
gb|ENC15322.1| hypothetical protein ECP02994385_0668 [Escherichia coli P0299438.5]
gb|ENC22889.1| hypothetical protein ECP02994387_0621 [Escherichia coli P0299438.7]
gb|ENC27403.1| hypothetical protein ECP02994388_0654 [Escherichia coli P0299438.8]
gb|ENC36387.1| hypothetical protein ECP02994389_0617 [Escherichia coli P0299438.9]
gb|ENC37058.1| hypothetical protein ECP029970676_0657 [Escherichia coli
P02997067.6]
gb|ENC42260.1| hypothetical protein ECP029991710_0700 [Escherichia coli
P0299917.10]
gb|ENC48838.1| hypothetical protein ECP02999172_0699 [Escherichia coli P0299917.2]
gb|ENC59457.1| hypothetical protein ECP02999174_0693 [Escherichia coli P0299917.4]
gb|ENC64064.1| hypothetical protein ECP02999175_0648 [Escherichia coli P0299917.5]
gb|ENC64129.1| hypothetical protein ECP02999173_0677 [Escherichia coli P0299917.3]
gb|ENC75567.1| hypothetical protein ECP02999178_0733 [Escherichia coli P0299917.8]
gb|ENC75798.1| hypothetical protein ECP02999176_0697 [Escherichia coli P0299917.6]
gb|ENC82500.1| hypothetical protein ECP02999177_0674 [Escherichia coli P0299917.7]
gb|ENC86111.1| hypothetical protein ECP02999179_0695 [Escherichia coli P0299917.9]
gb|ENC93339.1| hypothetical protein ECP030186711_0765 [Escherichia coli
P0301867.11]
gb|END02490.1| hypothetical protein ECP030230810_0698 [Escherichia coli
P0302308.10]
gb|END05548.1| hypothetical protein ECP030230811_0715 [Escherichia coli
P0302308.11]
gb|END09258.1| hypothetical protein ECP03018678_0669 [Escherichia coli P0301867.8]
gb|END14726.1| hypothetical protein ECP03023083_0700 [Escherichia coli P0302308.3]
gb|END17321.1| hypothetical protein ECP03023082_0753 [Escherichia coli P0302308.2]
gb|END24499.1| hypothetical protein ECP03023085_0709 [Escherichia coli P0302308.5]
gb|END35184.1| hypothetical protein EC179100_0665 [Escherichia coli 179100]
gb|END44532.1| hypothetical protein EC2854350_0642 [Escherichia coli 2854350]
gb|END46589.1| hypothetical protein EC2733950_0640 [Escherichia coli 2733950]
gb|END55986.1| hypothetical protein ECMP0209801_0778 [Escherichia coli MP020980.1]
gb|END60218.1| hypothetical protein ECBCE006MS23_0671 [Escherichia coli
BCE006_MS-23]
gb|END72215.1| hypothetical protein ECP02994831_0869 [Escherichia coli P0299483.1]
gb|END74649.1| hypothetical protein ECP02989424_0659 [Escherichia coli P0298942.4]
gb|END74826.1| hypothetical protein ECP02989423_0685 [Escherichia coli P0298942.3]
gb|END82727.1| hypothetical protein ECP02994832_0883 [Escherichia coli P0299483.2]
gb|END85633.1| hypothetical protein ECP02994833_0676 [Escherichia coli P0299483.3]
gb|END95598.1| hypothetical protein ECP030186713_0768 [Escherichia coli
P0301867.13]
gb|END99434.1| hypothetical protein ECP03019043_0663 [Escherichia coli P0301904.3]
gb|ENE02188.1| hypothetical protein ECP03022937_0646 [Escherichia coli P0302293.7]
gb|ENE12363.1| hypothetical protein ECP03052602_0731 [Escherichia coli P0305260.2]
gb|ENE14999.1| hypothetical protein ECP030529314_0646 [Escherichia coli
p0305293.14]
gb|ENE16084.1| hypothetical protein ECP03047993_0678 [Escherichia coli P0304799.3]
gb|ENE24864.1| hypothetical protein ECP03022933_0712 [Escherichia coli P0302293.3]
gb|ENE28591.1| hypothetical protein ECP030229310_0645 [Escherichia coli
P0302293.10]
gb|ENE32243.1| hypothetical protein ECP03022934_0698 [Escherichia coli P0302293.4]
gb|ENE38669.1| hypothetical protein ECP03022936_0683 [Escherichia coli P0302293.6]
gb|ENE45286.1| hypothetical protein ECP03022938_0680 [Escherichia coli P0302293.8]
gb|ENE50157.1| hypothetical protein ECP030477710_0623 [Escherichia coli
P0304777.10]
gb|ENE54773.1| hypothetical protein ECP03022939_0646 [Escherichia coli P0302293.9]
gb|ENE58767.1| hypothetical protein ECP030477711_0628 [Escherichia coli
P0304777.11]
gb|ENE69200.1| hypothetical protein ECP030477712_0629 [Escherichia coli
P0304777.12]
gb|ENE71238.1| hypothetical protein ECP030477713_0658 [Escherichia coli
P0304777.13]
gb|ENE75910.1| hypothetical protein ECP030477714_0638 [Escherichia coli
P0304777.14]
gb|ENE81107.1| hypothetical protein ECP030477715_0702 [Escherichia coli
P0304777.15]
gb|ENE88993.1| hypothetical protein ECP03047773_0626 [Escherichia coli P0304777.3]
gb|ENE96046.1| hypothetical protein ECP03047774_0622 [Escherichia coli P0304777.4]
gb|ENF02889.1| hypothetical protein ECP03047777_0614 [Escherichia coli P0304777.7]
gb|ENF06682.1| hypothetical protein ECP03047775_0607 [Escherichia coli P0304777.5]
gb|ENF13869.1| hypothetical protein ECP03047778_0613 [Escherichia coli P0304777.8]
gb|ENF15261.1| hypothetical protein ECP03047779_0677 [Escherichia coli P0304777.9]
gb|ENF22794.1| hypothetical protein ECP030481611_0656 [Escherichia coli
P0304816.11]
gb|ENF26446.1| hypothetical protein ECP030481610_0699 [Escherichia coli
P0304816.10]
gb|ENF34660.1| hypothetical protein ECP030481612_0645 [Escherichia coli
P0304816.12]
gb|ENF38220.1| hypothetical protein ECP030481614_0696 [Escherichia coli
P0304816.14]
gb|ENF42608.1| hypothetical protein ECP030481613_0637 [Escherichia coli
P0304816.13]
gb|ENF53639.1| hypothetical protein ECP030481615_0678 [Escherichia coli
P0304816.15]
gb|ENF56430.1| hypothetical protein ECP03048162_0703 [Escherichia coli P0304816.2]
gb|ENF64111.1| hypothetical protein ECP03048167_0646 [Escherichia coli P0304816.7]
gb|ENF73616.1| hypothetical protein ECP03048168_0655 [Escherichia coli P0304816.8]
gb|ENF76271.1| hypothetical protein ECP03048169_0722 [Escherichia coli P0304816.9]
gb|ENF79005.1| hypothetical protein ECP030526010_0707 [Escherichia coli
P0305260.10]
gb|ENF87419.1| hypothetical protein ECP030526011_0728 [Escherichia coli
P0305260.11]
gb|ENF90845.1| hypothetical protein ECP030526012_0622 [Escherichia coli
P0305260.12]
gb|ENF93830.1| hypothetical protein ECP030526013_0687 [Escherichia coli
P0305260.13]
gb|ENF99556.1| hypothetical protein ECP030526015_0725 [Escherichia coli
P0305260.15]
gb|ENG06494.1| hypothetical protein ECP03052603_0731 [Escherichia coli P0305260.3]
gb|ENG08001.1| hypothetical protein ECP03052604_0633 [Escherichia coli P0305260.4]
gb|ENG17478.1| hypothetical protein ECP03052605_0703 [Escherichia coli P0305260.5]
gb|ENG22001.1| hypothetical protein ECP03052606_0689 [Escherichia coli P0305260.6]
gb|ENG22303.1| hypothetical protein ECP03052607_0697 [Escherichia coli P0305260.7]
gb|ENG29309.1| hypothetical protein ECP03052608_0679 [Escherichia coli P0305260.8]
gb|ENG35521.1| hypothetical protein ECP030529310_0646 [Escherichia coli
p0305293.10]
gb|ENG37234.1| hypothetical protein ECP03052609_0676 [Escherichia coli P0305260.9]
gb|ENG46602.1| hypothetical protein ECP030529312_0640 [Escherichia coli
p0305293.12]
gb|ENG47174.1| hypothetical protein ECP030529311_0609 [Escherichia coli
p0305293.11]
gb|ENG55300.1| hypothetical protein ECP030529315_0625 [Escherichia coli
p0305293.15]
gb|ENG59971.1| hypothetical protein ECP03052932_0630 [Escherichia coli p0305293.2]
gb|ENG65855.1| hypothetical protein ECP03052933_0699 [Escherichia coli p0305293.3]
gb|ENG69009.1| hypothetical protein ECP03052934_0637 [Escherichia coli p0305293.4]
gb|ENG73445.1| hypothetical protein ECP03052938_0698 [Escherichia coli p0305293.8]
gb|ENG79540.1| hypothetical protein ECP03052939_0616 [Escherichia coli p0305293.9]
gb|ENG87700.1| hypothetical protein ECP029894212_0675 [Escherichia coli
P0298942.12]
gb|ENG91917.1| hypothetical protein ECP029894214_0687 [Escherichia coli
P0298942.14]
gb|ENH04641.1| hypothetical protein ECP03018675_0741 [Escherichia coli P0301867.5]
gb|ENH06920.1| hypothetical protein EC178850_0604 [Escherichia coli 178850]
gb|ENH10754.1| hypothetical protein ECP03018677_0698 [Escherichia coli P0301867.7]
gb|ENH23999.1| hypothetical protein ECP030230814_0760 [Escherichia coli
P0302308.14]
gb|ENH24300.1| hypothetical protein ECP030230812_0789 [Escherichia coli
P0302308.12]
gb|ENH25931.1| hypothetical protein ECP030230813_0667 [Escherichia coli
P0302308.13]
gb|ENH37241.1| hypothetical protein ECP03048164_0663 [Escherichia coli P0304816.4]
gb|ENH38319.1| hypothetical protein ECP03048163_0663 [Escherichia coli P0304816.3]
gb|ENH42792.1| hypothetical protein ECP03048165_0712 [Escherichia coli P0304816.5]
gb|ENH47504.1| hypothetical protein ECP03052935_0626 [Escherichia coli p0305293.5]
gb|ENH54337.1| hypothetical protein ECP03052937_0638 [Escherichia coli p0305293.7]
gb|ENH58253.1| hypothetical protein ECP03052936_0615 [Escherichia coli p0305293.6]
gb|ENO08675.1| hypothetical protein T22_015867 [Escherichia coli O157:H43 str.
T22]
gb|EOR51380.1| hypothetical protein K758_16604 [Escherichia coli ATCC 25922]
gb|EOU36555.1| hypothetical protein WAY_00617 [Escherichia coli KTE13]
gb|EOU38229.1| hypothetical protein WAW_01221 [Escherichia coli KTE7]
gb|EOU40705.1| hypothetical protein WAU_01302 [Escherichia coli KTE3]
gb|EOU45239.1| hypothetical protein WC5_02499 [Escherichia sp. KTE114]
gb|EOU53179.1| hypothetical protein WC9_00729 [Escherichia coli KTE231]
gb|EOU55239.1| hypothetical protein WC3_01019 [Escherichia coli KTE35]
gb|EOU70277.1| hypothetical protein WCS_00471 [Escherichia coli KTE14]
gb|EOU72544.1| hypothetical protein WE7_00908 [Escherichia coli KTE20]
gb|EOU74822.1| hypothetical protein WEG_02029 [Escherichia coli KTE24]
gb|EOU81811.1| hypothetical protein WEM_00699 [Escherichia coli KTE27]
gb|EOU83270.1| hypothetical protein WES_01236 [Escherichia sp. KTE31]
gb|EOU95172.1| hypothetical protein WG3_00936 [Escherichia coli KTE36]
gb|EOU97852.1| hypothetical protein WG5_00798 [Escherichia coli KTE37]
gb|EOU99615.1| hypothetical protein WEY_01023 [Escherichia coli KTE34]
gb|EOV11394.1| hypothetical protein A151_00736 [Escherichia coli KTE195]
gb|EOV13217.1| hypothetical protein WG7_00788 [Escherichia coli KTE38]
gb|EOV15364.1| hypothetical protein WGA_00513 [Escherichia coli KTE40]
gb|EOV17050.1| hypothetical protein A159_04985 [Escherichia coli KTE199]
gb|EOV25727.1| hypothetical protein A15A_01001 [Escherichia coli KTE200]
gb|EOV28905.1| hypothetical protein A157_01088 [Escherichia coli KTE198]
gb|EOV38720.1| hypothetical protein A17I_02543 [Escherichia coli KTE222]
gb|EOV40809.1| hypothetical protein A17C_00572 [Escherichia coli KTE219]
gb|EOV43293.1| hypothetical protein A1SC_04330 [Escherichia sp. KTE52]
gb|EOV44148.1| hypothetical protein A17G_00875 [Escherichia coli KTE221]
gb|EOV55008.1| hypothetical protein A1SU_00750 [Escherichia coli KTE61]
gb|EOV64987.1| hypothetical protein A1U1_00488 [Escherichia coli KTE64]
gb|EOV66579.1| hypothetical protein A1U9_00487 [Escherichia coli KTE68]
gb|EOV67633.1| hypothetical protein A1UA_01368 [Escherichia coli KTE69]
gb|EOV80297.1| hypothetical protein A1UC_00841 [Escherichia coli KTE70]
gb|EOV82381.1| hypothetical protein A1UI_00707 [Escherichia coli KTE73]
gb|EOV83168.1| hypothetical protein A1UE_00968 [Escherichia coli KTE71]
gb|EOV90946.1| hypothetical protein A1WG_03117 [Escherichia sp. KTE96]
gb|EOV97230.1| hypothetical protein A1UK_00830 [Escherichia coli KTE74]
gb|EOV97420.1| hypothetical protein A1W9_00513 [Escherichia coli KTE89]
gb|EOV97564.1| hypothetical protein A1WI_04452 [Escherichia coli KTE98]
gb|EOW09621.1| hypothetical protein A1WO_02054 [Escherichia coli KTE102]
gb|EOW10049.1| hypothetical protein A1WK_01376 [Escherichia coli KTE100]
gb|EOW18091.1| hypothetical protein A1WQ_01327 [Escherichia coli KTE103]
gb|EOW22769.1| hypothetical protein A1WU_02349 [Escherichia coli KTE108]
gb|EOW23965.1| hypothetical protein A1Y9_04972 [Escherichia coli KTE121]
gb|EOW39083.1| hypothetical protein A1YC_01731 [Escherichia coli KTE126]
gb|EOW40032.1| hypothetical protein A1YE_01456 [Escherichia coli KTE127]
gb|EOW50232.1| hypothetical protein A1YG_01174 [Escherichia coli KTE130]
gb|EOW50706.1| hypothetical protein A1YI_01123 [Escherichia coli KTE132]
gb|EOW53002.1| hypothetical protein A1YK_03251 [Escherichia coli KTE134]
gb|EOW62183.1| hypothetical protein A319_01495 [Escherichia coli KTE155]
gb|EOW69153.1| hypothetical protein G434_04452 [Escherichia sp. KTE172]
gb|EOW71075.1| hypothetical protein A31O_01288 [Escherichia coli KTE170]
gb|EOW96242.1| hypothetical protein WAS_01359 [Escherichia coli KTE1]
gb|EOX00600.1| hypothetical protein WGC_01255 [Escherichia coli KTE41]
gb|EOX01763.1| hypothetical protein A13A_00602 [Escherichia coli KTE182]
gb|EOX10012.1| hypothetical protein A17O_01954 [Escherichia coli KTE225]
gb|EOX12811.1| hypothetical protein A17Q_00649 [Escherichia coli KTE226]
gb|EOX16437.1| hypothetical protein A19A_01019 [Escherichia coli KTE240]
gb|EOX24889.1| hypothetical protein A13G_00938 [Escherichia coli KTE185]
gb|EOX25982.1| hypothetical protein A13I_03209 [Escherichia coli KTE186]
gb|EPH47758.1| hypothetical protein L340_4157 [Escherichia coli E2265]
gb|EQN06502.1| hypothetical protein G681_02836 [Escherichia coli HVH 1
(4-6876161)]
gb|EQN08653.1| hypothetical protein G682_00620 [Escherichia coli HVH 2
(4-6943160)]
gb|EQN09797.1| hypothetical protein G683_01333 [Escherichia coli HVH 3
(4-7276001)]
gb|EQN22270.1| hypothetical protein G685_01406 [Escherichia coli HVH 5
(4-7148410)]
gb|EQN24007.1| hypothetical protein G684_00627 [Escherichia coli HVH 4
(4-7276109)]
gb|EQN32841.1| hypothetical protein G686_00608 [Escherichia coli HVH 6
(3-8296502)]
gb|EQN34623.1| hypothetical protein G688_00660 [Escherichia coli HVH 9
(4-6942539)]
gb|EQN38489.1| hypothetical protein G687_00627 [Escherichia coli HVH 7
(4-7315031)]
gb|EQN39477.1| hypothetical protein G689_02874 [Escherichia coli HVH 10
(4-6832164)]
gb|EQN54140.1| hypothetical protein G691_00797 [Escherichia coli HVH 13
(4-7634056)]
gb|EQN55078.1| hypothetical protein G692_00634 [Escherichia coli HVH 16
(4-7649002)]
gb|EQN56283.1| hypothetical protein G693_00623 [Escherichia coli HVH 17
(4-7473087)]
gb|EQN64748.1| hypothetical protein G696_00609 [Escherichia coli HVH 20
(4-5865042)]
gb|EQN71059.1| hypothetical protein G694_00640 [Escherichia coli HVH 18
(4-8589585)]
gb|EQN73747.1| hypothetical protein G695_00634 [Escherichia coli HVH 19
(4-7154984)]
gb|EQN80301.1| hypothetical protein G698_00720 [Escherichia coli HVH 22
(4-2258986)]
gb|EQN83175.1| hypothetical protein G697_00591 [Escherichia coli HVH 21
(4-4517873)]
gb|EQN86616.1| hypothetical protein G700_00560 [Escherichia coli HVH 24
(4-5985145)]
gb|EQN98930.1| hypothetical protein G702_00645 [Escherichia coli HVH 26
(4-5703913)]
gb|EQN99266.1| hypothetical protein G703_00590 [Escherichia coli HVH 27
(4-7449267)]
gb|EQO02042.1| hypothetical protein G701_00735 [Escherichia coli HVH 25
(4-5851939)]
gb|EQO08386.1| hypothetical protein G705_01570 [Escherichia coli HVH 29
(4-3418073)]
gb|EQO09846.1| hypothetical protein G704_02009 [Escherichia coli HVH 28
(4-0907367)]
gb|EQO22468.1| hypothetical protein G707_00633 [Escherichia coli HVH 31
(4-2602156)]
gb|EQO24191.1| hypothetical protein G706_00581 [Escherichia coli HVH 30
(4-2661829)]
gb|EQO26926.1| hypothetical protein G708_00610 [Escherichia coli HVH 32
(4-3773988)]
gb|EQO34720.1| hypothetical protein G710_00586 [Escherichia coli HVH 35
(4-2962667)]
gb|EQO35049.1| hypothetical protein G709_01297 [Escherichia coli HVH 33
(4-2174936)]
gb|EQO44958.1| hypothetical protein G712_00544 [Escherichia coli HVH 37
(4-2773848)]
gb|EQO48267.1| hypothetical protein G714_00626 [Escherichia coli HVH 39
(4-2679949)]
gb|EQO53761.1| hypothetical protein G713_00685 [Escherichia coli HVH 38
(4-2774682)]
gb|EQO54771.1| hypothetical protein G715_00629 [Escherichia coli HVH 40
(4-1219782)]
gb|EQO62041.1| hypothetical protein G718_03318 [Escherichia coli HVH 43
(4-2173468)]
gb|EQO64326.1| hypothetical protein G717_00647 [Escherichia coli HVH 42
(4-2100061)]
gb|EQO72920.1| hypothetical protein G716_00618 [Escherichia coli HVH 41
(4-2677849)]
gb|EQO74088.1| hypothetical protein G719_00673 [Escherichia coli HVH 44
(4-2298570)]
gb|EQO81548.1| hypothetical protein G720_00634 [Escherichia coli HVH 45
(4-3129918)]
gb|EQO87030.1| hypothetical protein G722_00586 [Escherichia coli HVH 48
(4-2658593)]
gb|EQO91502.1| hypothetical protein G721_00584 [Escherichia coli HVH 46
(4-2758776)]
gb|EQO98608.1| hypothetical protein G724_00619 [Escherichia coli HVH 51
(4-2172526)]
gb|EQP02690.1| hypothetical protein G727_00664 [Escherichia coli HVH 55
(4-2646161)]
gb|EQP11885.1| hypothetical protein G728_00643 [Escherichia coli HVH 56
(4-2153033)]
gb|EQP14714.1| hypothetical protein G729_00656 [Escherichia coli HVH 58
(4-2839709)]
gb|EQP23398.1| hypothetical protein G731_00658 [Escherichia coli HVH 61
(4-2736020)]
gb|EQP26222.1| hypothetical protein G732_00723 [Escherichia coli HVH 63
(4-2542528)]
gb|EQP28428.1| hypothetical protein G730_00584 [Escherichia coli HVH 59
(4-1119338)]
gb|EQP37229.1| hypothetical protein G735_00731 [Escherichia coli HVH 69
(4-2837072)]
gb|EQP41742.1| hypothetical protein G734_00635 [Escherichia coli HVH 68
(4-0888028)]
gb|EQP42823.1| hypothetical protein G733_00681 [Escherichia coli HVH 65
(4-2262045)]
gb|EQP53588.1| hypothetical protein G737_00621 [Escherichia coli HVH 73
(4-2393174)]
gb|EQP56303.1| hypothetical protein G738_00629 [Escherichia coli HVH 74
(4-1034782)]
gb|EQP59481.1| hypothetical protein G736_00600 [Escherichia coli HVH 70
(4-2963531)]
gb|EQP63217.1| hypothetical protein G739_00668 [Escherichia coli HVH 76
(4-2538717)]
gb|EQP72601.1| hypothetical protein G741_00437 [Escherichia coli HVH 78
(4-2735946)]
gb|EQP77205.1| hypothetical protein G740_00627 [Escherichia coli HVH 77
(4-2605759)]
gb|EQP78317.1| hypothetical protein G742_00692 [Escherichia coli HVH 79
(4-2512823)]
gb|EQP80908.1| hypothetical protein G743_02533 [Escherichia coli HVH 80
(4-2428830)]
gb|EQP85519.1| hypothetical protein G744_02829 [Escherichia coli HVH 82
(4-2209276)]
gb|EQP95185.1| hypothetical protein G747_00705 [Escherichia coli HVH 85
(4-0792144)]
gb|EQP96892.1| hypothetical protein G746_00626 [Escherichia coli HVH 84
(4-1021478)]
gb|EQQ07271.1| hypothetical protein G750_00680 [Escherichia coli HVH 88
(4-5854636)]
gb|EQQ11151.1| hypothetical protein G751_00655 [Escherichia coli HVH 89
(4-5885604)]
gb|EQQ15511.1| hypothetical protein G749_00704 [Escherichia coli HVH 87
(4-5977630)]
gb|EQQ18443.1| hypothetical protein G752_00405 [Escherichia coli HVH 90
(4-3191362)]
gb|EQQ29440.1| hypothetical protein G756_00640 [Escherichia coli HVH 95
(4-6074464)]
gb|EQQ31423.1| hypothetical protein G754_00671 [Escherichia coli HVH 92
(4-5930790)]
gb|EQQ35552.1| hypothetical protein G761_02577 [Escherichia coli HVH 100
(4-2850729)]
gb|EQQ43168.1| hypothetical protein G763_01139 [Escherichia coli HVH 102
(4-6906788)]
gb|EQQ49997.1| hypothetical protein G757_00636 [Escherichia coli HVH 96
(4-5934869)]
gb|EQQ53624.1| hypothetical protein G765_00660 [Escherichia coli HVH 104
(4-6977960)]
gb|EQQ55948.1| hypothetical protein G764_00690 [Escherichia coli HVH 103
(4-5904188)]
gb|EQQ60235.1| hypothetical protein G767_00726 [Escherichia coli HVH 106
(4-6881831)]
gb|EQQ67989.1| hypothetical protein G771_00722 [Escherichia coli HVH 110
(4-6978754)]
gb|EQQ78660.1| hypothetical protein G772_00823 [Escherichia coli HVH 111
(4-7039018)]
gb|EQQ80053.1| hypothetical protein G770_00648 [Escherichia coli HVH 109
(4-6977162)]
gb|EQQ80834.1| hypothetical protein G768_00642 [Escherichia coli HVH 107
(4-5860571)]
gb|EQQ91991.1| hypothetical protein G773_00648 [Escherichia coli HVH 112
(4-5987253)]
gb|EQQ93350.1| hypothetical protein G775_00642 [Escherichia coli HVH 114
(4-7037740)]
gb|EQQ95856.1| hypothetical protein G774_00736 [Escherichia coli HVH 113
(4-7535473)]
gb|EQR04736.1| hypothetical protein G777_00858 [Escherichia coli HVH 115
(4-4465989)]
gb|EQR09505.1| hypothetical protein G778_00590 [Escherichia coli HVH 116
(4-6879942)]
gb|EQR09648.1| hypothetical protein G776_00767 [Escherichia coli HVH 115
(4-4465997)]
gb|EQR20569.1| hypothetical protein G779_00640 [Escherichia coli HVH 117
(4-6857191)]
gb|EQR23536.1| hypothetical protein G781_00631 [Escherichia coli HVH 119
(4-6879578)]
gb|EQR26765.1| hypothetical protein G780_00589 [Escherichia coli HVH 118
(4-7345399)]
gb|EQR33370.1| hypothetical protein G782_00563 [Escherichia coli HVH 120
(4-6978681)]
gb|EQR36080.1| hypothetical protein G784_00724 [Escherichia coli HVH 122
(4-6851606)]
gb|EQR44569.1| hypothetical protein G783_00654 [Escherichia coli HVH 121
(4-6877826)]
gb|EQR50505.1| hypothetical protein G786_00636 [Escherichia coli HVH 126
(4-6034225)]
gb|EQR55335.1| hypothetical protein G787_00656 [Escherichia coli HVH 127
(4-7303629)]
gb|EQR63017.1| hypothetical protein G788_00644 [Escherichia coli HVH 128
(4-7030436)]
gb|EQR68967.1| hypothetical protein G790_00598 [Escherichia coli HVH 132
(4-6876862)]
gb|EQR69265.1| hypothetical protein G789_00712 [Escherichia coli HVH 130
(4-7036876)]
gb|EQR71863.1| hypothetical protein G792_03545 [Escherichia coli HVH 134
(4-6073441)]
gb|EQR75174.1| hypothetical protein G791_03932 [Escherichia coli HVH 133
(4-4466519)]
gb|EQR76846.1| hypothetical protein G793_00725 [Escherichia coli HVH 135
(4-4449320)]
gb|EQR89822.1| hypothetical protein G795_00495 [Escherichia coli HVH 137
(4-2124971)]
gb|EQR96456.1| hypothetical protein G796_00081 [Escherichia coli HVH 138
(4-6066704)]
gb|EQS01397.1| hypothetical protein G797_00639 [Escherichia coli HVH 139
(4-3192644)]
gb|EQS07050.1| hypothetical protein G798_00725 [Escherichia coli HVH 140
(4-5894387)]
gb|EQS08604.1| hypothetical protein G799_00535 [Escherichia coli HVH 141
(4-5995973)]
gb|EQS17411.1| hypothetical protein G801_00595 [Escherichia coli HVH 143
(4-5674999)]
gb|EQS23449.1| hypothetical protein G803_03815 [Escherichia coli HVH 145
(4-5672112)]
gb|EQS23794.1| hypothetical protein G800_00714 [Escherichia coli HVH 142
(4-5627451)]
gb|EQS28332.1| hypothetical protein G802_00699 [Escherichia coli HVH 144
(4-4451937)]
gb|EQS36809.1| hypothetical protein G805_00922 [Escherichia coli HVH 147
(4-5893887)]
gb|EQS42313.1| hypothetical protein G807_00583 [Escherichia coli HVH 149
(4-4451880)]
gb|EQS42744.1| hypothetical protein G804_00282 [Escherichia coli HVH 146
(4-3189767)]
gb|EQS50430.1| hypothetical protein G809_00716 [Escherichia coli HVH 151
(4-5755573)]
gb|EQS55497.1| hypothetical protein G811_00588 [Escherichia coli HVH 153
(3-9344314)]
gb|EQS58387.1| hypothetical protein G808_00616 [Escherichia coli HVH 150
(4-3258106)]
gb|EQS61705.1| hypothetical protein G816_02043 [Escherichia coli HVH 158
(4-3224287)]
gb|EQS69517.1| hypothetical protein G819_01861 [Escherichia coli HVH 161
(4-3119890)]
gb|EQS71637.1| hypothetical protein G812_00656 [Escherichia coli HVH 154
(4-5636698)]
gb|EQS73832.1| hypothetical protein G821_03760 [Escherichia coli HVH 163
(4-4697553)]
gb|EQS84995.1| hypothetical protein G822_02638 [Escherichia coli HVH 164
(4-5953081)]
gb|EQS90464.1| hypothetical protein G823_00725 [Escherichia coli HVH 167
(4-6073565)]
gb|EQT01526.1| hypothetical protein G824_00603 [Escherichia coli HVH 169
(4-1075578)]
gb|EQT04479.1| hypothetical protein G826_00591 [Escherichia coli HVH 171
(4-3191958)]
gb|EQT04866.1| hypothetical protein G825_02179 [Escherichia coli HVH 170
(4-3026949)]
gb|EQT13216.1| hypothetical protein G828_03943 [Escherichia coli HVH 173
(3-9175482)]
gb|EQT17187.1| hypothetical protein G827_00615 [Escherichia coli HVH 172
(4-3248542)]
gb|EQT27081.1| hypothetical protein G830_00628 [Escherichia coli HVH 176
(4-3428664)]
gb|EQT29886.1| hypothetical protein G829_00589 [Escherichia coli HVH 175
(4-3405184)]
gb|EQT31459.1| hypothetical protein G833_00663 [Escherichia coli HVH 180
(4-3051617)]
gb|EQT39871.1| hypothetical protein G835_00730 [Escherichia coli HVH 183
(4-3205932)]
gb|EQT43128.1| hypothetical protein G834_00706 [Escherichia coli HVH 182
(4-0985554)]
gb|EQT48766.1| hypothetical protein G836_00595 [Escherichia coli HVH 184
(4-3343286)]
gb|EQT54314.1| hypothetical protein G837_00650 [Escherichia coli HVH 185
(4-2876639)]
gb|EQT62363.1| hypothetical protein G838_00682 [Escherichia coli HVH 186
(4-3405044)]
gb|EQT63545.1| hypothetical protein G840_00686 [Escherichia coli HVH 188
(4-2356988)]
gb|EQT79196.1| hypothetical protein G841_00723 [Escherichia coli HVH 189
(4-3220125)]
gb|EQT84866.1| hypothetical protein G843_00628 [Escherichia coli HVH 191
(3-9341900)]
gb|EQT87199.1| hypothetical protein G844_00590 [Escherichia coli HVH 192
(4-3054470)]
gb|EQT93043.1| hypothetical protein G845_00651 [Escherichia coli HVH 193
(4-3331423)]
gb|EQT98795.1| hypothetical protein G846_02212 [Escherichia coli HVH 194
(4-2356805)]
gb|EQU00836.1| hypothetical protein G847_00658 [Escherichia coli HVH 195
(3-7155360)]
gb|EQU00963.1| hypothetical protein G848_02303 [Escherichia coli HVH 196
(4-4530470)]
gb|EQU14559.1| hypothetical protein G851_00674 [Escherichia coli HVH 199
(4-5670322)]
gb|EQU16252.1| hypothetical protein G850_00644 [Escherichia coli HVH 198
(4-3206106)]
gb|EQU25975.1| hypothetical protein G849_00163 [Escherichia coli HVH 197
(4-4466217)]
gb|EQU27351.1| hypothetical protein G853_00606 [Escherichia coli HVH 201
(4-4459431)]
gb|EQU30592.1| hypothetical protein G852_00752 [Escherichia coli HVH 200
(4-4449924)]
gb|EQU38760.1| hypothetical protein G855_00604 [Escherichia coli HVH 203
(4-3126218)]
gb|EQU40970.1| hypothetical protein G854_00628 [Escherichia coli HVH 202
(4-3163997)]
gb|EQU45378.1| hypothetical protein G856_00639 [Escherichia coli HVH 204
(4-3112802)]
gb|EQU49701.1| hypothetical protein G858_02024 [Escherichia coli HVH 206
(4-3128229)]
gb|EQU57268.1| hypothetical protein G857_00352 [Escherichia coli HVH 205
(4-3094677)]
gb|EQU61254.1| hypothetical protein G859_00599 [Escherichia coli HVH 207
(4-3113221)]
gb|EQU62857.1| hypothetical protein G860_00725 [Escherichia coli HVH 208
(4-3112292)]
gb|EQU64610.1| hypothetical protein G861_03305 [Escherichia coli HVH 209
(4-3062651)]
gb|EQU75159.1| hypothetical protein G863_00666 [Escherichia coli HVH 211
(4-3041891)]
gb|EQU80472.1| hypothetical protein G864_00647 [Escherichia coli HVH 212
(3-9305343)]
gb|EQU86478.1| hypothetical protein G867_00724 [Escherichia coli HVH 215
(4-3008371)]
gb|EQU88539.1| hypothetical protein G865_00699 [Escherichia coli HVH 213
(4-3042928)]
gb|EQU97706.1| hypothetical protein G869_00634 [Escherichia coli HVH 217
(4-1022806)]
gb|EQU99304.1| hypothetical protein G868_00591 [Escherichia coli HVH 216
(4-3042952)]
gb|EQV04127.1| hypothetical protein G870_00646 [Escherichia coli HVH 218
(4-4500903)]
gb|EQV12596.1| hypothetical protein G871_00609 [Escherichia coli HVH 220
(4-5876842)]
gb|EQV17084.1| hypothetical protein G873_00665 [Escherichia coli HVH 222
(4-2977443)]
gb|EQV25346.1| hypothetical protein G874_00745 [Escherichia coli HVH 223
(4-2976528)]
gb|EQV30250.1| hypothetical protein G876_00617 [Escherichia coli HVH 227
(4-2277670)]
gb|EQV34729.1| hypothetical protein G881_00826 [Escherichia coli KOEGE 30 (63a)]
gb|EQV37157.1| hypothetical protein G875_00647 [Escherichia coli HVH 225
(4-1273116)]
gb|EQV38682.1| hypothetical protein G882_03378 [Escherichia coli KOEGE 32 (66a)]
gb|EQV45905.1| hypothetical protein G884_03177 [Escherichia coli KOEGE 40 (102a)]
gb|EQV49623.1| hypothetical protein G883_00682 [Escherichia coli KOEGE 33 (68a)]
gb|EQV58631.1| hypothetical protein G885_00583 [Escherichia coli KOEGE 43 (105a)]
gb|EQV60361.1| hypothetical protein G886_00587 [Escherichia coli KOEGE 44 (106a)]
gb|EQV71544.1| hypothetical protein G889_00694 [Escherichia coli KOEGE 61 (174a)]
gb|EQV73445.1| hypothetical protein G888_00522 [Escherichia coli KOEGE 58 (171a)]
gb|EQV82254.1| hypothetical protein G891_00706 [Escherichia coli KOEGE 68 (182a)]
gb|EQV85597.1| hypothetical protein G890_00727 [Escherichia coli KOEGE 62 (175a)]
gb|EQV90841.1| hypothetical protein G892_00579 [Escherichia coli KOEGE 70 (185a)]
gb|EQV92399.1| hypothetical protein G894_04684 [Escherichia coli KOEGE 73 (195a)]
gb|EQV94798.1| hypothetical protein G893_01173 [Escherichia coli KOEGE 71 (186a)]
gb|EQW00074.1| hypothetical protein G896_03248 [Escherichia coli KOEGE 118 (317a)]
gb|EQW07314.1| hypothetical protein G895_00700 [Escherichia coli KOEGE 77 (202a)]
gb|EQW15179.1| hypothetical protein G897_00637 [Escherichia coli KOEGE 131 (358a)]
gb|EQW22415.1| hypothetical protein G899_00631 [Escherichia coli UMEA 3022-1]
gb|EQW22804.1| hypothetical protein G898_00679 [Escherichia coli UMEA 3014-1]
gb|EQW32536.1| hypothetical protein G900_00616 [Escherichia coli UMEA 3033-1]
gb|EQW36103.1| hypothetical protein G901_00645 [Escherichia coli UMEA 3041-1]
gb|EQW46493.1| hypothetical protein G903_00636 [Escherichia coli UMEA 3053-1]
gb|EQW48146.1| hypothetical protein G904_00186 [Escherichia coli UMEA 3065-1]
gb|EQW54510.1| hypothetical protein G905_00638 [Escherichia coli UMEA 3087-1]
gb|EQW58649.1| hypothetical protein G907_00578 [Escherichia coli UMEA 3097-1]
gb|EQW67012.1| hypothetical protein G906_00647 [Escherichia coli UMEA 3088-1]
gb|EQW72614.1| hypothetical protein G909_00649 [Escherichia coli UMEA 3113-1]
gb|EQW74113.1| hypothetical protein G910_02629 [Escherichia coli UMEA 3117-1]
gb|EQW83248.1| hypothetical protein G911_00633 [Escherichia coli UMEA 3121-1]
gb|EQW90025.1| hypothetical protein G912_00481 [Escherichia coli UMEA 3122-1]
gb|EQW91716.1| hypothetical protein G913_00706 [Escherichia coli UMEA 3124-1]
gb|EQW94453.1| hypothetical protein G915_03499 [Escherichia coli UMEA 3140-1]
gb|EQW97436.1| hypothetical protein G914_00634 [Escherichia coli UMEA 3139-1]
gb|EQX03799.1| hypothetical protein G920_00599 [Escherichia coli UMEA 3152-1]
gb|EQX14488.1| hypothetical protein G922_00618 [Escherichia coli UMEA 3159-1]
gb|EQX23411.1| hypothetical protein G924_00636 [Escherichia coli UMEA 3161-1]
gb|EQX31740.1| hypothetical protein G925_00643 [Escherichia coli UMEA 3162-1]
gb|EQX36892.1| hypothetical protein G926_00616 [Escherichia coli UMEA 3163-1]
gb|EQX38697.1| hypothetical protein G927_00602 [Escherichia coli UMEA 3172-1]
gb|EQX46810.1| hypothetical protein G930_00689 [Escherichia coli UMEA 3175-1]
gb|EQX48285.1| hypothetical protein G928_00610 [Escherichia coli UMEA 3173-1]
gb|EQX59526.1| hypothetical protein G931_00642 [Escherichia coli UMEA 3176-1]
gb|EQX59828.1| hypothetical protein G929_00627 [Escherichia coli UMEA 3174-1]
gb|EQX61474.1| hypothetical protein G932_00744 [Escherichia coli UMEA 3178-1]
gb|EQX69228.1| hypothetical protein G933_02415 [Escherichia coli UMEA 3180-1]
gb|EQX69587.1| hypothetical protein G934_00426 [Escherichia coli UMEA 3185-1]
gb|EQX78893.1| hypothetical protein G936_00619 [Escherichia coli UMEA 3193-1]
gb|EQX87158.1| hypothetical protein G937_00669 [Escherichia coli UMEA 3199-1]
gb|EQX90401.1| hypothetical protein G938_00675 [Escherichia coli UMEA 3200-1]
gb|EQY01708.1| hypothetical protein G939_01021 [Escherichia coli UMEA 3201-1]
gb|EQY04776.1| hypothetical protein G940_00601 [Escherichia coli UMEA 3203-1]
gb|EQY06388.1| hypothetical protein G941_00607 [Escherichia coli UMEA 3206-1]
gb|EQY13623.1| hypothetical protein G942_00616 [Escherichia coli UMEA 3208-1]
gb|EQY18215.1| hypothetical protein G944_00645 [Escherichia coli UMEA 3215-1]
gb|EQY24067.1| hypothetical protein G945_00675 [Escherichia coli UMEA 3216-1]
gb|EQY28160.1| hypothetical protein G946_01965 [Escherichia coli UMEA 3217-1]
gb|EQY32169.1| hypothetical protein G943_00191 [Escherichia coli UMEA 3212-1]
gb|EQY35256.1| hypothetical protein G947_00608 [Escherichia coli UMEA 3220-1]
gb|EQY48772.1| hypothetical protein G949_00584 [Escherichia coli UMEA 3222-1]
gb|EQY60761.1| hypothetical protein G953_00617 [Escherichia coli UMEA 3244-1]
gb|EQY62295.1| hypothetical protein G951_00656 [Escherichia coli UMEA 3233-1]
gb|EQY68324.1| hypothetical protein G952_00677 [Escherichia coli UMEA 3240-1]
gb|EQY72020.1| hypothetical protein G956_00629 [Escherichia coli UMEA 3264-1]
gb|EQY75745.1| hypothetical protein G955_00599 [Escherichia coli UMEA 3257-1]
gb|EQY76091.1| hypothetical protein G962_04785 [Escherichia coli UMEA 3304-1]
gb|EQY79694.1| hypothetical protein G957_00616 [Escherichia coli UMEA 3268-1]
gb|EQY83402.1| hypothetical protein G964_03274 [Escherichia coli UMEA 3317-1]
gb|EQY92617.1| hypothetical protein G963_00732 [Escherichia coli UMEA 3314-1]
gb|EQZ04384.1| hypothetical protein G965_00835 [Escherichia coli UMEA 3318-1]
gb|EQZ04835.1| hypothetical protein G967_00574 [Escherichia coli UMEA 3329-1]
gb|EQZ07447.1| hypothetical protein G969_00661 [Escherichia coli UMEA 3337-1]
gb|EQZ16730.1| hypothetical protein G970_00582 [Escherichia coli UMEA 3341-1]
gb|EQZ20123.1| hypothetical protein G972_00649 [Escherichia coli UMEA 3355-1]
gb|EQZ23024.1| hypothetical protein G973_00701 [Escherichia coli UMEA 3391-1]
gb|EQZ24819.1| hypothetical protein G977_04129 [Escherichia coli UMEA 3585-1]
gb|EQZ31299.1| hypothetical protein G976_00622 [Escherichia coli UMEA 3490-1]
gb|EQZ43231.1| hypothetical protein G978_00643 [Escherichia coli UMEA 3592-1]
gb|EQZ43628.1| hypothetical protein G980_00647 [Escherichia coli UMEA 3617-1]
gb|EQZ46018.1| hypothetical protein G979_00648 [Escherichia coli UMEA 3609-1]
gb|EQZ53426.1| hypothetical protein G983_01869 [Escherichia coli UMEA 3656-1]
gb|EQZ56597.1| hypothetical protein G981_00672 [Escherichia coli UMEA 3632-1]
gb|EQZ61389.1| hypothetical protein G984_00607 [Escherichia coli UMEA 3662-1]
gb|EQZ69791.1| hypothetical protein G985_00737 [Escherichia coli UMEA 3671-1]
gb|EQZ70172.1| hypothetical protein G986_00719 [Escherichia coli UMEA 3682-1]
gb|EQZ81368.1| hypothetical protein G987_00584 [Escherichia coli UMEA 3687-1]
gb|EQZ81769.1| hypothetical protein G989_00697 [Escherichia coli UMEA 3694-1]
gb|EQZ83026.1| hypothetical protein G990_00605 [Escherichia coli UMEA 3702-1]
gb|EQZ84276.1| hypothetical protein G992_04641 [Escherichia coli UMEA 3705-1]
gb|EQZ93163.1| hypothetical protein G993_00587 [Escherichia coli UMEA 3707-1]
gb|ERA09781.1| hypothetical protein G995_00596 [Escherichia coli UMEA 3805-1]
gb|ERA09943.1| hypothetical protein G994_00686 [Escherichia coli UMEA 3718-1]
gb|ERA12540.1| hypothetical protein G996_00603 [Escherichia coli UMEA 3821-1]
gb|ERA22404.1| hypothetical protein G998_00664 [Escherichia coli UMEA 3889-1]
gb|ERA25354.1| hypothetical protein G999_00623 [Escherichia coli UMEA 3893-1]
gb|ERA26479.1| hypothetical protein G997_00683 [Escherichia coli UMEA 3834-1]
gb|ERA35105.1| hypothetical protein H001_00987 [Escherichia coli UMEA 3955-1]
gb|ERA40111.1| hypothetical protein H002_00588 [Escherichia coli UMEA 4075-1]
gb|ERA48506.1| hypothetical protein H004_00639 [Escherichia coli UMEA 4207-1]
gb|ERA51366.1| hypothetical protein H003_00599 [Escherichia coli UMEA 4076-1]
gb|ERA62194.1| hypothetical protein L668_03555 [Escherichia coli 95NR1]
gb|ERA68710.1| hypothetical protein G813_00727 [Escherichia coli HVH 155
(4-4509048)]
gb|ERA77488.1| hypothetical protein G814_00613 [Escherichia coli HVH 156
(4-3206505)]
gb|ERA78884.1| hypothetical protein G815_00637 [Escherichia coli HVH 157
(4-3406229)]
gb|ERA83343.1| hypothetical protein G817_00646 [Escherichia coli HVH 159
(4-5818141)]
gb|ERA91936.1| hypothetical protein G818_00605 [Escherichia coli HVH 160
(4-5695937)]
gb|ERA93167.1| hypothetical protein G862_00524 [Escherichia coli HVH 210
(4-3042480)]
gb|ERA96505.1| hypothetical protein G877_00586 [Escherichia coli HVH 228
(4-7787030)]
gb|ERB04979.1| hypothetical protein G878_00637 [Escherichia coli KOEGE 3 (4a)]
gb|ERB09583.1| hypothetical protein G879_00638 [Escherichia coli KOEGE 7 (16a)]
gb|ERB11342.1| hypothetical protein G880_00587 [Escherichia coli KOEGE 10 (25a)]
gb|ERB15583.1| hypothetical protein G918_03295 [Escherichia coli UMEA 3150-1]
gb|ERB19565.1| hypothetical protein G916_00674 [Escherichia coli UMEA 3144-1]
gb|ERB23798.1| hypothetical protein G919_00998 [Escherichia coli UMEA 3151-1]
gb|ERB32400.1| hypothetical protein G958_00649 [Escherichia coli UMEA 3271-1]
gb|ERB38271.1| hypothetical protein G961_00045 [Escherichia coli UMEA 3298-1]
gb|ERB39053.1| hypothetical protein G960_00654 [Escherichia coli UMEA 3292-1]
gb|ERB78327.1| hypothetical protein QYE_1118 [Escherichia coli B107]
gb|ERB83698.1| hypothetical protein EC09BKT76207_0432 [Escherichia coli
09BKT076207]
gb|ERB88112.1| hypothetical protein QYC_0809 [Escherichia coli B102]
gb|ERB91229.1| hypothetical protein S11_0950 [Escherichia coli B26-1]
gb|ERB94898.1| hypothetical protein S13_2375 [Escherichia coli B26-2]
gb|ERC05684.1| hypothetical protein QYM_0848 [Escherichia coli B28-2]
gb|ERC06950.1| hypothetical protein QYK_0853 [Escherichia coli B28-1]
gb|ERC13398.1| hypothetical protein QYO_0864 [Escherichia coli B29-1]
gb|ERC22233.1| hypothetical protein QYQ_0790 [Escherichia coli B29-2]
gb|ERC24999.1| hypothetical protein QYS_0559 [Escherichia coli B36-1]
gb|ERC28845.1| hypothetical protein QYU_0833 [Escherichia coli B36-2]
gb|ERC36981.1| hypothetical protein QYG_0512 [Escherichia coli B7-1]
gb|ERC45582.1| hypothetical protein QYI_0525 [Escherichia coli B7-2]
gb|ERC46894.1| hypothetical protein S1C_0527 [Escherichia coli B93]
gb|ERC52352.1| hypothetical protein S1E_0592 [Escherichia coli B94]
gb|ERC60140.1| hypothetical protein S1G_0768 [Escherichia coli B95]
gb|ERC62753.1| hypothetical protein ECOT7509_0675 [Escherichia coli TW07509]
gb|ERC71072.1| hypothetical protein EC08BKT55439_0765 [Escherichia coli
08BKT055439]
gb|ERC73284.1| hypothetical protein ECBD561099_0754 [Escherichia coli Bd5610_99]
gb|ERC76466.1| hypothetical protein ECT184097_0699 [Escherichia coli T1840_97]
gb|ERC86246.1| hypothetical protein ECT23400_0751 [Escherichia coli T234_00]
gb|ERC89559.1| hypothetical protein ECT92401_0898 [Escherichia coli T924_01]
gb|ERC91121.1| hypothetical protein B230_0933 [Escherichia coli 14A]
gb|ERD04232.1| hypothetical protein S35_0849 [Escherichia coli B104]
gb|ERD06075.1| hypothetical protein S1I_0847 [Escherichia coli B103]
gb|ERD06979.1| hypothetical protein B233_0854 [Escherichia coli 2886-75]
gb|ERD19493.1| hypothetical protein S3C_0850 [Escherichia coli B105]
gb|ERD21213.1| hypothetical protein S3E_0819 [Escherichia coli B106]
gb|ERD22108.1| hypothetical protein S33_0869 [Escherichia coli B108]
gb|ERD33803.1| hypothetical protein S37_0882 [Escherichia coli B109]
gb|ERD35864.1| hypothetical protein S3G_0845 [Escherichia coli B112]
gb|ERD42975.1| hypothetical protein S3I_0884 [Escherichia coli B113]
gb|ERD50762.1| hypothetical protein S3K_0871 [Escherichia coli B114]
gb|ERD52849.1| hypothetical protein S1O_0748 [Escherichia coli B15]
gb|ERD54715.1| hypothetical protein S1Q_0590 [Escherichia coli B17]
gb|ERD67643.1| hypothetical protein S17_0851 [Escherichia coli B40-2]
gb|ERD71212.1| hypothetical protein S3A_0867 [Escherichia coli B49-2]
gb|ERD71749.1| hypothetical protein S15_0841 [Escherichia coli B40-1]
gb|ERD81680.1| hypothetical protein QYY_0863 [Escherichia coli B5-2]
gb|ERD84995.1| hypothetical protein S1U_0855 [Escherichia coli B83]
gb|ERD89748.1| hypothetical protein S1W_0847 [Escherichia coli B84]
gb|ERD96269.1| hypothetical protein S31_0595 [Escherichia coli B86]
gb|ERD96518.1| hypothetical protein S1Y_0877 [Escherichia coli B85]
gb|ERE04498.1| hypothetical protein L667_09660 [Escherichia coli 95JB1]
gb|ERE10508.1| hypothetical protein EC08BKT77219_0789 [Escherichia coli
08BKT77219]
gb|ERE20614.1| hypothetical protein EC09BKT24447_0926 [Escherichia coli
09BKT024447]
gb|ERE26322.1| hypothetical protein ECT128201_0663 [Escherichia coli T1282_01]
gb|ERE34921.1| hypothetical protein S1K_0872 [Escherichia coli B89]
gb|ERE37762.1| hypothetical protein S1M_0844 [Escherichia coli B90]
gb|ERE40939.1| hypothetical protein B232_0981 [Escherichia coli Tx1686]
gb|ERE44757.1| hypothetical protein B231_0935 [Escherichia coli Tx3800]
gb|ERF50909.1| hypothetical protein G982_03801 [Escherichia coli UMEA 3652-1]
gb|ERF96912.1| hypothetical protein CFSAN002237_07370 [Escherichia coli O104:H21
str. CFSAN002237]
gb|AGW08053.1| hypothetical protein LY180_03470 [Escherichia coli LY180]
emb|CDH64167.1| hypothetical protein ECOPMV1_00660 [Escherichia coli PMV-1]
gb|AGX32780.1| conserved protein, DUF1451 family [synthetic Escherichia coli
C321.deltaA]
gb|ERO89533.1| hypothetical protein L411_00945 [Escherichia coli BWH 24]
gb|ERO95479.1| hypothetical protein L454_00659 [Escherichia coli BIDMC 19C]
gb|ESA30763.1| hypothetical protein L913_0041 [Escherichia coli SCD2]
gb|ESA60240.1| hypothetical protein HMPREF1589_05528 [Escherichia coli 113290]
gb|ESA61296.1| hypothetical protein HMPREF1588_05380 [Escherichia coli 110957]
gb|ESA63480.1| hypothetical protein HMPREF1591_03117 [Escherichia coli 113303]
gb|ESA70638.1| hypothetical protein HMPREF1592_05164 [Escherichia coli 907357]
gb|ESA82313.1| hypothetical protein HMPREF1599_04428 [Escherichia coli 907713]
gb|ESA93895.1| hypothetical protein HMPREF1601_00382 [Escherichia coli 907779]
gb|ESA96548.1| hypothetical protein HMPREF1620_01798 [Escherichia coli 909945-2]
gb|ESC91267.1| hypothetical protein HMPREF1594_04701 [Escherichia coli 907446]
gb|ESC92245.1| hypothetical protein HMPREF1590_04334 [Escherichia coli 113302]
gb|ESC97125.1| hypothetical protein HMPREF1593_02218 [Escherichia coli 907391]
gb|ESD05171.1| hypothetical protein HMPREF1595_03758 [Escherichia coli 907672]
gb|ESD06289.1| hypothetical protein HMPREF1596_04755 [Escherichia coli 907700]
gb|ESD17578.1| hypothetical protein HMPREF1598_03771 [Escherichia coli 907710]
gb|ESD21862.1| hypothetical protein HMPREF1600_04087 [Escherichia coli 907715]
gb|ESD22381.1| hypothetical protein HMPREF1597_02158 [Escherichia coli 907701]
gb|ESD32488.1| hypothetical protein HMPREF1604_05622 [Escherichia coli 908519]
gb|ESD34015.1| hypothetical protein HMPREF1602_04326 [Escherichia coli 907889]
gb|ESD38847.1| hypothetical protein HMPREF1603_01931 [Escherichia coli 907892]
gb|ESD47831.1| hypothetical protein HMPREF1605_04400 [Escherichia coli 908521]
gb|ESD52640.1| hypothetical protein HMPREF1606_03657 [Escherichia coli 908522]
gb|ESD62958.1| hypothetical protein HMPREF1607_00521 [Escherichia coli 908524]
gb|ESD67591.1| hypothetical protein HMPREF1610_03402 [Escherichia coli 908555]
gb|ESD70735.1| hypothetical protein HMPREF1608_02897 [Escherichia coli 908525]
gb|ESD71850.1| hypothetical protein HMPREF1609_03154 [Escherichia coli 908541]
gb|ESD78293.1| hypothetical protein HMPREF1611_04995 [Escherichia coli 908573]
gb|ESD82570.1| hypothetical protein HMPREF1613_05012 [Escherichia coli 908616]
gb|ESD83012.1| hypothetical protein HMPREF1612_04464 [Escherichia coli 908585]
gb|ESD94794.1| hypothetical protein HMPREF1614_04341 [Escherichia coli 908624]
gb|ESE04067.1| hypothetical protein HMPREF1616_03125 [Escherichia coli 908658]
gb|ESE05680.1| hypothetical protein HMPREF1615_02832 [Escherichia coli 908632]
gb|ESE10315.1| hypothetical protein HMPREF1617_04548 [Escherichia coli 908675]
gb|ESE16891.1| hypothetical protein HMPREF1618_03524 [Escherichia coli 908691]
gb|ESE27879.1| hypothetical protein HMPREF1622_04865 [Escherichia coli A35218R]
gb|ESE35428.1| hypothetical protein HMPREF1621_01784 [Escherichia coli A25922R]
gb|AGY83561.1| hypothetical protein P423_03155 [Escherichia coli JJ1886]
gb|ESK09228.1| hypothetical protein G968_00595 [Escherichia coli UMEA 3336-1]
gb|ESK09773.1| hypothetical protein G759_00671 [Escherichia coli HVH 98
(4-5799287)]
gb|ESK11957.1| hypothetical protein G723_01754 [Escherichia coli HVH 50
(4-2593475)]
gb|ESK20470.1| hypothetical protein G959_00828 [Escherichia coli UMEA 3290-1]
gb|ESK21216.1| hypothetical protein G974_00801 [Escherichia coli UMEA 3426-1]
gb|ESK31707.1| hypothetical protein G988_00782 [Escherichia coli UMEA 3693-1]
gb|ESK32475.1| hypothetical protein G971_00628 [Escherichia coli UMEA 3342-1]
gb|ESK41387.1| hypothetical protein G966_00726 [Escherichia coli UMEA 3323-1]
gb|ESL25918.1| hypothetical protein L476_00682 [Escherichia coli BIDMC 39]
gb|ESL44108.1| hypothetical protein L475_00626 [Escherichia coli BIDMC 38]
gb|ESM40770.1| hypothetical protein L403_00755 [Escherichia coli BWH 32]
gb|ESP10307.1| hypothetical protein G711_00502 [Escherichia coli HVH 36
(4-5675286)]
gb|ESP21469.1| hypothetical protein G794_00820 [Escherichia coli HVH 136
(4-5970458)]
gb|ESP23741.1| hypothetical protein G690_00476 [Escherichia coli HVH 12
(4-7653042)]
gb|ESP25678.1| hypothetical protein G748_00719 [Escherichia coli HVH 86
(4-7026218)]
gb|ESP32661.1| hypothetical protein G806_02252 [Escherichia coli HVH 148
(4-3192490)]
gb|ESP34095.1| hypothetical protein G832_01396 [Escherichia coli HVH 178
(4-3189163)]
gb|ESP47876.1| hypothetical protein G810_00561 [Escherichia coli HVH 152
(4-3447545)]
gb|ESP48331.1| hypothetical protein G769_00614 [Escherichia coli HVH 108
(4-6924867)]
gb|ESP49514.1| hypothetical protein G917_00673 [Escherichia coli UMEA 3148-1]
emb|CDJ71102.1| hypothetical protein BN896_0514 [Escherichia coli str. K-12 substr.
MC4100]
gb|ESS88903.1| hypothetical protein L343_4315 [Escherichia coli CE549]
gb|ESS96342.1| hypothetical protein L342_1029 [Escherichia coli CE516]
gb|EST00840.1| hypothetical protein L341_1941 [Escherichia coli CE418]
gb|AHA63561.1| Hypothetical protein Asd1617_00734 [Shigella dysenteriae 1617]
gb|EST60449.1| hypothetical protein ECCZ_20893 [Escherichia coli ECC-Z]
gb|EST66219.1| hypothetical protein M13_18378 [Escherichia coli P4-96]
gb|EST70724.1| hypothetical protein MOI_10787 [Escherichia coli P4-NR]
gb|EST76085.1| hypothetical protein ECC1470_24547 [Escherichia coli ECC-1470]
gb|EST81171.1| hypothetical protein ECA727_05358 [Escherichia coli ECA-727]
gb|ESU80356.1| hypothetical protein WRSd3_01504 [Shigella dysenteriae WRSd3]
gb|ESU82702.1| hypothetical protein WRSd5_02509 [Shigella dysenteriae WRSd5]
gb|ESV03135.1| hypothetical protein L339_03253 [Escherichia coli E1777]
gb|ETD64691.1| hypothetical protein Q458_05700 [Escherichia coli ATCC BAA-2209]
gb|ETE13151.1| hypothetical protein V413_03100 [Escherichia coli LAU-EC8]
gb|ETE18675.1| hypothetical protein V411_01705 [Escherichia coli LAU-EC6]
gb|ETE25508.1| hypothetical protein V415_04595 [Escherichia coli LAU-EC10]
gb|ETE32190.1| hypothetical protein V412_12300 [Escherichia coli LAU-EC7]
gb|ETE39501.1| hypothetical protein V414_03105 [Escherichia coli LAU-EC9]
gb|ETF21964.1| hypothetical protein G831_00382 [Escherichia coli HVH 177
(4-2876612)]
gb|ETF22142.1| hypothetical protein G745_02228 [Escherichia coli HVH 83
(4-2051087)]
gb|ETF26267.1| hypothetical protein G866_03693 [Escherichia coli HVH 214
(4-3062198)]
gb|ETF30194.1| hypothetical protein G699_00395 [Escherichia coli HVH 23
(4-6066488)]
gb|ETF33198.1| hypothetical protein G975_04206 [Escherichia coli UMEA 3489-1]
gb|ETI73890.1| hypothetical protein Q460_20355 [Escherichia coli ATCC BAA-2219]
gb|ETI74163.1| hypothetical protein Q457_19615 [Escherichia coli ATCC BAA-2196]
gb|ETJ22281.1| hypothetical protein Q609_ECAC01653G0007 [Escherichia coli
DORA_A_5_14_21]
gb|ETJ56744.1| hypothetical protein Q456_0222330 [Escherichia coli ATCC BAA-2193]
gb|ETJ67645.1| hypothetical protein O199_0218835 [Escherichia coli ATCC 35150]
gb|ETJ80896.1| hypothetical protein Q455_0204140 [Escherichia coli ATCC BAA-2192]
emb|CDK47345.1| COG2433: Uncharacterized conserved protein [Escherichia coli IS1]
emb|CDK53258.1| COG2433: Uncharacterized conserved protein [Escherichia coli IS5]
gb|AHF25772.1| ybeL protein [uncultured bacterium Contigcl_138]
emb|CDK81433.1| FIG002095: hypothetical protein [Escherichia coli IS25]
emb|CDL24481.1| COG2433: Uncharacterized conserved protein [Escherichia coli ISC7]
emb|CDK78804.1| FIG002095: hypothetical protein [Klebsiella pneumoniae IS22]
emb|CDK60080.1| COG2433: Uncharacterized conserved protein [Escherichia coli IS9]
emb|CDL06658.1| FIG002095: hypothetical protein [Escherichia coli IS35]
emb|CDK85843.1| FIG002095: hypothetical protein [Escherichia coli IS29]
gb|ETS24418.1| hypothetical protein N444_25005 [Escherichia coli O6:H16:CFA/II
str. B2C]
gb|AHG13299.1| hypothetical protein ECRM13516_0612 [Escherichia coli O145:H28 str.
RM13516]
gb|AHG07366.1| hypothetical protein ECRM13514_0667 [Escherichia coli O145:H28 str.
RM13514]
gb|ETX74750.1| hypothetical protein P804_04035 [Escherichia coli BIDMC 43b]
gb|ETX83807.1| hypothetical protein P803_03600 [Escherichia coli BIDMC 43a]
gb|ETX93655.1| hypothetical protein L456_00625 [Escherichia coli BIDMC 20B]
gb|ETX97784.1| hypothetical protein L455_04937 [Escherichia coli BIDMC 20A]
gb|ETY01206.1| hypothetical protein L453_06418 [Escherichia coli BIDMC 19B]
gb|ETY04372.1| hypothetical protein L452_09313 [Escherichia coli BIDMC 19A]
gb|ETY10548.1| hypothetical protein L447_08653 [Escherichia coli BIDMC 17B]
gb|ETY14635.1| hypothetical protein L446_04956 [Escherichia coli BIDMC 17A]
gb|ETY22468.1| hypothetical protein L444_07574 [Escherichia coli BIDMC 15]
gb|ETY27745.1| hypothetical protein L436_06901 [Escherichia coli BIDMC 9]
gb|ETY34346.1| hypothetical protein L429_05670 [Escherichia coli BIDMC 3]
gb|ETY40384.1| hypothetical protein L428_07973 [Escherichia coli BIDMC 2B]
gb|ETY43893.1| hypothetical protein L404_00630 [Escherichia coli BWH 34]
gb|ETY50039.1| hypothetical protein L408_01146 [Escherichia coli BWH 40]
gb|ETY51916.1| hypothetical protein P811_04026 [Escherichia coli BIDMC 49b]
gb|ETY53725.1| hypothetical protein P810_04059 [Escherichia coli BIDMC 49a]
gb|ETY63527.1| hypothetical protein L432_04963 [Escherichia coli BIDMC 6]
emb|CDL49076.1| COG2433: Uncharacterized conserved protein [Escherichia coli ISC41]
gb|EWC57124.1| hypothetical protein G654_04989 [Escherichia coli EC096/10]
gb|EWY55179.1| hypothetical protein K427_01250 [Escherichia coli MP1]
gb|AHM28529.1| hypothetical protein BU34_04250 [Escherichia coli]
gb|AHM35456.1| hypothetical protein CF57_20665 [Escherichia coli]
gb|AHM40053.1| hypothetical protein CF61_21355 [Escherichia coli]
gb|AHM42842.1| hypothetical protein CF58_08490 [Escherichia coli]
gb|AHM47473.1| hypothetical protein CF59_08570 [Escherichia coli]
gb|AHM52014.1| hypothetical protein CF60_08605 [Escherichia coli]
gb|EYB38824.1| hypothetical protein BU70_23145 [Escherichia coli]
gb|EYB40403.1| hypothetical protein BU66_22200 [Escherichia coli]
gb|EYB46828.1| hypothetical protein BU65_24995 [Escherichia coli]
gb|EYB51004.1| hypothetical protein BU68_18320 [Escherichia coli]
gb|EYB60763.1| hypothetical protein BU67_23120 [Escherichia coli]
gb|EYD87093.1| hypothetical protein AC26_0691 [Escherichia coli 1-176-05_S3_C2]
gb|EYD90429.1| hypothetical protein AB11_0655 [Escherichia coli 1-176-05_S1_C1]
gb|EYD91912.1| hypothetical protein AB98_0676 [Escherichia coli 1-176-05_S3_C1]
gb|EYE05004.1| hypothetical protein AD37_0658 [Escherichia coli 1-110-08_S4_C3]
gb|EYE06022.1| hypothetical protein AD08_0650 [Escherichia coli 1-110-08_S4_C2]
gb|EYE07400.1| hypothetical protein AC80_0814 [Escherichia coli 1-110-08_S4_C1]
gb|EYE14742.1| hypothetical protein AC55_0988 [Escherichia coli 1-110-08_S3_C3]
gb|EYE28100.1| hypothetical protein AB69_0656 [Escherichia coli 1-110-08_S1_C3]
gb|EYE28924.1| hypothetical protein AC25_0566 [Escherichia coli 1-110-08_S3_C2]
gb|EYE30019.1| hypothetical protein AB97_0785 [Escherichia coli 1-110-08_S3_C1]
gb|EYE39784.1| hypothetical protein AB10_0673 [Escherichia coli 1-110-08_S1_C1]
gb|EYE39910.1| hypothetical protein AB38_0649 [Escherichia coli 1-110-08_S1_C2]
gb|EYT11446.1| hypothetical protein T654_01455 [Escherichia coli K02]
gb|EYU77189.1| hypothetical protein BX62_09945 [Escherichia coli O121:H19 str.
2010C-4254]
gb|EYU77460.1| hypothetical protein BX60_11860 [Escherichia coli O111:NM str.
2010C-4221]
gb|EYU83943.1| hypothetical protein BX63_16820 [Escherichia coli O26:NM str.
2010C-4347]
gb|EYU91162.1| hypothetical protein BX59_17455 [Escherichia coli O111:NM str.
2010C-4086]
gb|EYU99200.1| hypothetical protein BX58_03660 [Escherichia coli O111:NM str.
2010C-3977]
gb|EYV00752.1| hypothetical protein BX54_10725 [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV11639.1| hypothetical protein BX52_02460 [Escherichia coli O121:H19 str.
2010C-3609]
gb|EYV14527.1| hypothetical protein BX51_13230 [Escherichia coli O145:NM str.
2010C-3526]
gb|EYV20513.1| hypothetical protein BX50_05355 [Escherichia coli O145:NM str.
2010C-3521]
gb|EYV26594.1| hypothetical protein BX48_25425 [Escherichia coli O145:NM str.
2010C-3517]
gb|EYV30067.1| hypothetical protein BX49_00455 [Escherichia coli O145:NM str.
2010C-3518]
gb|EYV32909.1| hypothetical protein BX47_04345 [Escherichia coli O145:NM str.
2010C-3516]
gb|EYV41018.1| hypothetical protein BX46_20400 [Escherichia coli O145:NM str.
2010C-3511]
gb|EYV42863.1| hypothetical protein BX45_06085 [Escherichia coli O145:NM str.
2010C-3510]
gb|EYV48140.1| hypothetical protein BX44_11085 [Escherichia coli O145:NM str.
2010C-3509]
gb|EYV49025.1| hypothetical protein BX42_26465 [Escherichia coli O145:NM str.
2010C-3507]
gb|EYV53283.1| hypothetical protein BX36_06400 [Escherichia coli O157:H7 str.
2009EL2109]
gb|EYV63252.1| hypothetical protein BX40_00360 [Escherichia coli O103:H11 str.
2010C-3214]
gb|EYV66189.1| hypothetical protein BX34_18270 [Escherichia coli O157:H7 str.
2009EL1705]
gb|EYV75845.1| hypothetical protein BX25_21160 [Escherichia coli O121:H19 str.
2009C-4659]
gb|EYV77378.1| hypothetical protein BX32_09760 [Escherichia coli O121:H19 str.
2009EL1412]
gb|EYV83907.1| hypothetical protein BY91_08400 [Escherichia coli O157:H7 str.
K5806]
gb|EYV89818.1| hypothetical protein BY42_16510 [Escherichia coli O6:H16 str.
99-3165]
gb|EYV91581.1| hypothetical protein BY51_06745 [Escherichia coli O157:H7 str.
F7350]
gb|EYV98533.1| hypothetical protein BY41_07515 [Escherichia coli O86:H34 str.
99-3124]
gb|EYW02719.1| hypothetical protein BY37_12890 [Escherichia coli O157:H7 str.
2011EL-2312]
gb|EYW10282.1| hypothetical protein BY34_20195 [Escherichia coli O157:H7 str.
2011EL-2288]
gb|EYW12534.1| hypothetical protein BY35_03780 [Escherichia coli O157:H7 str.
2011EL-2289]
gb|EYW19277.1| hypothetical protein BY33_08565 [Escherichia coli O157:H7 str.
2011EL-2287]
gb|EYW20282.1| hypothetical protein BY31_09130 [Escherichia coli O157:H7 str.
2011EL-2114]
gb|EYW23481.1| hypothetical protein BY32_15000 [Escherichia coli O157:H7 str.
2011EL-2286]
gb|EYW37901.1| hypothetical protein BY30_18635 [Escherichia coli O157:H7 str.
2011EL-2113]
gb|EYW39597.1| hypothetical protein BY29_16435 [Escherichia coli O157:H7 str.
2011EL-2112]
gb|EYW40889.1| hypothetical protein BY28_07915 [Escherichia coli O157:H7 str.
2011EL-2111]
gb|EYW47419.1| hypothetical protein BY27_10760 [Escherichia coli O157:H7 str.
2011EL-2109]
gb|EYW51096.1| hypothetical protein BY25_22030 [Escherichia coli O157:H7 str.
2011EL-2107]
gb|EYW52240.1| hypothetical protein BY26_04285 [Escherichia coli O157:H7 str.
2011EL-2108]
gb|EYW58188.1| hypothetical protein BY24_23230 [Escherichia coli O157:H7 str.
2011EL-2106]
gb|EYW62532.1| hypothetical protein BY23_17470 [Escherichia coli O157:H7 str.
2011EL-2105]
gb|EYW69781.1| hypothetical protein BY22_12670 [Escherichia coli O157:H7 str.
2011EL-2104]
gb|EYW74216.1| hypothetical protein BY21_17240 [Escherichia coli O157:H7 str.
2011EL-2103]
gb|EYW79825.1| hypothetical protein BY20_09070 [Escherichia coli O157:H7 str.
2011EL-2101]
gb|EYW82429.1| hypothetical protein BY19_18930 [Escherichia coli O157:H7 str.
2011EL-2099]
gb|EYW90983.1| hypothetical protein BX03_08030 [Escherichia coli O111:NM str.
08-4487]
gb|EYW91630.1| hypothetical protein BX02_25890 [Escherichia coli O145:NM str.
08-4270]
gb|EYW95289.1| hypothetical protein BX01_17690 [Escherichia coli O157:H7 str.
08-4169]
gb|EYX04604.1| hypothetical protein BX00_05870 [Escherichia coli O118:H16 str.
08-3651]
gb|EYX12561.1| hypothetical protein BW98_06630 [Escherichia coli O157:H7 str.
08-3037]
gb|EYX13512.1| hypothetical protein BW99_09145 [Escherichia coli O157:H7 str.
08-3527]
gb|EYX19705.1| hypothetical protein BW97_11115 [Escherichia coli O69:H11 str.
07-4281]
gb|EYX26299.1| hypothetical protein BY18_04510 [Escherichia coli O157:H7 str.
2011EL-2098]
gb|EYX29387.1| hypothetical protein BY17_02755 [Escherichia coli O157:H7 str.
2011EL-2097]
gb|EYX32090.1| hypothetical protein BY16_18775 [Escherichia coli O157:H7 str.
2011EL-2096]
gb|EYX37530.1| hypothetical protein BY14_23780 [Escherichia coli O157:H7 str.
2011EL-2093]
gb|EYX40067.1| hypothetical protein BY15_09120 [Escherichia coli O157:H7 str.
2011EL-2094]
gb|EYX47218.1| hypothetical protein BY13_16315 [Escherichia coli O157:H7 str.
2011EL-2092]
gb|EYX51702.1| hypothetical protein BY12_19940 [Escherichia coli O157:H7 str.
2011EL-2091]
gb|EYX59600.1| hypothetical protein BY11_04320 [Escherichia coli O157:H7 str.
2011EL-2090]
gb|EYX66654.1| hypothetical protein BY09_16685 [Escherichia coli O157:H7 str.
2011EL-1107]
gb|EYX68220.1| hypothetical protein BY10_10955 [Escherichia coli O104:H4 str.
2011EL-1675A]
gb|EYX76639.1| hypothetical protein BY07_02315 [Escherichia coli O111:NM str.
2011C-3679]
gb|EYX78096.1| hypothetical protein BY05_11485 [Escherichia coli O111:NM str.
2011C-3632]
gb|EYX84216.1| hypothetical protein BY04_05115 [Escherichia coli O156:H25 str.
2011C-3602]
gb|EYX93075.1| hypothetical protein BY03_12685 [Escherichia coli O111:NM str.
2011C-3573]
gb|EYX96841.1| hypothetical protein BY02_14890 [Escherichia coli O121:H19 str.
2011C-3537]
gb|EYY02120.1| hypothetical protein BY00_11890 [Escherichia coli O121:H19 str.
2011C-3500]
gb|EYY07857.1| hypothetical protein BX97_09605 [Escherichia coli O111:NM str.
2011C-3362]
gb|EYY11968.1| hypothetical protein BX93_22825 [Escherichia coli O111:NM str.
2011C-3170]
gb|EYY14140.1| hypothetical protein BX94_07280 [Escherichia coli O121:H19 str.
2011C-3216]
gb|EYY22286.1| hypothetical protein BX92_10190 [Escherichia coli O121:H19 str.
2011C-3108]
gb|EYY30375.1| hypothetical protein BX91_11215 [Escherichia coli O121:H19 str.
2011C-3072]
gb|EYY31186.1| hypothetical protein BX87_10225 [Escherichia coli O121:H19 str.
2010EL1058]
gb|EYY36249.1| hypothetical protein BX84_03160 [Escherichia coli O121:H19 str.
2010C-4989]
gb|EYY50906.1| hypothetical protein BX83_00265 [Escherichia coli O157:H7 str.
2010C-4979C1]
gb|EYY52009.1| hypothetical protein BX82_12285 [Escherichia coli O121:H19 str.
2010C-4966]
gb|EYY57351.1| hypothetical protein BX81_00255 [Escherichia coli O165:H25 str.
2010C-4874]
gb|EYY59601.1| hypothetical protein BX79_10675 [Escherichia coli O121:H19 str.
2010C-4824]
gb|EYY64836.1| hypothetical protein BX76_20825 [Escherichia coli O111:NM str.
2010C-4799]
gb|EYY67117.1| hypothetical protein BX77_06510 [Escherichia coli O111:NM str.
2010C-4818]
gb|EYY73993.1| hypothetical protein BX74_18555 [Escherichia coli O111:NM str.
2010C-4746]
gb|EYY76436.1| hypothetical protein BX75_22780 [Escherichia coli O26:NM str.
2010C-4788]
gb|EYY86528.1| hypothetical protein BX73_24670 [Escherichia coli O111:NM str.
2010C-4735]
gb|EYY87275.1| hypothetical protein BX72_22810 [Escherichia coli O121:H19 str.
2010C-4732]
gb|EYY97404.1| hypothetical protein BX71_22195 [Escherichia coli O111:NM str.
2010C-4715]
gb|EYY99127.1| hypothetical protein BX70_10140 [Escherichia coli O111:NM str.
2010C-4622]
gb|EYZ04277.1| hypothetical protein BX69_17810 [Escherichia coli O111:NM str.
2010C-4592]
gb|EYZ07100.1| hypothetical protein BX68_11315 [Escherichia coli O177:NM str.
2010C-4558]
gb|EYZ16205.1| hypothetical protein BX67_15775 [Escherichia coli O145:NM str.
2010C-4557C2]
gb|EYZ23046.1| hypothetical protein BX66_23785 [Escherichia coli O103:H25 str.
2010C-4529]
gb|EYZ29557.1| hypothetical protein BW96_13280 [Escherichia coli O157:H7 str.
07-3391]
gb|EYZ35798.1| hypothetical protein BW95_02885 [Escherichia coli O157:H7 str.
07-3091]
gb|EYZ39157.1| hypothetical protein BW94_06595 [Escherichia coli O157:H7 str.
06-4039]
gb|EYZ46159.1| hypothetical protein BW91_18990 [Escherichia coli O91:H14 str.
06-3691]
gb|EYZ50783.1| hypothetical protein BW93_00590 [Escherichia coli O121:H19 str.
06-3822]
gb|EYZ51802.1| hypothetical protein BW92_08700 [Escherichia coli O157:H7 str.
06-3745]
gb|EYZ57617.1| hypothetical protein BW88_08740 [Escherichia coli O79:H7 str.
06-3501]
gb|EYZ61896.1| hypothetical protein BW89_10390 [Escherichia coli O55:H7 str.
06-3555]
gb|EYZ67773.1| hypothetical protein BW90_09310 [Escherichia coli O118:H16 str.
06-3612]
gb|EYZ72004.1| hypothetical protein BW87_15065 [Escherichia coli O145:NM str.
06-3484]
gb|EYZ75141.1| hypothetical protein BW85_12095 [Escherichia coli O69:H11 str.
06-3325]
gb|EYZ87206.1| hypothetical protein BW82_05760 [Escherichia coli O111:NM str.
04-3211]
gb|EYZ89127.1| hypothetical protein BW83_07925 [Escherichia coli O121:H19 str.
06-3003]
gb|EYZ90594.1| hypothetical protein BW84_15385 [Escherichia coli O118:H16 str.
06-3256]
gb|EYZ96373.1| hypothetical protein BW79_08225 [Escherichia coli O119:H4 str.
03-3458]
gb|EYZ99764.1| hypothetical protein BW78_06005 [Escherichia coli O174:H21 str.
03-3269]
gb|EZA04700.1| hypothetical protein BW80_10895 [Escherichia coli O111:NM str.
03-3484]
gb|EZA09356.1| hypothetical protein BW77_12710 [Escherichia coli O121:H19 str.
03-3227]
gb|EZA11001.1| hypothetical protein BW76_10195 [Escherichia coli O28ac:NM str.
02-3404]
gb|EZA17334.1| hypothetical protein BW75_22420 [Escherichia coli O81:NM str.
02-3012]
gb|EZA23523.1| hypothetical protein BW71_08175 [Escherichia coli O113:H21 str.
07-4224]
gb|EZA37041.1| hypothetical protein BW70_03200 [Escherichia coli O174:H8 str.
04-3038]
gb|EZA41902.1| hypothetical protein BW69_08530 [Escherichia coli O103:H11 str.
04-3023]
gb|EZA43373.1| hypothetical protein BW68_08255 [Escherichia coli O26:H11 str.
05-3646]
gb|EZA64417.1| hypothetical protein BY39_05820 [Escherichia coli O104:H21 str.
94-3025]
gb|EZA70684.1| hypothetical protein BY40_10780 [Escherichia coli O157:H16 str.
98-3133]
gb|EZA73544.1| hypothetical protein BY44_19970 [Escherichia coli O6:H16 str.
F5656C1]
gb|EZA80692.1| hypothetical protein BY43_13825 [Escherichia coli O25:NM str.
E2539C1]
gb|EZA81318.1| hypothetical protein BY46_25115 [Escherichia coli O111:H8 str.
F6627]
gb|EZA86208.1| hypothetical protein BY45_09470 [Escherichia coli O157:H7 str.
F6142]
gb|EZA95636.1| hypothetical protein BY47_20960 [Escherichia coli O121:H19 str.
F6714]
gb|EZB03309.1| hypothetical protein BY48_05740 [Escherichia coli O157:H7 str.
F6749]
gb|EZB04588.1| hypothetical protein BY49_26445 [Escherichia coli O157:H7 str.
F6750]
gb|EZB08532.1| hypothetical protein BY50_13060 [Escherichia coli O157:H7 str.
F6751]
gb|EZB14100.1| hypothetical protein BY52_20680 [Escherichia coli O157:H7 str.
F7377]
gb|EZB16155.1| hypothetical protein BY53_07005 [Escherichia coli O157:H7 str.
F7384]
gb|EZB22861.1| hypothetical protein BY54_16915 [Escherichia coli O157:H7 str.
F7410]
gb|EZB27763.1| hypothetical protein BY55_01230 [Escherichia coli O169:H41 str.
F9792]
gb|EZB31502.1| hypothetical protein BY56_14970 [Escherichia coli O157:H7 str.
G5303]
gb|EZB35703.1| hypothetical protein BY57_23515 [Escherichia coli O157:H7 str.
H2495]
gb|EZB40524.1| hypothetical protein BY58_13855 [Escherichia coli O157:H7 str.
H2498]
gb|EZB43839.1| hypothetical protein BY59_11815 [Escherichia coli O157:H7 str.
K1420]
gb|EZB56932.1| hypothetical protein BY62_04285 [Escherichia coli O157:H7 str.
K1793]
gb|EZB60773.1| hypothetical protein BY61_25060 [Escherichia coli O157:H7 str.
K1792]
gb|EZB64104.1| hypothetical protein BY60_09350 [Escherichia coli O15:H18 str.
K1516]
gb|EZB68271.1| hypothetical protein BY65_21060 [Escherichia coli O157:H7 str.
K1845]
gb|EZB72698.1| hypothetical protein BY63_02195 [Escherichia coli O157:H7 str.
K1795]
gb|EZB76178.1| hypothetical protein BY64_00265 [Escherichia coli O157:H7 str.
K1796]
gb|EZB77810.1| hypothetical protein BY67_08015 [Escherichia coli O157:H7 str.
K1927]
gb|EZB86971.1| hypothetical protein BY66_10070 [Escherichia coli O157:H7 str.
K1921]
gb|EZB91530.1| hypothetical protein BY68_05795 [Escherichia coli O157:H7 str.
K2188]
gb|EZC01303.1| hypothetical protein BY69_00295 [Escherichia coli O157:H7 str.
K2191]
gb|EZC04873.1| hypothetical protein BY71_06325 [Escherichia coli O157:H7 str.
K2324]
gb|EZC07876.1| hypothetical protein BY70_10975 [Escherichia coli O157:H7 str.
K2192]
gb|EZC15166.1| hypothetical protein BY72_07570 [Escherichia coli O157:H7 str.
K2581]
gb|EZC16893.1| hypothetical protein BY73_08325 [Escherichia coli O157:H7 str.
K2622]
gb|EZC23356.1| hypothetical protein BY74_08135 [Escherichia coli O157:H7 str.
K2845]
gb|EZC30546.1| hypothetical protein BY75_08015 [Escherichia coli O157:H7 str.
K2854]
gb|EZC35352.1| hypothetical protein BY76_07650 [Escherichia coli O157:H7 str.
K4396]
gb|EZC38782.1| hypothetical protein BY77_05395 [Escherichia coli O157:H7 str.
K4405]
gb|EZC41541.1| hypothetical protein BY78_05915 [Escherichia coli O157:H7 str.
K4406]
gb|EZC46116.1| hypothetical protein BY79_05420 [Escherichia coli O157:H7 str.
K4527]
gb|EZC54946.1| hypothetical protein BY80_07445 [Escherichia coli O121:H19 str.
K5198]
gb|EZC57667.1| hypothetical protein BY82_04565 [Escherichia coli O157:H7 str.
K5418]
gb|EZC58312.1| hypothetical protein BY81_06490 [Escherichia coli O121:H19 str.
K5269]
gb|EZC67260.1| hypothetical protein BY83_08935 [Escherichia coli O157:H7 str.
K5448]
gb|EZC71962.1| hypothetical protein BY85_05300 [Escherichia coli O157:H7 str.
K5453]
gb|EZC73116.1| hypothetical protein BY84_06190 [Escherichia coli O157:H7 str.
K5449]
gb|EZC80692.1| hypothetical protein BY86_05610 [Escherichia coli O157:H7 str.
K5460]
gb|EZC88459.1| hypothetical protein BY87_02930 [Escherichia coli O157:H7 str.
K5467]
gb|EZC92142.1| hypothetical protein BY88_11610 [Escherichia coli O157:H7 str.
K5602]
gb|EZC94421.1| hypothetical protein BY90_21440 [Escherichia coli O157:H7 str.
K5609]
gb|EZC95599.1| hypothetical protein BY89_02380 [Escherichia coli O157:H7 str.
K5607]
gb|EZD05267.1| hypothetical protein BY92_03810 [Escherichia coli O157:H7 str.
K5852]
gb|EZD06324.1| hypothetical protein BY93_27200 [Escherichia coli O157:H7 str.
K6590]
gb|EZD11651.1| hypothetical protein BY94_12900 [Escherichia coli O157:H7 str.
K6676]
gb|EZD18271.1| hypothetical protein BY95_05560 [Escherichia coli O157:H7 str.
K6687]
gb|EZD21001.1| hypothetical protein BY97_24970 [Escherichia coli O111:NM str.
K6723]
gb|EZD23889.1| hypothetical protein BY96_24120 [Escherichia coli O111:NM str.
K6722]
gb|EZD29414.1| hypothetical protein BY98_09165 [Escherichia coli O111:NM str.
K6728]
gb|EZD42998.1| hypothetical protein BY99_27790 [Escherichia coli O111:NM str.
K6890]
gb|EZD47667.1| hypothetical protein BZ00_00170 [Escherichia coli O111:NM str.
K6895]
gb|EZD54124.1| hypothetical protein BZ01_02945 [Escherichia coli O111:NM str.
K6897]
gb|EZD55275.1| hypothetical protein BZ02_11080 [Escherichia coli O111:NM str.
K6898]
gb|EZD61523.1| hypothetical protein BZ03_09550 [Escherichia coli O111:NM str.
K6904]
gb|EZD68236.1| hypothetical protein BZ05_15745 [Escherichia coli O111:NM str.
K6915]
gb|EZD68744.1| hypothetical protein BZ04_23330 [Escherichia coli O111:NM str.
K6908]
gb|EZD74706.1| hypothetical protein BZ06_11155 [Escherichia coli O157:H7 str.
K7140]
gb|EZD81327.1| hypothetical protein P411_18960 [Escherichia coli O39:NM str.
F8704-2]
gb|EZD85034.1| hypothetical protein BX04_01400 [Escherichia coli O157:H7 str.
08-4529]
gb|EZD91210.1| hypothetical protein BX05_00620 [Escherichia coli O157:NM str.
08-4540]
gb|EZD93884.1| hypothetical protein BX07_11935 [Escherichia coli O91:H14 str.
2009C-3227]
gb|EZD98934.1| hypothetical protein BX09_17195 [Escherichia coli O145:H28 str.
2009C-3292]
gb|EZE05479.1| hypothetical protein BX06_20490 [Escherichia coli O69:H11 str.
08-4661]
gb|EZE09593.1| hypothetical protein BX10_11585 [Escherichia coli O121:H7 str.
2009C-3299]
gb|EZE25487.1| hypothetical protein BX11_23810 [Escherichia coli O123:H11 str.
2009C-3307]
gb|EZE29486.1| hypothetical protein BX16_04145 [Escherichia coli O91:NM str.
2009C-3745]
gb|EZE30625.1| hypothetical protein BX12_02890 [Escherichia coli O69:H11 str.
2009C-3601]
gb|EZE38544.1| hypothetical protein BX18_20240 [Escherichia coli O111:NM str.
2009C-4006]
gb|EZE41070.1| hypothetical protein BX19_19705 [Escherichia coli O121:H19 str.
2009C-4050]
gb|EZE48667.1| hypothetical protein BX23_04675 [Escherichia coli O118:H16 str.
2009C-4446]
gb|EZE50400.1| hypothetical protein BX20_12380 [Escherichia coli O111:NM str.
2009C-4052]
gb|EZE58825.1| hypothetical protein BX22_13540 [Escherichia coli O157:H7 str.
2009C-4258]
gb|EZE65997.1| hypothetical protein BX24_08065 [Escherichia coli O91:H21 str.
2009C-4646]
gb|EZE72447.1| hypothetical protein BX27_15450 [Escherichia coli O121:H19 str.
2009C-4750]
gb|EZE73591.1| hypothetical protein BX33_13510 [Escherichia coli O157:H7 str.
2009EL1449]
gb|EZE82766.1| hypothetical protein BX31_13685 [Escherichia coli O121:H19 str.
2009EL1302]
gb|EZE83335.1| hypothetical protein BX35_09935 [Escherichia coli O157:H7 str.
2009EL1913]
gb|EZE93593.1| hypothetical protein BX43_13455 [Escherichia coli O145:NM str.
2010C-3508]
gb|EZE96169.1| hypothetical protein BX53_18000 [Escherichia coli O121:H19 str.
2010C-3794]
gb|EZF02452.1| hypothetical protein BY38_21945 [Escherichia coli O157:H7 str.
2011EL-2313]
gb|EZF07513.1| hypothetical protein BY36_02345 [Escherichia coli O157:H7 str.
2011EL-2290]
gb|EZG31283.1| hypothetical protein AU10_14555 [Escherichia coli E1728]
gb|EZG50816.1| hypothetical protein BW81_14475 [Escherichia coli O26:H11 str.
03-3500]
gb|EZG52173.1| hypothetical protein BW86_05565 [Escherichia coli O26:H11 str.
06-3464]
gb|EZG58186.1| hypothetical protein BX78_01340 [Escherichia coli O26:H11 str.
2010C-4819]
gb|EZG60787.1| hypothetical protein BX64_11195 [Escherichia coli O26:H11 str.
2010C-4430]
gb|EZG74148.1| hypothetical protein BX80_07450 [Escherichia coli O26:H11 str.
2010C-4834]
gb|EZG74268.1| hypothetical protein BX85_20115 [Escherichia coli O26:H11 str.
2010C-5028]
gb|EZG84245.1| hypothetical protein BX95_23380 [Escherichia coli O26:H11 str.
2011C-3270]
gb|EZG84399.1| hypothetical protein BX88_08805 [Escherichia coli O26:H11 str.
2010EL-1699]
gb|EZG96746.1| hypothetical protein BX98_10185 [Escherichia coli O26:H11 str.
2011C-3387]
gb|EZH03616.1| hypothetical protein BY01_25830 [Escherichia coli O26:H11 str.
2011C-3506]
gb|EZH04254.1| hypothetical protein BX96_11720 [Escherichia coli O26:H11 str.
2011C-3282]
gb|EZH08697.1| hypothetical protein BX15_21545 [Escherichia coli O26:H11 str.
2009C-3689]
gb|EZH10287.1| hypothetical protein BX13_22585 [Escherichia coli O26:H11 str.
2009C-3612]
gb|EZH15760.1| hypothetical protein BY06_26285 [Escherichia coli O26:H11 str.
2011C-3655]
gb|EZH24515.1| hypothetical protein BX30_00765 [Escherichia coli O26:H11 str.
2009C-4826]
gb|EZH24855.1| hypothetical protein BX17_17490 [Escherichia coli O26:H11 str.
2009C-3996]
gb|EZH27634.1| hypothetical protein BX28_18240 [Escherichia coli O26:H11 str.
2009C-4760]
gb|EZH38241.1| hypothetical protein BX38_17480 [Escherichia coli O26:H11 str.
2010C-3051]
gb|EZH43083.1| hypothetical protein BX41_20085 [Escherichia coli O26:H11 str.
2010C-3472]
gb|EZH43210.1| hypothetical protein BX55_25485 [Escherichia coli O26:H11 str.
2010C-3871]
gb|EZH55392.1| hypothetical protein BX57_09530 [Escherichia coli O26:H11 str.
2010C-3902]
gb|EZH55965.1| hypothetical protein BX61_19820 [Escherichia coli O26:H11 str.
2010C-4244]
gb|EZJ24544.1| hypothetical protein AD39_0623 [Escherichia coli 1-182-04_S4_C3]
gb|EZJ28934.1| hypothetical protein AD38_0641 [Escherichia coli 1-176-05_S4_C3]
gb|EZJ31323.1| hypothetical protein AD12_0765 [Escherichia coli 1-392-07_S4_C2]
gb|EZJ44287.1| hypothetical protein AD11_0676 [Escherichia coli 1-250-04_S4_C2]
gb|EZJ45982.1| hypothetical protein AD23_0684 [Escherichia coli 2-005-03_S4_C3]
gb|EZJ46578.1| hypothetical protein AD10_0659 [Escherichia coli 1-182-04_S4_C2]
gb|EZJ54633.1| hypothetical protein AC93_0675 [Escherichia coli 2-005-03_S4_C2]
gb|EZJ57187.1| hypothetical protein AC83_0684 [Escherichia coli 1-250-04_S4_C1]
gb|EZJ63187.1| hypothetical protein AC82_0650 [Escherichia coli 1-182-04_S4_C1]
gb|EZJ74069.1| hypothetical protein AC81_0692 [Escherichia coli 1-176-05_S4_C1]
gb|EZJ76754.1| hypothetical protein AC57_0600 [Escherichia coli 1-392-07_S3_C3]
gb|EZJ78940.1| hypothetical protein AC56_0648 [Escherichia coli 1-182-04_S3_C3]
gb|EZJ89472.1| hypothetical protein AC00_0685 [Escherichia coli 1-250-04_S3_C1]
gb|EZJ90136.1| hypothetical protein AC27_0372 [Escherichia coli 1-182-04_S3_C2]
gb|EZJ98873.1| hypothetical protein AB71_0866 [Escherichia coli 1-182-04_S1_C3]
gb|EZK01602.1| hypothetical protein AB72_0737 [Escherichia coli 1-250-04_S1_C3]
gb|EZK03520.1| hypothetical protein AB99_0711 [Escherichia coli 1-182-04_S3_C1]
gb|EZK09937.1| hypothetical protein AB70_0736 [Escherichia coli 1-176-05_S1_C3]
gb|EZK18363.1| hypothetical protein AB53_0677 [Escherichia coli 2-005-03_S1_C3]
gb|EZK23887.1| hypothetical protein AB39_0618 [Escherichia coli 1-176-05_S1_C2]
gb|EZK25397.1| hypothetical protein AB26_0704 [Escherichia coli 2-011-08_S1_C2]
gb|EZK32993.1| hypothetical protein AB12_0649 [Escherichia coli 1-182-04_S1_C1]
gb|EZK36249.1| hypothetical protein AB25_0685 [Escherichia coli 2-005-03_S1_C2]
gb|EZK52905.1| hypothetical protein AA97_0690 [Escherichia coli 2-005-03_S1_C1]
gb|EZQ28741.1| hypothetical protein BX39_04020 [Escherichia coli O111:NM str.
2010C-3053]
gb|EZQ29782.1| hypothetical protein BX37_03535 [Escherichia coli O111:H8 str.
2009EL-2169]
gb|EZQ35273.1| hypothetical protein BX26_25110 [Escherichia coli O26:H1 str.
2009C-4747]
gb|EZQ37837.1| hypothetical protein BX21_18925 [Escherichia coli O111:H8 str.
2009C-4126]
gb|EZQ38597.1| hypothetical protein BX90_20195 [Escherichia coli O157: str.
2010EL-2045]
gb|EZQ43103.1| hypothetical protein BX99_13225 [Escherichia coli O111:H8 str.
2011C-3453]
gb|EZQ54196.1| hypothetical protein BX89_07725 [Escherichia coli O157: str.
2010EL-2044]
gb|EZQ62217.1| hypothetical protein AF56_00945 [Escherichia coli BIDMC 83]
gb|EZQ67803.1| hypothetical protein AF55_02654 [Escherichia coli BIDMC 82]
gb|AHY63640.1| ybeL [Escherichia coli O145:H28 str. RM12761]
gb|AHY69193.1| ybeL [Escherichia coli O145:H28 str. RM12581]
gb|KCW95576.1| hypothetical protein DP79_11125 [Escherichia coli]
gb|KDA65486.1| hypothetical protein AA99_0664 [Escherichia coli 2-052-05_S1_C1]
gb|KDA70154.1| hypothetical protein AB40_0637 [Escherichia coli 1-182-04_S1_C2]
gb|KDA74920.1| hypothetical protein AC12_0734 [Escherichia coli 2-005-03_S3_C2]
gb|KDA81046.1| hypothetical protein AC13_0597 [Escherichia coli 2-011-08_S3_C2]
gb|KDA86193.1| hypothetical protein AC41_0706 [Escherichia coli 2-011-08_S3_C3]
gb|KDA91300.1| hypothetical protein AD09_0600 [Escherichia coli 1-176-05_S4_C2]
emb|CDP72396.1| Putative alpha helical protein [Escherichia coli]
emb|CDP67228.1| Putative alpha helical protein [Escherichia coli D6-113.11]
emb|CDP76257.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
gb|KDF71097.1| hypothetical protein AE34_01169 [Escherichia coli BIDMC 59]
gb|KDF78557.1| hypothetical protein AE33_00630 [Escherichia coli BIDMC 58]
gb|KDF82393.1| hypothetical protein AE37_03587 [Escherichia coli BIDMC 62]
gb|KDF83034.1| hypothetical protein AE38_03291 [Escherichia coli BIDMC 63]
gb|KDF92968.1| hypothetical protein AE39_00411 [Escherichia coli BIDMC 64]
gb|KDG00999.1| hypothetical protein AE45_00410 [Escherichia coli BIDMC 70]
gb|KDG07416.1| hypothetical protein AE40_00586 [Escherichia coli BIDMC 65]
gb|KDG08837.1| hypothetical protein AE46_00452 [Escherichia coli BIDMC 71]
gb|KDG11461.1| hypothetical protein AE47_02758 [Escherichia coli BIDMC 72]
gb|KDG11955.1| hypothetical protein AE48_03836 [Escherichia coli BIDMC 73]
gb|KDG15521.1| hypothetical protein AE49_04201 [Escherichia coli BIDMC 74]
gb|KDG31189.1| hypothetical protein AE51_00412 [Escherichia coli BIDMC 76]
gb|KDG32761.1| hypothetical protein AE50_00410 [Escherichia coli BIDMC 75]
gb|KDG35663.1| hypothetical protein AE53_03311 [Escherichia coli BIDMC 78]
gb|KDG37156.1| hypothetical protein AE52_02501 [Escherichia coli BIDMC 77]
gb|KDG46391.1| hypothetical protein AE54_00626 [Escherichia coli BIDMC 79]
gb|KDG52820.1| hypothetical protein AF25_03425 [Escherichia coli CHS 69]
gb|KDG53630.1| hypothetical protein AF24_00631 [Escherichia coli CHS 68]
gb|KDG60129.1| hypothetical protein AF33_00618 [Escherichia coli CHS 77]
gb|KDG65601.1| hypothetical protein AF44_04304 [Escherichia coli MGH 58]
gb|KDG67652.1| hypothetical protein AF43_00643 [Escherichia coli MGH 57]
gb|KDG76012.1| hypothetical protein AE10_00631 [Escherichia coli UCI 51]
gb|KDG81257.1| hypothetical protein AE12_00370 [Escherichia coli UCI 53]
gb|KDG88352.1| hypothetical protein AE16_00443 [Escherichia coli UCI 57]
gb|KDG91891.1| hypothetical protein AE17_00430 [Escherichia coli UCI 58]
gb|KDH01675.1| hypothetical protein AE24_00621 [Escherichia coli UCI 65]
gb|KDH01849.1| hypothetical protein AE25_00681 [Escherichia coli UCI 66]
gb|KDM71150.1| hypothetical protein DA88_21000 [Escherichia coli]
gb|KDM73707.1| hypothetical protein DC23_19325 [Escherichia coli O145:H28 str.
4865/96]
gb|KDM81270.1| hypothetical protein DC24_08535 [Escherichia coli]
gb|KDN07566.1| hypothetical protein DH22_1832 [Escherichia coli]
emb|CDN81015.1| hypothetical protein EC958_0762 [Escherichia coli O25b:H4-ST131]
gb|KDO91671.1| hypothetical protein DO98_06415 [Escherichia coli]
gb|KDP17206.1| hypothetical protein EP08_28515 [Escherichia coli]
gb|KDT03370.1| hypothetical protein AB83_0733 [Escherichia coli 2-011-08_S3_C1]
gb|KDT05587.1| hypothetical protein AB54_0638 [Escherichia coli 2-011-08_S1_C3]
gb|KDT08908.1| hypothetical protein AC66_0668 [Escherichia coli 2-011-08_S4_C1]
gb|KDT16755.1| hypothetical protein AB55_0710 [Escherichia coli 2-052-05_S1_C3]
gb|KDT22522.1| hypothetical protein AB84_0664 [Escherichia coli 2-052-05_S3_C1]
gb|KDT23918.1| hypothetical protein AD24_0666 [Escherichia coli 2-011-08_S4_C3]
gb|KDT29696.1| hypothetical protein AC67_0668 [Escherichia coli 2-052-05_S4_C1]
gb|KDT33806.1| hypothetical protein AB17_2477 [Escherichia coli 3-105-05_S1_C1]
gb|KDT36505.1| hypothetical protein AC04_2985 [Escherichia coli 3-105-05_S3_C1]
gb|KDT44966.1| hypothetical protein AD15_1629 [Escherichia coli 3-105-05_S4_C2]
gb|KDT48537.1| hypothetical protein AC32_3040 [Escherichia coli 3-105-05_S3_C2]
gb|KDT53151.1| hypothetical protein AD43_3501 [Escherichia coli 3-105-05_S4_C3]
gb|KDT60352.1| hypothetical protein AC05_3894 [Escherichia coli 3-267-03_S3_C1]
gb|KDT63650.1| hypothetical protein AB76_1321 [Escherichia coli 3-267-03_S1_C3]
gb|KDT69053.1| hypothetical protein AC06_2659 [Escherichia coli 3-373-03_S3_C1]
gb|KDT72777.1| hypothetical protein AC59_3804 [Escherichia coli 3-373-03_S3_C3]
gb|KDT77441.1| hypothetical protein AB47_4279 [Escherichia coli 3-373-03_S1_C2]
gb|KDT83937.1| hypothetical protein AC90_3705 [Escherichia coli 3-475-03_S4_C1]
gb|KDT89394.1| hypothetical protein AB20_1983 [Escherichia coli 3-475-03_S1_C1]
gb|KDT92403.1| hypothetical protein AC87_3624 [Escherichia coli 3-105-05_S4_C1]
gb|KDT97203.1| hypothetical protein AC33_3586 [Escherichia coli 3-267-03_S3_C2]
gb|KDU00338.1| hypothetical protein AB46_4197 [Escherichia coli 3-267-03_S1_C2]
gb|KDU08929.1| hypothetical protein AC34_3833 [Escherichia coli 3-373-03_S3_C2]
gb|KDU19710.1| hypothetical protein AB18_1958 [Escherichia coli 3-267-03_S1_C1]
gb|KDU25057.1| hypothetical protein AD16_2542 [Escherichia coli 3-267-03_S4_C2]
gb|KDU29335.1| hypothetical protein AD17_3474 [Escherichia coli 3-373-03_S4_C2]
gb|KDU35533.1| hypothetical protein AB77_4170 [Escherichia coli 3-373-03_S1_C3]
gb|KDU37466.1| hypothetical protein AC86_2673 [Escherichia coli 3-073-06_S4_C1]
gb|KDU38318.1| hypothetical protein AC86_2127 [Escherichia coli 3-073-06_S4_C1]
gb|KDU43850.1| hypothetical protein AB19_4336 [Escherichia coli 3-373-03_S1_C1]
gb|KDU51743.1| hypothetical protein AC89_3144 [Escherichia coli 3-373-03_S4_C1]
gb|KDU56574.1| hypothetical protein AD18_2698 [Escherichia coli 3-475-03_S4_C2]
gb|KDU60993.1| hypothetical protein AB21_3621 [Escherichia coli 4-203-08_S1_C1]
gb|KDU66911.1| hypothetical protein AD45_2401 [Escherichia coli 4-203-08_S4_C3]
gb|KDV14051.1| hypothetical protein BW73_30830 [Escherichia coli O111:NM str.
01-3076]
gb|KDV14944.1| hypothetical protein BW72_23710 [Escherichia coli O78:H12 str.
00-3279]
gb|KDV35248.1| hypothetical protein BU59_36525 [Escherichia coli O69:H11 str.
07-3763]
gb|KDV35782.1| hypothetical protein BU56_02680 [Escherichia coli O145:H25 str.
07-3858]
gb|KDV39048.1| hypothetical protein BU55_07455 [Escherichia coli O146:H21 str.
2010C-3325]
gb|KDV46905.1| hypothetical protein BU53_20835 [Escherichia coli O91:H21 str.
2009C-3740]
gb|KDV56426.1| hypothetical protein BU57_02770 [Escherichia coli O121:H19 str.
2011C-3609]
gb|KDV61295.1| hypothetical protein BU64_00390 [Escherichia coli O128:H2 str.
2011C-3317]
gb|KDV72376.1| hypothetical protein BU63_07160 [Escherichia coli O118:H16 str.
07-4255]
gb|KDV75709.1| hypothetical protein BU58_31130 [Escherichia coli O26:H11 str.
2011C-3274]
gb|KDV87956.1| hypothetical protein AC42_0651 [Escherichia coli 2-052-05_S3_C3]
gb|KDV88517.1| hypothetical protein AC95_0484 [Escherichia coli 2-052-05_S4_C2]
gb|KDV91852.1| hypothetical protein AD25_0663 [Escherichia coli 2-052-05_S4_C3]
gb|KDW05594.1| hypothetical protein AB85_0709 [Escherichia coli 2-156-04_S3_C1]
gb|KDW11473.1| hypothetical protein AC43_0519 [Escherichia coli 2-156-04_S3_C3]
gb|KDW21514.1| hypothetical protein AB86_0672 [Escherichia coli 2-177-06_S3_C1]
gb|KDW25014.1| hypothetical protein AB01_0718 [Escherichia coli 2-177-06_S1_C1]
gb|KDW26148.1| hypothetical protein AC68_0560 [Escherichia coli 2-156-04_S4_C1]
gb|KDW34041.1| hypothetical protein AC15_0721 [Escherichia coli 2-156-04_S3_C2]
gb|KDW36837.1| hypothetical protein AB29_0659 [Escherichia coli 2-177-06_S1_C2]
gb|KDW43888.1| hypothetical protein AC97_2715 [Escherichia coli 2-177-06_S4_C2]
gb|KDW44345.1| hypothetical protein AB61_0726 [Escherichia coli 2-177-06_S1_C3]
gb|KDW49634.1| hypothetical protein AB62_3703 [Escherichia coli 2-210-07_S1_C3]
gb|KDW56500.1| hypothetical protein AB82_3289 [Escherichia coli 2-005-03_S3_C1]
gb|KDW60442.1| hypothetical protein AC29_2128 [Escherichia coli 1-392-07_S3_C2]
gb|KDW65435.1| hypothetical protein AC40_3282 [Escherichia coli 2-005-03_S3_C3]
gb|KDW72358.1| hypothetical protein AB14_3422 [Escherichia coli 1-392-07_S1_C1]
gb|KDW77517.1| hypothetical protein AC65_2455 [Escherichia coli 2-005-03_S4_C1]
gb|KDW81752.1| hypothetical protein AB42_3413 [Escherichia coli 1-392-07_S1_C2]
gb|KDW87165.1| hypothetical protein AC70_3173 [Escherichia coli 2-210-07_S4_C1]
gb|KDW93136.1| hypothetical protein AB30_2235 [Escherichia coli 2-210-07_S1_C2]
gb|KDW97311.1| hypothetical protein AC17_3694 [Escherichia coli 2-210-07_S3_C2]
gb|KDX04208.1| hypothetical protein AC01_1835 [Escherichia coli 1-392-07_S3_C1]
gb|KDX07920.1| hypothetical protein AD27_3292 [Escherichia coli 2-177-06_S4_C3]
gb|KDX20433.1| hypothetical protein AC45_1953 [Escherichia coli 2-210-07_S3_C3]
gb|KDX27607.1| hypothetical protein AB13_3853 [Escherichia coli 1-250-04_S1_C1]
gb|KDX30230.1| hypothetical protein AB41_2372 [Escherichia coli 1-250-04_S1_C2]
gb|KDX44573.1| hypothetical protein AD26_0651 [Escherichia coli 2-156-04_S4_C3]
gb|KDX44636.1| hypothetical protein AC16_2947 [Escherichia coli 2-177-06_S3_C2]
gb|KDX52553.1| hypothetical protein AC69_0563 [Escherichia coli 2-177-06_S4_C1]
gb|KDX55008.1| hypothetical protein AB87_3067 [Escherichia coli 2-210-07_S3_C1]
gb|KDX60476.1| hypothetical protein AC98_2475 [Escherichia coli 2-210-07_S4_C2]
gb|KDX65717.1| hypothetical protein AB02_3641 [Escherichia coli 2-222-05_S1_C1]
gb|KDX69042.1| hypothetical protein AD28_1960 [Escherichia coli 2-210-07_S4_C3]
gb|KDX74146.1| hypothetical protein AB31_3291 [Escherichia coli 2-222-05_S1_C2]
gb|KDX82535.1| hypothetical protein AB63_0393 [Escherichia coli 2-222-05_S1_C3]
gb|KDX86116.1| hypothetical protein AC46_2853 [Escherichia coli 2-222-05_S3_C3]
gb|KDX87804.1| hypothetical protein AC99_3736 [Escherichia coli 2-222-05_S4_C2]
gb|KDX92138.1| hypothetical protein AB89_4035 [Escherichia coli 2-316-03_S3_C1]
gb|KDY00123.1| hypothetical protein AC19_3068 [Escherichia coli 2-316-03_S3_C2]
gb|KDY04884.1| hypothetical protein AC47_2847 [Escherichia coli 2-316-03_S3_C3]
gb|KDY09578.1| hypothetical protein AC72_3335 [Escherichia coli 2-316-03_S4_C1]
gb|KDY15026.1| hypothetical protein AD00_4116 [Escherichia coli 2-316-03_S4_C2]
gb|KDY16443.1| hypothetical protein AD30_3865 [Escherichia coli 2-316-03_S4_C3]
gb|KDY25398.1| hypothetical protein AB33_2970 [Escherichia coli 2-427-07_S1_C2]
gb|KDY31391.1| hypothetical protein AB90_3798 [Escherichia coli 2-427-07_S3_C1]
gb|KDY32220.1| hypothetical protein AC48_2749 [Escherichia coli 2-427-07_S3_C3]
gb|KDY41667.1| hypothetical protein AC73_3442 [Escherichia coli 2-427-07_S4_C1]
gb|KDY42860.1| hypothetical protein AD01_3589 [Escherichia coli 2-427-07_S4_C2]
gb|KDY52016.1| hypothetical protein AB91_3079 [Escherichia coli 2-460-02_S3_C1]
gb|KDY60250.1| hypothetical protein AC20_2795 [Escherichia coli 2-460-02_S3_C2]
gb|KDY62768.1| hypothetical protein AC49_2618 [Escherichia coli 2-460-02_S3_C3]
gb|KDY68930.1| hypothetical protein AD02_2813 [Escherichia coli 2-460-02_S4_C2]
gb|KDY74289.1| hypothetical protein AD32_3440 [Escherichia coli 2-460-02_S4_C3]
gb|KDY79473.1| hypothetical protein AB06_3126 [Escherichia coli 2-474-04_S1_C1]
gb|KDY88955.1| hypothetical protein AB92_1947 [Escherichia coli 2-474-04_S3_C1]
gb|KDY89742.1| hypothetical protein AB64_3644 [Escherichia coli 2-427-07_S1_C3]
gb|KDY97023.1| hypothetical protein AC21_2058 [Escherichia coli 2-474-04_S3_C2]
gb|KDZ01189.1| hypothetical protein AB35_3325 [Escherichia coli 2-474-04_S1_C2]
gb|KDZ05811.1| hypothetical protein AD03_3317 [Escherichia coli 2-474-04_S4_C2]
gb|KDZ12383.1| hypothetical protein AD33_2781 [Escherichia coli 2-474-04_S4_C3]
gb|KDZ17379.1| hypothetical protein AC50_2308 [Escherichia coli 2-474-04_S3_C3]
gb|KDZ37257.1| hypothetical protein AC02_3388 [Escherichia coli 3-020-07_S3_C1]
gb|KDZ43290.1| hypothetical protein AD13_2374 [Escherichia coli 3-020-07_S4_C2]
gb|KDZ48861.1| hypothetical protein AD41_3466 [Escherichia coli 3-020-07_S4_C3]
gb|KDZ54180.1| hypothetical protein AB16_1065 [Escherichia coli 3-073-06_S1_C1]
gb|KDZ57654.1| hypothetical protein AB44_4457 [Escherichia coli 3-073-06_S1_C2]
gb|KDZ67028.1| hypothetical protein AC31_2355 [Escherichia coli 3-073-06_S3_C2]
gb|KDZ67518.1| hypothetical protein AC03_1916 [Escherichia coli 3-073-06_S3_C1]
gb|KDZ73038.1| hypothetical protein AD14_3965 [Escherichia coli 3-073-06_S4_C2]
gb|KDZ78742.1| hypothetical protein AB45_4317 [Escherichia coli 3-105-05_S1_C2]
gb|KDZ84894.1| hypothetical protein AD42_1500 [Escherichia coli 3-073-06_S4_C3]
gb|KDZ90263.1| hypothetical protein AB75_2584 [Escherichia coli 3-105-05_S1_C3]
gb|KDZ94007.1| hypothetical protein AB04_3311 [Escherichia coli 2-427-07_S1_C1]
gb|KEJ15007.1| hypothetical protein AD07_0779 [Escherichia coli 8-415-05_S4_C2]
gb|KEJ16369.1| hypothetical protein AC79_0669 [Escherichia coli 8-415-05_S4_C1]
gb|KEJ18297.1| hypothetical protein AB50_0791 [Escherichia coli 6-175-07_S1_C2]
gb|KEJ32173.1| hypothetical protein AB03_0756 [Escherichia coli 2-316-03_S1_C1]
gb|KEJ32635.1| hypothetical protein AB32_0733 [Escherichia coli 2-316-03_S1_C2]
gb|KEJ34690.1| hypothetical protein AD36_0782 [Escherichia coli 8-415-05_S4_C3]
gb|KEJ41810.1| hypothetical protein AB65_0849 [Escherichia coli 2-460-02_S1_C3]
gb|KEJ51415.1| hypothetical protein AD31_0750 [Escherichia coli 2-427-07_S4_C3]
gb|KEJ53434.1| hypothetical protein AC74_0672 [Escherichia coli 2-460-02_S4_C1]
gb|KEJ61909.1| hypothetical protein AC85_0903 [Escherichia coli 3-020-07_S4_C1]
gb|KEJ65161.1| hypothetical protein AC88_0746 [Escherichia coli 3-267-03_S4_C1]
gb|KEJ70657.1| hypothetical protein AC30_0668 [Escherichia coli 3-020-07_S3_C2]
gb|KEJ80010.1| hypothetical protein AB67_0731 [Escherichia coli 5-366-08_S1_C3]
gb|KEJ81182.1| hypothetical protein AC37_0739 [Escherichia coli 6-175-07_S3_C2]
gb|KEK77255.1| hypothetical protein AC07_2578 [Escherichia coli 3-475-03_S3_C1]
gb|KEK81355.1| hypothetical protein AB48_3368 [Escherichia coli 3-475-03_S1_C2]
gb|KEK87295.1| hypothetical protein AC35_2489 [Escherichia coli 3-475-03_S3_C2]
gb|KEK92547.1| hypothetical protein AB49_3521 [Escherichia coli 4-203-08_S1_C2]
gb|KEK98093.1| hypothetical protein AB78_3308 [Escherichia coli 4-203-08_S1_C3]
gb|KEK99505.1| hypothetical protein AC61_3111 [Escherichia coli 4-203-08_S3_C3]
gb|KEL09766.1| hypothetical protein AD19_2311 [Escherichia coli 4-203-08_S4_C2]
gb|KEL12869.1| hypothetical protein AC36_2245 [Escherichia coli 4-203-08_S3_C2]
gb|KEL16918.1| hypothetical protein AC08_2949 [Escherichia coli 4-203-08_S3_C1]
gb|KEL23237.1| hypothetical protein AD44_3447 [Escherichia coli 3-373-03_S4_C3]
gb|KEL24247.1| hypothetical protein AD04_3955 [Escherichia coli 5-172-05_S4_C2]
gb|KEL33793.1| hypothetical protein AD05_2043 [Escherichia coli 5-366-08_S4_C2]
gb|KEL37160.1| hypothetical protein AC76_3948 [Escherichia coli 5-172-05_S4_C1]
gb|KEL41999.1| hypothetical protein AC51_4203 [Escherichia coli 5-172-05_S3_C3]
gb|KEL53443.1| hypothetical protein AB22_0024 [Escherichia coli 6-175-07_S1_C1]
gb|KEL54319.1| hypothetical protein AB93_2102 [Escherichia coli 5-172-05_S3_C1]
gb|KEL63357.1| hypothetical protein AD34_0972 [Escherichia coli 5-172-05_S4_C3]
gb|KEL69213.1| hypothetical protein AB08_2482 [Escherichia coli 5-366-08_S1_C1]
gb|KEL75313.1| hypothetical protein AC52_1431 [Escherichia coli 5-366-08_S3_C3]
gb|KEL84645.1| hypothetical protein AC22_2573 [Escherichia coli 5-366-08_S3_C2]
gb|KEL93789.1| hypothetical protein AB94_1487 [Escherichia coli 5-366-08_S3_C1]
gb|KEL98326.1| hypothetical protein AC09_0622 [Escherichia coli 6-175-07_S3_C1]
gb|KEM06000.1| hypothetical protein AC62_0601 [Escherichia coli 6-175-07_S3_C3]
gb|KEM11602.1| hypothetical protein AD20_0584 [Escherichia coli 6-175-07_S4_C2]
gb|KEM13339.1| hypothetical protein AC91_0602 [Escherichia coli 6-175-07_S4_C1]
gb|KEM16851.1| hypothetical protein AB51_0755 [Escherichia coli 6-319-05_S1_C2]
gb|KEM23914.1| hypothetical protein AC10_0649 [Escherichia coli 6-319-05_S3_C1]
gb|KEM35143.1| hypothetical protein AB80_0700 [Escherichia coli 6-319-05_S1_C3]
gb|KEM40128.1| hypothetical protein AD21_0681 [Escherichia coli 6-319-05_S4_C2]
gb|KEM43512.1| hypothetical protein AB24_0660 [Escherichia coli 6-537-08_S1_C1]
gb|KEM50541.1| hypothetical protein AD46_0574 [Escherichia coli 6-175-07_S4_C3]
gb|KEM54780.1| hypothetical protein AB79_0793 [Escherichia coli 6-175-07_S1_C3]
gb|KEM65431.1| hypothetical protein AC63_0653 [Escherichia coli 6-319-05_S3_C3]
gb|KEM66691.1| hypothetical protein AB36_0629 [Escherichia coli 7-233-03_S1_C2]
gb|KEM72304.1| hypothetical protein AD47_0686 [Escherichia coli 6-319-05_S4_C3]
gb|KEM78105.1| hypothetical protein AB95_0639 [Escherichia coli 7-233-03_S3_C1]
gb|KEM80026.1| hypothetical protein AC11_0750 [Escherichia coli 6-537-08_S3_C1]
gb|KEM85430.1| hypothetical protein AC64_0803 [Escherichia coli 6-537-08_S3_C3]
gb|KEM93831.1| hypothetical protein AC71_0629 [Escherichia coli 2-222-05_S4_C1]
gb|KEM95052.1| hypothetical protein AC92_0574 [Escherichia coli 6-537-08_S4_C1]
gb|KEN03671.1| hypothetical protein AB68_0705 [Escherichia coli 7-233-03_S1_C3]
gb|KEN08220.1| hypothetical protein AC53_0671 [Escherichia coli 7-233-03_S3_C3]
gb|KEN09821.1| hypothetical protein AB23_0757 [Escherichia coli 6-319-05_S1_C1]
gb|KEN15567.1| hypothetical protein AD06_0798 [Escherichia coli 7-233-03_S4_C2]
gb|KEN21171.1| hypothetical protein AC39_0703 [Escherichia coli 6-537-08_S3_C2]
gb|KEN28198.1| hypothetical protein AB09_0585 [Escherichia coli 8-415-05_S1_C1]
gb|KEN29572.1| hypothetical protein AC23_0602 [Escherichia coli 7-233-03_S3_C2]
gb|KEN35538.1| hypothetical protein AC54_0751 [Escherichia coli 8-415-05_S3_C3]
gb|KEN36917.1| hypothetical protein AC78_4590 [Escherichia coli 7-233-03_S4_C1]
gb|KEN44841.1| hypothetical protein AB96_0739 [Escherichia coli 8-415-05_S3_C1]
gb|KEN47370.1| hypothetical protein AC78_0610 [Escherichia coli 7-233-03_S4_C1]
gb|KEN52190.1| hypothetical protein AB52_0663 [Escherichia coli 6-537-08_S1_C2]
gb|KEN59553.1| hypothetical protein AB81_0694 [Escherichia coli 6-537-08_S1_C3]
gb|KEN60178.1| hypothetical protein AD35_0596 [Escherichia coli 7-233-03_S4_C3]
gb|KEN66987.1| hypothetical protein AD22_0575 [Escherichia coli 6-537-08_S4_C2]
gb|KEN73457.1| hypothetical protein AD40_0722 [Escherichia coli 1-392-07_S4_C3]
gb|KEN76328.1| hypothetical protein AC24_0740 [Escherichia coli 8-415-05_S3_C2]
gb|KEN79703.1| hypothetical protein AC14_0657 [Escherichia coli 2-052-05_S3_C2]
gb|KEN87575.1| hypothetical protein AC75_0881 [Escherichia coli 2-474-04_S4_C1]
gb|KEN92207.1| hypothetical protein AB88_0745 [Escherichia coli 2-222-05_S3_C1]
gb|KEO01292.1| hypothetical protein AC18_1081 [Escherichia coli 2-222-05_S3_C2]
gb|KEO03590.1| hypothetical protein AC84_0722 [Escherichia coli 1-392-07_S4_C1]
gb|KEO14576.1| hypothetical protein AB37_0588 [Escherichia coli 8-415-05_S1_C2]
gb|KEO15658.1| hypothetical protein AC44_0850 [Escherichia coli 2-177-06_S3_C3]
gb|KEO19400.1| hypothetical protein AD29_0685 [Escherichia coli 2-222-05_S4_C3]
gb|KEO28109.1| hypothetical protein AC77_0685 [Escherichia coli 5-366-08_S4_C1]
gb|KEO34080.1| hypothetical protein AB05_0755 [Escherichia coli 2-460-02_S1_C1]
gb|KEO37825.1| hypothetical protein AC28_0674 [Escherichia coli 1-250-04_S3_C2]
gb|KEO41772.1| hypothetical protein AB34_0741 [Escherichia coli 2-460-02_S1_C2]
gb|AID77697.1| hypothetical protein ECOLIN_03405 [Escherichia coli Nissle 1917]
gb|KEO94553.1| hypothetical protein EH66_15990 [Escherichia coli]
gb|KEP04662.1| hypothetical protein EH64_13490 [Escherichia coli]
gb|KEP06803.1| hypothetical protein EH65_02025 [Escherichia coli]
gb|KEP17098.1| hypothetical protein EH63_27270 [Escherichia coli]
gb|KEP20087.1| hypothetical protein EH61_00925 [Escherichia coli]
gb|KEP83822.1| hypothetical protein AU08_0202045 [Escherichia coli E1140]
gb|AIF36013.1| hypothetical protein HQ24_03225 [Escherichia coli KLY]
gb|AIF61525.1| hypothetical protein L960_1702c [Escherichia coli B7A]
emb|CDU34419.1| Putative alpha helical protein [Escherichia coli D6-113.11]
emb|CDU39587.1| Putative alpha helical protein [Escherichia coli]
gb|AIF92276.1| hypothetical protein SS17_0675 [Escherichia coli O157:H7 str. SS17]
gb|AIG66919.1| hypothetical protein EDL933_0717 [Escherichia coli O157:H7 str.
EDL933]
gb|KFB92041.1| hypothetical protein GECO_03719 [Escherichia coli DSM 30083 = JCM
1649 = ATCC 11775]
emb|CDW58977.1| DUF1451 domain containing protein [Trichuris trichiura]
gb|KFF40163.1| hypothetical protein BC97_0210785 [Escherichia coli]
gb|KFF52052.1| hypothetical protein BC99_0312445 [Escherichia coli]
gb|KFH78067.1| hypothetical protein GR04_14275 [Escherichia coli]
gb|KFH84117.1| hypothetical protein GR03_11735 [Escherichia coli]
gb|KFH92940.1| hypothetical protein GR06_01455 [Escherichia coli]
gb|KFH94329.1| hypothetical protein GR07_16425 [Escherichia coli]
gb|KFI00880.1| hypothetical protein GR02_02020 [Escherichia coli]
gb|AIL17118.1| hypothetical protein DR76_4353 [Escherichia coli ATCC 25922]
gb|KFV22651.1| hypothetical protein GS40_09205 [Escherichia coli]
gb|KFV27296.1| hypothetical protein GS37_08485 [Escherichia coli]
gb|KFV31858.1| hypothetical protein GS38_05975 [Escherichia coli]
gb|KFV36364.1| hypothetical protein GS39_16840 [Escherichia coli]
emb|CEE04898.1| conserved hypothetical protein [Escherichia coli]
gb|AIN31132.1| DUF1451 family protein [Escherichia coli BW25113]
gb|KGA87345.1| hypothetical protein KV39_08115 [Escherichia coli]
emb|CDY56039.1| conserved protein [Escherichia coli]
emb|CDZ19509.1| conserved protein [Escherichia coli]
gb|KGI51245.1| hypothetical protein LJ08_0386 [Escherichia coli]
gb|AIT33841.1| hypothetical protein LI75_05885 [Escherichia coli FAP1]
gb|KGL67883.1| hypothetical protein L670_21511 [Escherichia coli NCTC 50110]
gb|KGM64124.1| putative protein YbeL [Escherichia coli]
gb|KGM68368.1| putative protein YbeL [Escherichia coli]
gb|KGM73135.1| putative protein YbeL [Escherichia coli]
gb|KGM77915.1| putative protein YbeL [Escherichia coli]
gb|KGM80623.1| putative protein YbeL [Escherichia coli]
gb|KGP12541.1| hypothetical protein JQ58_14105 [Escherichia coli]
gb|KGP13596.1| hypothetical protein JQ57_05680 [Escherichia coli]
gb|KGP21175.1| hypothetical protein JQ56_00955 [Escherichia coli]
gb|KGP40983.1| hypothetical protein JQ59_03810 [Escherichia coli]
gb|KGP52615.1| hypothetical protein LS89_03200 [Escherichia coli]
gb|KGP54849.1| hypothetical protein LS90_05805 [Escherichia coli]
gb|KGT07384.1| hypothetical protein GY32_03915 [Escherichia coli]
gb|KGT12072.1| hypothetical protein JO89_18335 [Escherichia coli]
gb|KGT26905.1| hypothetical protein JO88_11220 [Escherichia coli]
gb|KGT30148.1| hypothetical protein JO86_16835 [Escherichia coli]
gb|AIX62400.1| hypothetical protein ECONIH1_03665 [Escherichia coli]
gb|KHD39929.1| hypothetical protein LS39_12735 [Escherichia coli]
gb|KHD47366.1| hypothetical protein LS41_19620 [Escherichia coli]
gb|KHD57177.1| hypothetical protein LS40_00270 [Escherichia coli]
gb|KHD59607.1| hypothetical protein LS42_01390 [Escherichia coli]
gb|KHG73256.1| hypothetical protein PU75_22895 [Escherichia coli]
gb|KHG77273.1| hypothetical protein PU77_01685 [Escherichia coli]
gb|KHG81317.1| hypothetical protein PU76_10455 [Escherichia coli]
gb|KHG88210.1| hypothetical protein PU74_12595 [Escherichia coli]
gb|KHG91243.1| hypothetical protein PU73_22565 [Escherichia coli]
gb|KHG95821.1| hypothetical protein PU72_16330 [Escherichia coli]
gb|KHG99346.1| hypothetical protein PU71_21670 [Escherichia coli]
gb|KHH07896.1| hypothetical protein PU69_16490 [Escherichia coli]
gb|KHH13792.1| hypothetical protein PU68_16505 [Escherichia coli]
gb|KHH16072.1| hypothetical protein PU63_19975 [Escherichia coli]
gb|KHH16676.1| hypothetical protein PU67_13980 [Escherichia coli]
gb|KHH27116.1| hypothetical protein PU62_17470 [Escherichia coli]
gb|KHH28483.1| hypothetical protein PU61_18780 [Escherichia coli]
gb|KHH37232.1| hypothetical protein PU60_12440 [Escherichia coli]
gb|KHH42133.1| hypothetical protein PU59_14805 [Escherichia coli]
gb|KHH50020.1| hypothetical protein PU56_22085 [Escherichia coli]
gb|KHH56603.1| hypothetical protein PU57_10415 [Escherichia coli]
gb|KHH60785.1| hypothetical protein PU55_15215 [Escherichia coli]
gb|KHH65316.1| hypothetical protein PU54_14035 [Escherichia coli]
gb|KHH67565.1| hypothetical protein PU52_18855 [Escherichia coli]
gb|KHH75059.1| hypothetical protein PU50_19885 [Escherichia coli]
gb|KHH77202.1| hypothetical protein PU49_21885 [Escherichia coli]
gb|KHH84011.1| hypothetical protein PU51_05585 [Escherichia coli]
gb|KHH92919.1| hypothetical protein PU46_15005 [Escherichia coli]
gb|KHH93936.1| hypothetical protein PU47_04095 [Escherichia coli]
gb|KHH96451.1| hypothetical protein PU48_23025 [Escherichia coli]
gb|KHI00205.1| hypothetical protein PU44_18600 [Escherichia coli]
gb|KHI12209.1| hypothetical protein PU43_00260 [Escherichia coli]
gb|KHI14034.1| hypothetical protein PU36_16920 [Escherichia coli]
gb|KHI18777.1| hypothetical protein PU40_08280 [Escherichia coli]
gb|KHI22860.1| hypothetical protein PU35_14680 [Escherichia coli]
gb|KHI33470.1| hypothetical protein PU34_02175 [Escherichia coli]
gb|KHI35630.1| hypothetical protein PU33_07035 [Escherichia coli]
gb|KHI36016.1| hypothetical protein PU32_17355 [Escherichia coli]
gb|KHI43426.1| hypothetical protein PU31_13195 [Escherichia coli]
gb|KHI50246.1| hypothetical protein PU27_00270 [Escherichia coli]
gb|KHI54325.1| hypothetical protein PU24_12250 [Escherichia coli]
gb|KHI54570.1| hypothetical protein PU26_18530 [Escherichia coli]
gb|KHI60441.1| hypothetical protein PU22_12750 [Escherichia coli]
gb|KHI66572.1| hypothetical protein PU20_16950 [Escherichia coli]
gb|KHI71556.1| hypothetical protein PU19_15155 [Escherichia coli]
gb|KHI77819.1| hypothetical protein PU16_14730 [Escherichia coli]
gb|KHI82273.1| hypothetical protein PU18_13050 [Escherichia coli]
gb|KHI85477.1| hypothetical protein PU14_21400 [Escherichia coli]
gb|KHI87923.1| hypothetical protein PU15_23845 [Escherichia coli]
gb|KHI96541.1| hypothetical protein PU11_21445 [Escherichia coli]
gb|KHI99828.1| hypothetical protein PU12_08180 [Escherichia coli]
gb|KHJ07815.1| hypothetical protein PU08_11810 [Escherichia coli]
gb|KHJ11095.1| hypothetical protein PU10_18335 [Escherichia coli]
gb|KHJ16936.1| hypothetical protein PU06_18465 [Escherichia coli]
gb|KHJ23058.1| hypothetical protein PU04_16325 [Escherichia coli]
gb|KHJ28895.1| hypothetical protein PU03_00515 [Escherichia coli]
gb|AIZ31168.1| conserved protein, DUF1451 family [Escherichia coli ER2796]
gb|AIZ54493.1| conserved protein, DUF1451 family [Escherichia coli K-12]
gb|AIZ81677.1| hypothetical protein HW42_07065 [Escherichia coli]
gb|AIZ86196.1| hypothetical protein HW43_06935 [Escherichia coli]
gb|AIZ92214.1| hypothetical protein EO53_15015 [Escherichia coli str. K-12 substr.
MG1655]
gb|AJA24632.1| hypothetical protein SS52_0726 [Escherichia coli O157:H7 str. SS52]
gb|KHO57663.1| hypothetical protein RT53_17330 [Escherichia coli]
emb|CEK03695.1| conserved hypothetical protein [Escherichia coli O26:H11]
gb|AJB38437.1| hypothetical protein L282_3478 [Escherichia coli APEC IMT5155]
gb|AJB50806.1| hypothetical protein RR31_03555 [Escherichia coli]
emb|CCQ27546.2| hypothetical protein HUS2011_0667 [Escherichia coli]
gb|KIE69038.1| hypothetical protein GT41_06355 [Escherichia coli]
gb|KIE74713.1| hypothetical protein EP21_00400 [Escherichia coli]
gb|KIE80940.1| hypothetical protein GT42_02930 [Escherichia coli]
gb|KIE83886.1| hypothetical protein SC80_01260 [Escherichia coli RS218]
gb|KIG28191.1| hypothetical protein ECC69171_03740 [Escherichia coli C691-71
(14b)]
gb|KIG29614.1| hypothetical protein PU66_22650 [Escherichia coli]
gb|KIG36827.1| hypothetical protein PU70_17250 [Escherichia coli]
gb|KIG43562.1| hypothetical protein PU64_12920 [Escherichia coli]
gb|KIG44362.1| hypothetical protein PU65_06540 [Escherichia coli]
gb|KIG55520.1| hypothetical protein PU53_03175 [Escherichia coli]
gb|KIG57309.1| hypothetical protein PU45_10220 [Escherichia coli]
gb|KIG63230.1| hypothetical protein PU42_00400 [Escherichia coli]
gb|KIG65016.1| hypothetical protein PU39_18655 [Escherichia coli]
gb|KIG70235.1| hypothetical protein PU41_15220 [Escherichia coli]
gb|KIG74717.1| hypothetical protein PU37_18390 [Escherichia coli]
gb|KIG81185.1| hypothetical protein PU38_11105 [Escherichia coli]
gb|KIG90557.1| hypothetical protein PU30_02130 [Escherichia coli]
gb|KIG92278.1| hypothetical protein PU29_05770 [Escherichia coli]
gb|KIH01386.1| hypothetical protein PU23_00315 [Escherichia coli]
gb|KIH06800.1| hypothetical protein PU25_02960 [Escherichia coli]
gb|KIH08037.1| hypothetical protein PU21_02175 [Escherichia coli]
gb|KIH14313.1| hypothetical protein PU09_09495 [Escherichia coli]
gb|KIH18315.1| hypothetical protein PU17_01400 [Escherichia coli]
gb|KIH24914.1| hypothetical protein PU05_12290 [Escherichia coli]
gb|KIH25387.1| hypothetical protein PU07_12075 [Escherichia coli]
gb|KIH33106.1| hypothetical protein PU13_00125 [Escherichia coli]
gb|KIH34537.1| hypothetical protein PD07_19470 [Escherichia coli]
gb|AJE54968.1| alpha helical protein YbeL [Escherichia coli]
gb|KII10559.1| hypothetical protein LS43_03850 [Escherichia coli]
gb|AJF55383.1| hypothetical protein EC1303_c06160 [Escherichia coli 1303]
gb|AJF75980.1| hypothetical protein TH69_03095 [Escherichia coli]
gb|KIN86554.1| hypothetical protein PU28_08430 [Escherichia coli]
gb|AJG07670.1| hypothetical protein E1470_c06890 [Escherichia coli ECC-1470]
gb|KIO42402.1| hypothetical protein SU67_00395 [Escherichia coli O139:H28 str.
E24377A]
gb|AJH09536.1| hypothetical protein SR36_03100 [Escherichia coli]
gb|KIO87339.1| PF07295 family protein [Escherichia coli 97.0264]
gb|KIQ40776.1| hypothetical protein IY33_13330 [Escherichia coli]
gb|KIQ45651.1| hypothetical protein IY32_14845 [Escherichia coli]
gb|AJM72782.1| hypothetical protein W817_03615 [Escherichia coli RS218]
gb|AJO82526.1| hypothetical protein SY51_03255 [Escherichia coli]
gb|KIY29296.1| hypothetical protein TB57_07340 [Escherichia coli]
gb|KIZ08336.1| hypothetical protein UC39_25870 [Escherichia coli]
gb|KIZ63317.1| hypothetical protein UH28_04790 [Escherichia coli]
gb|KIZ67325.1| hypothetical protein UH34_01980 [Escherichia coli]
gb|KIZ70844.1| hypothetical protein UH31_03745 [Escherichia coli]
gb|KIZ73704.1| hypothetical protein UH35_10785 [Escherichia coli]
gb|KIZ79876.1| hypothetical protein UH32_03355 [Escherichia coli]
gb|KIZ85876.1| hypothetical protein UH29_01155 [Escherichia coli]
gb|KIZ86749.1| hypothetical protein UH37_17380 [Escherichia coli]
gb|KIZ94413.1| hypothetical protein UH33_04315 [Escherichia coli]
gb|KIZ99910.1| hypothetical protein UH36_01730 [Escherichia coli]
gb|KJA00298.1| hypothetical protein UH27_19150 [Escherichia coli]
gb|KJA05510.1| hypothetical protein UH30_16720 [Escherichia coli]
gb|KJD61344.1| hypothetical protein LT79_19580 [Escherichia coli]
gb|KJD66502.1| hypothetical protein LP50_19470 [Escherichia coli]
gb|KJD73153.1| hypothetical protein LR65_22935 [Escherichia coli]
gb|KJD74640.1| hypothetical protein LR67_21615 [Escherichia coli]
gb|KJD82052.1| hypothetical protein LR66_02750 [Escherichia coli]
gb|KJD88328.1| hypothetical protein LV68_23545 [Escherichia coli]
gb|KJD89915.1| hypothetical protein LV67_12870 [Escherichia coli]
gb|KJG98729.1| hypothetical protein UC40_05815 [Escherichia coli]
gb|KJH03549.1| hypothetical protein TS82_04045 [Escherichia coli]
gb|KJH06395.1| hypothetical protein UC41_17470 [Escherichia coli]
gb|KJI02517.1| hypothetical protein UO94_15935 [Escherichia coli]
gb|KJI13048.1| hypothetical protein UO92_02925 [Escherichia coli]
gb|KJI29031.1| hypothetical protein UO95_02215 [Escherichia coli]
gb|KJJ45659.1| hypothetical protein VM92_17490 [Escherichia coli]
gb|KJJ78958.1| hypothetical protein MPEC4839_11c00630 [Escherichia coli]
gb|KJJ82581.1| hypothetical protein MPEC4969_25c00770 [Escherichia coli]
gb|KJW24043.1| hypothetical protein UN88_22020 [Escherichia coli]
gb|KJW42204.1| hypothetical protein UN89_06775 [Escherichia coli]
gb|KJW47160.1| hypothetical protein UN91_17550 [Escherichia coli]
gb|KJW48776.1| hypothetical protein UN90_14135 [Escherichia coli]
gb|KJW59581.1| hypothetical protein UN93_24485 [Escherichia coli]
gb|KJW65729.1| hypothetical protein UN94_11320 [Escherichia coli]
gb|KJY09963.1| hypothetical protein UC21_19340 [Escherichia coli]
gb|AKA89597.1| uncharacterized protein YbeL [Escherichia coli VR50]
emb|CQR80242.1| conserved protein, DUF1451 family [Escherichia coli K-12]
gb|KKA61097.1| PF07295 family protein [Escherichia coli 9.1649]
gb|KKB13829.1| hypothetical protein VP68_27260 [Escherichia coli]
gb|KKB21514.1| hypothetical protein VP69_00205 [Escherichia coli]
gb|AKC12791.1| hypothetical protein VK74_09320 [Escherichia coli]
gb|AKD60222.1| hypothetical protein SH05_07055 [Escherichia coli K-12]
gb|AKD64592.1| hypothetical protein SH02_07010 [Escherichia coli K-12]
gb|AKD68969.1| hypothetical protein SH08_07055 [Escherichia coli K-12]
gb|AKD73335.1| hypothetical protein SH03_07060 [Escherichia coli K-12]
gb|AKD77744.1| hypothetical protein SH06_07365 [Escherichia coli K-12]
gb|AKD82113.1| hypothetical protein SH04_07050 [Escherichia coli K-12]
gb|AKD86474.1| hypothetical protein SH07_07055 [Escherichia coli K-12]
gb|AKD90884.1| hypothetical protein SF31_07365 [Escherichia coli K-12]
gb|KKF75229.1| hypothetical protein XE90_26430 [Escherichia coli O157:H7]
gb|KKF84857.1| hypothetical protein XF37_04790 [Escherichia coli O157:H7]
gb|KKJ24426.1| hypothetical protein T638_01825 [Escherichia coli MRSN 10204]
gb|AKE85464.1| hypothetical protein AAF13_15700 [Escherichia coli O104:H4 str.
C227-11]
gb|KKK03966.1| hypothetical protein CR63_03050 [Escherichia coli NB8]
gb|KKK29386.1| hypothetical protein WY12_06375 [Escherichia coli]
gb|KKO25484.1| hypothetical protein XA43_14625 [Escherichia coli]
gb|KKO30243.1| hypothetical protein XA40_10605 [Escherichia coli]
gb|KKO33241.1| hypothetical protein XA41_14370 [Escherichia coli]
gb|KKO37747.1| hypothetical protein XA44_16250 [Escherichia coli]
gb|AKF19642.1| hypothetical protein DP32_03600 [Escherichia coli]
gb|AKF54565.1| DUF1451 family protein [Escherichia coli]
gb|AKF58705.1| DUF1451 family protein [Escherichia coli]
gb|AKF62843.1| DUF1451 family protein [Escherichia coli]
gb|AKF66983.1| DUF1451 family protein [Escherichia coli]
gb|AKF71123.1| DUF1451 family protein [Escherichia coli]
gb|KKY48920.1| hypothetical protein AAY45_03490 [Escherichia coli O157:H7]
gb|AKH25626.1| hypothetical protein AA102_17615 [Escherichia coli]
gb|KLD47871.1| hypothetical protein XB01_07070 [Escherichia coli]
gb|KLD51535.1| hypothetical protein XB00_11920 [Escherichia coli]
gb|KLG32742.1| hypothetical protein WQ65_08655 [Escherichia coli]
gb|KLG38398.1| hypothetical protein WQ86_00660 [Escherichia coli]
gb|KLG44522.1| hypothetical protein WR16_14520 [Escherichia coli]
gb|KLG49097.1| hypothetical protein WQ74_23165 [Escherichia coli]
gb|KLG55265.1| hypothetical protein WQ68_10595 [Escherichia coli]
gb|KLG59797.1| hypothetical protein WQ95_19640 [Escherichia coli]
gb|KLG68279.1| hypothetical protein WR00_08855 [Escherichia coli]
gb|KLG74057.1| hypothetical protein WR24_03265 [Escherichia coli]
gb|KLG77384.1| hypothetical protein WR12_11880 [Escherichia coli]
gb|KLG83775.1| hypothetical protein WR01_06815 [Escherichia coli]
gb|KLH07024.1| hypothetical protein WQ71_03440 [Escherichia coli]
gb|KLH08907.1| hypothetical protein WQ88_08635 [Escherichia coli]
gb|KLH10956.1| hypothetical protein WR23_19160 [Escherichia coli]
gb|KLH17555.1| hypothetical protein WQ72_11325 [Escherichia coli]
gb|KLH25339.1| hypothetical protein WR13_03335 [Escherichia coli]
gb|KLH28547.1| hypothetical protein WR17_10030 [Escherichia coli]
gb|KLH35436.1| hypothetical protein WQ96_11565 [Escherichia coli]
gb|KLH37485.1| hypothetical protein WQ69_09760 [Escherichia coli]
gb|KLH44135.1| hypothetical protein WQ84_08150 [Escherichia coli]
gb|KLH48615.1| hypothetical protein WQ99_16655 [Escherichia coli]
gb|KLH48791.1| hypothetical protein WQ70_19130 [Escherichia coli]
gb|KLH61594.1| hypothetical protein WQ64_00270 [Escherichia coli]
gb|KLH64985.1| hypothetical protein WQ66_23155 [Escherichia coli]
gb|KLH65864.1| hypothetical protein WQ73_16955 [Escherichia coli]
gb|KLH69798.1| hypothetical protein WQ79_05945 [Escherichia coli]
gb|KLH79471.1| hypothetical protein WR19_10765 [Escherichia coli]
gb|KLH83265.1| hypothetical protein WR04_18270 [Escherichia coli]
gb|KLH85563.1| hypothetical protein WQ91_16520 [Escherichia coli]
gb|KLH94140.1| hypothetical protein WR18_08470 [Escherichia coli]
gb|AKI65666.1| hypothetical protein ABE81_02930 [Shigella boydii]
gb|AKK47257.1| hypothetical protein PPECC33_00681 [Escherichia coli PCN033]
gb|AKK36619.1| hypothetical protein APECO18_21920 [Escherichia coli APEC O18]
gb|AKK37997.1| hypothetical protein APECO2_04730 [Escherichia coli APEC O2-211]
gb|AKK46284.1| hypothetical protein NMECO18_29915 [Escherichia coli]
gb|KLU95198.1| hypothetical protein N621_16445 [Escherichia coli]
gb|KLX07915.1| hypothetical protein SK64_00405 [Escherichia coli]
gb|KLX08560.1| hypothetical protein SK65_00407 [Escherichia coli]
gb|KLX08711.1| hypothetical protein SK67_01295 [Escherichia coli]
gb|KLX19594.1| hypothetical protein SK69_00380 [Escherichia coli]
gb|KLX24763.1| hypothetical protein SK70_00623 [Escherichia coli]
gb|KLX31764.1| hypothetical protein SK72_00617 [Escherichia coli]
gb|KLX37377.1| hypothetical protein SK73_00668 [Escherichia coli]
gb|KLX39181.1| hypothetical protein SK71_00411 [Escherichia coli]
gb|KLX43614.1| hypothetical protein SK75_02743 [Escherichia coli]
gb|KLX49868.1| hypothetical protein SK76_00381 [Escherichia coli]
gb|KLX56340.1| hypothetical protein SK77_00610 [Escherichia coli]
gb|KLX56567.1| hypothetical protein SK78_03172 [Escherichia coli]
gb|KLX62155.1| hypothetical protein SK79_03481 [Escherichia coli]
gb|KLX68324.1| hypothetical protein SK80_03134 [Escherichia coli]
gb|KLX69104.1| hypothetical protein SK74_02400 [Escherichia coli]
gb|KLX78520.1| hypothetical protein SK81_00467 [Escherichia coli]
gb|KLX80000.1| hypothetical protein SK82_04150 [Escherichia coli]
gb|KLX86839.1| hypothetical protein SK83_03227 [Escherichia coli]
gb|KLX93911.1| hypothetical protein SK84_00625 [Escherichia coli]
gb|KLY01625.1| hypothetical protein SK87_02180 [Escherichia coli]
gb|KLY03786.1| hypothetical protein SK85_00644 [Escherichia coli]
gb|KLY07487.1| hypothetical protein SK86_01551 [Escherichia coli]
gb|KME72284.1| hypothetical protein SM09_01464 [Escherichia coli]
gb|AKN46755.1| hypothetical protein TZ57_03090 [Escherichia coli]
gb|AKO56157.1| hypothetical protein AA953_09240 [Escherichia coli]
gb|AKP83364.1| hypothetical protein J444_0632 [Escherichia coli ACN001]
gb|KMV41414.1| hypothetical protein ACM16_03920 [Escherichia coli]
gb|KMV51065.1| hypothetical protein ACM17_04170 [Escherichia coli]
gb|KMV53475.1| hypothetical protein ACM19_03905 [Escherichia coli]
gb|KMV55163.1| hypothetical protein ACM18_03130 [Escherichia coli]
gb|KMV61150.1| hypothetical protein ACM21_02550 [Escherichia coli]
gb|KMV64238.1| hypothetical protein ACM20_04005 [Escherichia coli]
gb|AKR19595.1| hypothetical protein ADS71_03250 [Escherichia coli]
gb|AKR23950.1| hypothetical protein ADZ27_03250 [Escherichia coli]
gb|AKR28322.1| hypothetical protein ADZ28_03250 [Escherichia coli]
gb|KNA41790.1| hypothetical protein ERYG_01989 [Escherichia coli M114]
emb|CTD17408.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD08111.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD06440.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP48502.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC93162.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS08444.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC92671.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR77330.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP04657.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ56179.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ72442.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP45535.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG43114.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC82458.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP40314.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG33133.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ51309.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE72987.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP58419.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE37138.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC81155.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ42912.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ45227.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN94573.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR71753.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH45477.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP22014.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR33540.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO22875.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ92611.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR07446.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE55868.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE29297.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE65272.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN89862.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE47436.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ15457.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN85576.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ06873.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR50635.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN96561.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO95384.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG36115.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF09809.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF36885.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO17453.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE92279.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ86895.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP21396.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO88115.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ67573.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ95389.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE54549.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ20489.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE85064.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR37902.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC78607.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR31940.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR00905.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ38022.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE77625.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF68910.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE83910.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF88900.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG29038.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS91287.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF05040.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO65533.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE73566.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ25573.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS05399.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE79721.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP43527.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ60384.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO43977.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST55375.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO67377.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF92761.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ97513.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP20874.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG40380.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN79539.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP88031.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR47454.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR18461.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR70448.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM33801.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ74530.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO28875.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM79371.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO82620.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP06695.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE34235.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO01669.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO33456.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO92326.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO15574.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK89604.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST55199.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR65430.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE50654.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE83385.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN36014.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO50076.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP31529.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO75813.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN76937.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO91552.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU09504.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ43573.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO66444.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO77110.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ47742.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST39654.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP46528.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN22804.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF71273.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ16352.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ35902.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP88013.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK08844.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ69924.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR44143.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS72250.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR91594.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ18059.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST04303.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW55086.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO72213.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM67285.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE83701.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL68572.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF04380.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTP67393.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF37619.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU94950.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST17158.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS74301.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV90065.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL54211.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF51378.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF23843.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV68492.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO03905.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL51963.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO77345.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS89563.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ20485.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO59984.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU10269.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE33851.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP76903.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR87848.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS88136.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST86104.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF32762.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO40945.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR52357.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR39967.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV56759.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF33269.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF25142.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG53341.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN30047.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP82849.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO83988.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM11809.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI93602.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW69510.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE30172.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV19225.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC45996.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF10389.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC52904.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX32286.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF66082.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ80154.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA16242.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW58145.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL48613.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR51896.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST11582.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU77282.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTP68945.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF66842.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR83596.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR35154.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS43265.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF62236.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL92180.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST63166.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS04859.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN33488.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ56197.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL61786.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY78901.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU79265.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST65874.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG87977.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV33982.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV35956.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV05262.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL78301.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW88723.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ03217.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST07746.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW97480.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR84297.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY52132.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU38847.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR09003.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL30343.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW36845.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR78801.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX99917.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ60559.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO18258.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF20265.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX13317.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV32426.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ42363.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK42193.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS59556.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV15164.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL43630.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU14992.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTP67220.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI68375.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO11109.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW73307.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG89894.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX91523.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK66500.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS54854.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ91289.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL27677.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV90698.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU80988.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ90302.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF29280.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU20778.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX41527.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL27223.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ28373.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX21012.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK60322.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSE54626.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR75865.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN10527.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL86051.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS32830.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV22230.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV53783.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ53679.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX96990.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSQ69380.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ75184.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK77277.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY23349.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH81090.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ20531.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU99456.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ72569.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI87886.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL15009.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB12341.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU34928.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR51551.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM27913.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR39635.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK31523.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU35929.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI66739.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST96862.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL04481.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK50146.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL30129.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS53380.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK52190.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX34007.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU07986.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ06622.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ68277.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX32279.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV48396.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL65263.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX35813.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF82686.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA83111.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU86140.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR67729.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH52225.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR44922.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL17321.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL61606.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST75922.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV40759.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB55315.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ25256.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ44961.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF19824.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ91682.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU66865.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW29877.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX91594.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV50073.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX38679.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI54119.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ78451.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ64842.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY46378.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ52441.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX90290.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF57082.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG48317.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV31159.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM59126.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR05195.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB76879.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC29734.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY34934.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU83041.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ93871.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY82198.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB37852.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV77218.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY14825.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV92212.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM32870.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ77605.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX94488.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF01989.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ39835.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH08042.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ69082.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST82608.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSF01080.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI78566.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD76604.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL81793.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV50413.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ27999.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS47994.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY48152.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG86154.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI63516.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU85668.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM35172.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU88546.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSN74829.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS48560.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV54204.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM06361.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH80476.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU82266.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX81757.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY07945.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY25138.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX35564.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ42121.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO91942.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB94180.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO62768.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ49142.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX63655.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL93645.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW72983.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG95220.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB45340.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX93361.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD67119.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU90193.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST76680.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW99365.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU52642.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA07080.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV76974.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSO19565.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR16248.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX23176.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR04851.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ33514.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH67433.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB45330.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH52118.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX04427.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI01699.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX33282.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY28501.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB68505.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ31716.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH55286.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX08103.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX31137.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM36067.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSP11083.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH73602.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU42119.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK19888.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ77441.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC80032.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU74710.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ27931.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB38405.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU73478.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX70937.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX14382.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH74824.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS10248.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB17408.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS04883.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV17942.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB58972.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI53825.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM27821.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH72067.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ34665.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH15022.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA14319.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM47659.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL67676.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ06793.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ85346.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ53305.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ00079.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM60979.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB99562.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB42041.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD85553.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC38050.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB34433.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC30524.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL79521.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX86888.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ78634.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY18509.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH11189.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC13728.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX27001.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU53049.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ58461.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC14651.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH65071.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS66317.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST42389.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL87681.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC57410.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU45003.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU67654.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ09998.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ05754.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX99829.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CST83859.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB51239.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ26851.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH05531.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU19354.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC67099.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX96272.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX10414.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH20166.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG76841.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI71553.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG98408.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU70663.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG47402.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ93993.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY95296.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC22298.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM45520.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ42692.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY22875.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ51540.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU52318.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSV06089.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG66330.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU63309.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI05168.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH59781.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSU94967.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSW88820.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSX39181.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG99387.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG62280.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSG57208.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA96220.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA89238.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSZ94122.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA88159.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA41650.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA27751.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH68074.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH89104.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM74028.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS56237.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH37608.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM85275.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY19217.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH24065.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL86393.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSR96054.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM28382.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA50435.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM48601.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM42019.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM11287.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB09211.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH62681.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSL84744.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB07614.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM43648.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH54335.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSS70038.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM69942.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA19066.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM29971.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA66514.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB23909.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA25341.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM31020.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ59220.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ68440.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH52367.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM03588.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ27053.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB30014.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSM27873.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB43029.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA62944.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA88588.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH29009.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA55319.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB16205.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA60832.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTC28817.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSH34805.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSI27582.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA33469.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA70122.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA98165.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA43938.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB45407.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTA59858.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK01021.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSJ58892.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK50116.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTB95890.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK39362.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK45286.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSK13624.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CSY22512.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
gb|KNF15288.1| hypothetical protein WQ85_19500 [Escherichia coli]
gb|KNF17398.1| hypothetical protein WQ94_08225 [Escherichia coli]
gb|KNF23257.1| hypothetical protein WQ81_06215 [Escherichia coli]
gb|KNF26658.1| hypothetical protein WQ82_20565 [Escherichia coli]
gb|KNF32587.1| hypothetical protein WR10_10860 [Escherichia coli]
gb|KNF37108.1| hypothetical protein WR26_17685 [Escherichia coli]
gb|KNF39446.1| hypothetical protein WR22_20900 [Escherichia coli]
gb|KNF49803.1| hypothetical protein WR02_06370 [Escherichia coli]
gb|KNF54225.1| hypothetical protein WQ76_12030 [Escherichia coli]
gb|KNF63032.1| hypothetical protein WQ67_19225 [Escherichia coli]
gb|KNF64068.1| hypothetical protein WR15_22280 [Escherichia coli]
gb|KNF69946.1| hypothetical protein WQ83_24535 [Escherichia coli]
gb|KNF82516.1| hypothetical protein WQ89_00270 [Escherichia coli]
gb|KNG03867.1| hypothetical protein WQ80_00270 [Escherichia coli]
gb|KNG07584.1| hypothetical protein WQ90_19760 [Escherichia coli]
gb|KNG14249.1| hypothetical protein WR06_07335 [Escherichia coli]
gb|KNG16054.1| hypothetical protein WQ93_13405 [Escherichia coli]
gb|KNG22385.1| hypothetical protein WQ97_17555 [Escherichia coli]
gb|KNG24326.1| hypothetical protein WQ87_11495 [Escherichia coli]
gb|KNG33502.1| hypothetical protein WR21_06735 [Escherichia coli]
gb|KNG40299.1| hypothetical protein WR20_10190 [Escherichia coli]
gb|KNG41828.1| hypothetical protein WR11_06580 [Escherichia coli]
gb|KNY01856.1| hypothetical protein AB747_10795 [Escherichia coli]
gb|KNY55075.1| hypothetical protein AGA24_14815 [Escherichia coli]
gb|KNY59866.1| hypothetical protein AGA21_18340 [Escherichia coli]
gb|KNY62649.1| hypothetical protein AGA22_12080 [Escherichia coli]
gb|KNY75544.1| hypothetical protein AGA25_00545 [Escherichia coli]
gb|KNY78731.1| hypothetical protein AGA26_00515 [Escherichia coli]
gb|KNY79199.1| hypothetical protein AGA27_16355 [Escherichia coli]
gb|KNY90637.1| hypothetical protein AGA28_01415 [Escherichia coli]
gb|KNY90958.1| hypothetical protein AGA29_07240 [Escherichia coli]
gb|KNY99715.1| hypothetical protein AGA37_02710 [Escherichia coli]
gb|KNZ01344.1| hypothetical protein AGA31_13200 [Escherichia coli]
gb|KNZ10282.1| hypothetical protein AGA36_02710 [Escherichia coli]
gb|KNZ11773.1| hypothetical protein AGA20_15570 [Escherichia coli]
gb|KNZ16045.1| hypothetical protein AGA30_05975 [Escherichia coli]
gb|KNZ21150.1| hypothetical protein AGA23_11170 [Escherichia coli]
gb|KOA00053.1| hypothetical protein AKG99_04565 [Escherichia coli]
gb|KOA22451.1| hypothetical protein AC065_25535 [Escherichia coli]
gb|KOA23124.1| hypothetical protein AC066_24980 [Escherichia coli]
gb|KOA34366.1| hypothetical protein AC067_14920 [Escherichia coli]
emb|CTX22314.1| putative alpha helical protein [Escherichia coli]
emb|CTX17356.1| putative alpha helical protein [Escherichia coli]
emb|CTX11370.1| putative alpha helical protein [Escherichia coli]
emb|CTW83216.1| putative alpha helical protein [Escherichia coli]
emb|CTX08832.1| putative alpha helical protein [Escherichia coli]
emb|CTX02531.1| putative alpha helical protein [Escherichia coli]
emb|CTW97040.1| putative alpha helical protein [Escherichia coli]
emb|CTX05055.1| putative alpha helical protein [Escherichia coli]
emb|CTX00402.1| putative alpha helical protein [Escherichia coli]
emb|CTR35179.1| putative alpha helical protein [Escherichia coli]
emb|CTR36707.1| putative alpha helical protein [Escherichia coli]
emb|CTU61702.1| putative alpha helical protein [Escherichia coli]
emb|CTU78093.1| putative alpha helical protein [Escherichia coli]
emb|CTR48143.1| putative alpha helical protein [Escherichia coli]
emb|CTV50259.1| putative alpha helical protein [Escherichia coli]
emb|CTS16487.1| putative alpha helical protein [Escherichia coli]
emb|CTR12140.1| putative alpha helical protein [Escherichia coli]
emb|CTR43729.1| putative alpha helical protein [Escherichia coli]
emb|CTV43504.1| putative alpha helical protein [Escherichia coli]
emb|CTR31198.1| putative alpha helical protein [Escherichia coli]
emb|CTV25007.1| putative alpha helical protein [Escherichia coli]
emb|CTT23080.1| putative alpha helical protein [Escherichia coli]
emb|CTV20414.1| putative alpha helical protein [Escherichia coli]
emb|CTU02410.1| putative alpha helical protein [Escherichia coli]
emb|CTT15009.1| putative alpha helical protein [Escherichia coli]
emb|CTV32373.1| putative alpha helical protein [Escherichia coli]
emb|CTS02392.1| putative alpha helical protein [Escherichia coli]
emb|CTU08466.1| putative alpha helical protein [Escherichia coli]
emb|CTT17317.1| putative alpha helical protein [Escherichia coli]
emb|CTU85895.1| putative alpha helical protein [Escherichia coli]
emb|CTR86105.1| putative alpha helical protein [Escherichia coli]
emb|CTW67461.1| putative alpha helical protein [Escherichia coli]
emb|CTU00457.1| putative alpha helical protein [Escherichia coli]
emb|CTV42724.1| putative alpha helical protein [Escherichia coli]
emb|CTR24350.1| putative alpha helical protein [Escherichia coli]
emb|CTR36291.1| putative alpha helical protein [Escherichia coli]
emb|CTW15002.1| putative alpha helical protein [Escherichia coli]
emb|CTU14638.1| putative alpha helical protein [Escherichia coli]
emb|CTR77753.1| putative alpha helical protein [Escherichia coli]
emb|CTR99599.1| putative alpha helical protein [Escherichia coli]
emb|CTU19931.1| putative alpha helical protein [Escherichia coli]
emb|CTS09780.1| putative alpha helical protein [Escherichia coli]
emb|CTW26925.1| putative alpha helical protein [Escherichia coli]
emb|CTV44022.1| putative alpha helical protein [Escherichia coli]
emb|CTT00339.1| putative alpha helical protein [Escherichia coli]
emb|CTS08538.1| putative alpha helical protein [Escherichia coli]
emb|CTT17387.1| putative alpha helical protein [Escherichia coli]
emb|CTR90027.1| putative alpha helical protein [Escherichia coli]
emb|CTV94862.1| putative alpha helical protein [Escherichia coli]
emb|CTW33212.1| putative alpha helical protein [Escherichia coli]
emb|CTW04667.1| putative alpha helical protein [Escherichia coli]
emb|CTW63253.1| putative alpha helical protein [Escherichia coli]
emb|CTV89039.1| putative alpha helical protein [Escherichia coli]
emb|CTS95268.1| putative alpha helical protein [Escherichia coli]
emb|CTV51681.1| putative alpha helical protein [Escherichia coli]
emb|CTW46085.1| putative alpha helical protein [Escherichia coli]
emb|CTS85358.1| putative alpha helical protein [Escherichia coli]
emb|CTV22761.1| putative alpha helical protein [Escherichia coli]
emb|CTS76661.1| putative alpha helical protein [Escherichia coli]
emb|CTT27059.1| putative alpha helical protein [Escherichia coli]
emb|CTS98099.1| putative alpha helical protein [Escherichia coli]
emb|CTW62549.1| putative alpha helical protein [Escherichia coli]
emb|CTW38720.1| putative alpha helical protein [Escherichia coli]
emb|CTS77631.1| putative alpha helical protein [Escherichia coli]
emb|CTU49745.1| putative alpha helical protein [Escherichia coli]
emb|CTW05134.1| putative alpha helical protein [Escherichia coli]
emb|CTS67407.1| putative alpha helical protein [Escherichia coli]
emb|CTT21475.1| putative alpha helical protein [Escherichia coli]
emb|CTV17218.1| putative alpha helical protein [Escherichia coli]
emb|CTS81591.1| putative alpha helical protein [Escherichia coli]
emb|CTS00672.1| putative alpha helical protein [Escherichia coli]
emb|CTU39239.1| putative alpha helical protein [Escherichia coli]
emb|CTS09493.1| putative alpha helical protein [Escherichia coli]
emb|CTS27129.1| putative alpha helical protein [Escherichia coli]
emb|CTS27024.1| putative alpha helical protein [Escherichia coli]
emb|CTV52775.1| putative alpha helical protein [Escherichia coli]
emb|CTW79872.1| putative alpha helical protein [Escherichia coli]
emb|CTR87850.1| putative alpha helical protein [Escherichia coli]
emb|CTV25323.1| putative alpha helical protein [Escherichia coli]
emb|CTT44176.1| putative alpha helical protein [Escherichia coli]
emb|CTW23848.1| putative alpha helical protein [Escherichia coli]
emb|CTT96520.1| putative alpha helical protein [Escherichia coli]
emb|CTV16039.1| putative alpha helical protein [Escherichia coli]
emb|CTU16091.1| putative alpha helical protein [Escherichia coli]
emb|CTW06166.1| putative alpha helical protein [Escherichia coli]
emb|CTT40327.1| putative alpha helical protein [Escherichia coli]
emb|CTV77089.1| putative alpha helical protein [Escherichia coli]
emb|CTS35704.1| putative alpha helical protein [Escherichia coli]
emb|CTT68286.1| putative alpha helical protein [Escherichia coli]
emb|CTU62783.1| putative alpha helical protein [Escherichia coli]
emb|CTV32533.1| putative alpha helical protein [Escherichia coli]
emb|CTW16218.1| putative alpha helical protein [Escherichia coli]
emb|CTV57473.1| putative alpha helical protein [Escherichia coli]
emb|CTW01972.1| putative alpha helical protein [Escherichia coli]
emb|CTS20962.1| putative alpha helical protein [Escherichia coli]
emb|CTS54048.1| putative alpha helical protein [Escherichia coli]
emb|CTS79885.1| putative alpha helical protein [Escherichia coli]
emb|CTU47266.1| putative alpha helical protein [Escherichia coli]
emb|CTT11129.1| putative alpha helical protein [Escherichia coli]
emb|CTW01532.1| putative alpha helical protein [Escherichia coli]
emb|CTS50218.1| putative alpha helical protein [Escherichia coli]
emb|CTV48208.1| putative alpha helical protein [Escherichia coli]
emb|CTS06252.1| putative alpha helical protein [Escherichia coli]
emb|CTV62683.1| putative alpha helical protein [Escherichia coli]
emb|CTV76523.1| putative alpha helical protein [Escherichia coli]
emb|CTW29287.1| putative alpha helical protein [Escherichia coli]
emb|CTR80604.1| putative alpha helical protein [Escherichia coli]
emb|CTS34422.1| putative alpha helical protein [Escherichia coli]
emb|CTR82816.1| putative alpha helical protein [Escherichia coli]
emb|CTS46060.1| putative alpha helical protein [Escherichia coli]
emb|CTW43742.1| putative alpha helical protein [Escherichia coli]
emb|CTT84507.1| putative alpha helical protein [Escherichia coli]
emb|CTT85180.1| putative alpha helical protein [Escherichia coli]
emb|CTV22570.1| putative alpha helical protein [Escherichia coli]
emb|CTS72276.1| putative alpha helical protein [Escherichia coli]
emb|CTS54218.1| putative alpha helical protein [Escherichia coli]
emb|CTV50106.1| putative alpha helical protein [Escherichia coli]
emb|CTY56297.1| putative alpha helical protein [Escherichia coli]
emb|CTY82635.1| putative alpha helical protein [Escherichia coli]
emb|CTX65218.1| putative alpha helical protein [Escherichia coli]
emb|CTY54589.1| putative alpha helical protein [Escherichia coli]
emb|CTZ29017.1| putative alpha helical protein [Escherichia coli]
emb|CTY93976.1| putative alpha helical protein [Escherichia coli]
emb|CTY41191.1| putative alpha helical protein [Escherichia coli]
emb|CTY49420.1| putative alpha helical protein [Escherichia coli]
emb|CTZ08374.1| putative alpha helical protein [Escherichia coli]
emb|CTZ07808.1| putative alpha helical protein [Escherichia coli]
emb|CTZ73063.1| putative alpha helical protein [Escherichia coli]
emb|CTY42560.1| putative alpha helical protein [Escherichia coli]
emb|CTZ70678.1| putative alpha helical protein [Escherichia coli]
emb|CTZ13392.1| putative alpha helical protein [Escherichia coli]
emb|CTY71622.1| putative alpha helical protein [Escherichia coli]
emb|CTZ58835.1| putative alpha helical protein [Escherichia coli]
emb|CTX56569.1| putative alpha helical protein [Escherichia coli]
emb|CTZ35474.1| putative alpha helical protein [Escherichia coli]
emb|CTY74562.1| putative alpha helical protein [Escherichia coli]
emb|CTZ05380.1| putative alpha helical protein [Escherichia coli]
emb|CTY67285.1| putative alpha helical protein [Escherichia coli]
emb|CTX92180.1| putative alpha helical protein [Escherichia coli]
emb|CTY52078.1| putative alpha helical protein [Escherichia coli]
emb|CTZ67744.1| putative alpha helical protein [Escherichia coli]
emb|CTY50729.1| putative alpha helical protein [Escherichia coli]
emb|CTY81703.1| putative alpha helical protein [Escherichia coli]
emb|CTZ51929.1| putative alpha helical protein [Escherichia coli]
emb|CTX84927.1| putative alpha helical protein [Escherichia coli]
emb|CTZ38810.1| putative alpha helical protein [Escherichia coli]
emb|CTZ46883.1| putative alpha helical protein [Escherichia coli]
emb|CTZ42601.1| putative alpha helical protein [Escherichia coli]
emb|CTY37141.1| putative alpha helical protein [Escherichia coli]
emb|CTZ35987.1| putative alpha helical protein [Escherichia coli]
emb|CTX83471.1| putative alpha helical protein [Escherichia coli]
emb|CTZ84745.1| putative alpha helical protein [Escherichia coli]
emb|CTY52011.1| putative alpha helical protein [Escherichia coli]
emb|CTX95989.1| putative alpha helical protein [Escherichia coli]
emb|CTY44060.1| putative alpha helical protein [Escherichia coli]
emb|CTY57574.1| putative alpha helical protein [Escherichia coli]
emb|CTZ50043.1| putative alpha helical protein [Escherichia coli]
emb|CTZ90048.1| putative alpha helical protein [Escherichia coli]
emb|CUA09188.1| putative alpha helical protein [Escherichia coli]
emb|CUA06978.1| putative alpha helical protein [Escherichia coli]
emb|CUA01222.1| putative alpha helical protein [Escherichia coli]
emb|CUA01797.1| putative alpha helical protein [Escherichia coli]
emb|CUA29508.1| putative alpha helical protein [Escherichia coli]
emb|CUA55483.1| putative alpha helical protein [Escherichia coli]
emb|CUA45331.1| putative alpha helical protein [Escherichia coli]
emb|CUA58711.1| putative alpha helical protein [Escherichia coli]
emb|CUA41854.1| putative alpha helical protein [Escherichia coli]
emb|CUA40094.1| putative alpha helical protein [Escherichia coli]
emb|CUA22245.1| putative alpha helical protein [Escherichia coli]
emb|CUA32129.1| putative alpha helical protein [Escherichia coli]
emb|CUA39420.1| putative alpha helical protein [Escherichia coli]
gb|KOR05993.1| hypothetical protein ABW50_06805 [Escherichia coli]
gb|ALB30833.1| hypothetical protein SR35_03220 [Escherichia coli]
gb|ALD26187.1| hypothetical protein AN206_17890 [Escherichia coli]
gb|ALD40974.1| hypothetical protein AN203_17055 [Escherichia coli]
gb|ALD31371.1| hypothetical protein AN205_17635 [Escherichia coli]
emb|CUH55032.1| DUF1451 family protein [Escherichia coli KRX]
gb|KOZ12198.1| hypothetical protein ACP59_06060 [Escherichia coli]
gb|KOZ12590.1| hypothetical protein AC814_03060 [Escherichia coli]
gb|KOZ18062.1| hypothetical protein ACP60_02555 [Escherichia coli]
gb|KOZ20108.1| hypothetical protein ACP62_21265 [Escherichia coli]
gb|KOZ30336.1| hypothetical protein ACP61_11005 [Escherichia coli]
gb|KOZ32239.1| hypothetical protein ACP63_03350 [Escherichia coli]
gb|KOZ36769.1| hypothetical protein ACP64_17895 [Escherichia coli]
gb|KOZ42454.1| hypothetical protein ACP65_21845 [Escherichia coli]
gb|KOZ47910.1| hypothetical protein ACP66_05865 [Escherichia coli]
gb|KOZ53767.1| hypothetical protein ACP68_12010 [Escherichia coli]
gb|KOZ59396.1| hypothetical protein ACP69_12000 [Escherichia coli]
gb|KOZ66688.1| hypothetical protein ACP74_00170 [Escherichia coli]
gb|KOZ69891.1| hypothetical protein ACP70_12720 [Escherichia coli]
gb|KOZ70291.1| hypothetical protein ACP71_22050 [Escherichia coli]
gb|KOZ79389.1| hypothetical protein ACP72_17510 [Escherichia coli]
gb|KOZ81196.1| hypothetical protein ACP73_22080 [Escherichia coli]
gb|KOZ92558.1| hypothetical protein ACP75_03005 [Escherichia coli]
gb|KOZ93610.1| hypothetical protein ACP67_22855 [Escherichia coli]
emb|CUK02256.1| Protein of uncharacterised function (DUF1451) [Achromobacter sp.
ATCC35328]
gb|KPH29969.1| hypothetical protein ACZ78_22435 [Escherichia coli]
gb|KPH39491.1| hypothetical protein ACZ77_02890 [Escherichia coli]
gb|KPH45027.1| hypothetical protein ABT67_09555 [Escherichia coli]
gb|KPH48619.1| hypothetical protein ACZ84_05525 [Escherichia coli]
emb|CUQ95705.1| FIG002095: hypothetical protein [Escherichia coli]
emb|CTX64384.1| putative alpha helical protein [Escherichia coli]
emb|CTX50225.1| putative alpha helical protein [Escherichia coli]
emb|CTX53966.1| putative alpha helical protein [Escherichia coli]
emb|CTX57499.1| putative alpha helical protein [Escherichia coli]
emb|CTX69624.1| putative alpha helical protein [Escherichia coli]
emb|CTX55251.1| putative alpha helical protein [Escherichia coli]
emb|CTX79080.1| putative alpha helical protein [Escherichia coli]
emb|CTD49640.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTD46686.1| putative F0F1-type ATP synthase%2C subunit b [Shigella sonnei]
emb|CTX63096.1| putative alpha helical protein [Escherichia coli]
emb|CTX98700.1| putative alpha helical protein [Escherichia coli]
emb|CTX26810.1| putative alpha helical protein [Escherichia coli]
gb|ALH89400.1| hypothetical protein AO055_03490 [Escherichia coli O157:H7]
gb|ALI41550.1| hypothetical protein QQ24_19580 [Escherichia coli str. K-12 substr.
MG1655]
gb|ALI45947.1| hypothetical protein QR62_19585 [Escherichia coli]
gb|ALI50346.1| hypothetical protein QR63_19585 [Escherichia coli]
gb|KPO06899.1| hypothetical protein VM39_18735 [Escherichia coli]
gb|KPO15416.1| hypothetical protein ACU62_01365 [Escherichia coli]
gb|KPO20191.1| hypothetical protein ACU57_00570 [Escherichia coli]
gb|KPO28755.1| hypothetical protein ACU75_25390 [Escherichia coli]
gb|KPO30420.1| hypothetical protein ACU65_02785 [Escherichia coli]
gb|KPO36111.1| hypothetical protein ACU70_07990 [Escherichia coli]
gb|KPO38694.1| hypothetical protein ACU81_11440 [Escherichia coli]
gb|KPO51664.1| hypothetical protein ACU82_07800 [Escherichia coli]
gb|KPO54863.1| hypothetical protein ACU90_10730 [Escherichia coli]
gb|KPO57801.1| hypothetical protein ACU60_22960 [Escherichia coli]
gb|KPO67763.1| hypothetical protein ACU64_10600 [Escherichia coli]
gb|KPO71907.1| hypothetical protein ACU80_17015 [Escherichia coli]
gb|KPO73039.1| hypothetical protein ACU91_24600 [Escherichia coli]
gb|KPO81835.1| hypothetical protein ACU72_14240 [Escherichia coli]
gb|KPO91174.1| hypothetical protein ACU87_08425 [Escherichia coli]
gb|KPO97744.1| hypothetical protein ACU88_12200 [Escherichia coli]
gb|KPP01237.1| hypothetical protein ACU83_09120 [Escherichia coli]
gb|KPP05382.1| hypothetical protein ACU67_27085 [Escherichia coli]
gb|KPP05905.1| hypothetical protein ACU98_07195 [Escherichia coli]
gb|KPP10522.1| hypothetical protein ACU66_22715 [Escherichia coli]
gb|KPP21042.1| hypothetical protein ACU68_13280 [Escherichia coli]
gb|KPP27856.1| hypothetical protein ACU99_21035 [Escherichia coli]
gb|KPP29618.1| hypothetical protein ACU86_07975 [Escherichia coli]
gb|KPP31727.1| hypothetical protein ACU94_26075 [Escherichia coli]
gb|KPP47008.1| hypothetical protein ACU96_25250 [Escherichia coli]
gb|KPP47340.1| hypothetical protein ACU76_06490 [Escherichia coli]
gb|KPP52917.1| hypothetical protein ACU77_01075 [Escherichia coli]
gb|KPQ46393.1| Uncharacterized protein YbeL [Escherichia coli TW10598]
gb|ALJ95364.1| DUF1451 family protein [Escherichia coli K-12]
gb|ALJ95964.1| DUF1451 family protein [Escherichia coli K-12]
gb|KQB26502.1| hypothetical protein APV31_13960 [Escherichia coli]
gb|KQC25120.1| hypothetical protein AML92_16890 [Escherichia coli]
gb|KQI74863.1| hypothetical protein AM258_18190 [Escherichia coli]
gb|KQI79585.1| hypothetical protein AM259_17675 [Escherichia coli]
gb|KQI84675.1| hypothetical protein AM260_16835 [Escherichia coli]
gb|KQI89663.1| hypothetical protein AM261_16445 [Escherichia coli]
gb|KQJ01995.1| hypothetical protein AM262_03315 [Escherichia coli]
gb|KQJ03779.1| hypothetical protein AM264_17185 [Escherichia coli]
gb|KQJ09877.1| hypothetical protein AM265_08485 [Escherichia coli]
gb|KQJ15192.1| hypothetical protein AM266_12950 [Escherichia coli]
gb|KQJ15365.1| hypothetical protein AM267_21290 [Escherichia coli]
gb|KQJ24008.1| hypothetical protein AM268_12775 [Escherichia coli]
gb|KQJ39651.1| hypothetical protein AM272_15880 [Escherichia coli]
gb|KQJ40353.1| hypothetical protein AM270_15770 [Escherichia coli]
gb|KQJ48360.1| hypothetical protein AM273_13710 [Escherichia coli]
gb|ALL86705.1| hypothetical protein MJ49_03345 [Escherichia coli]
gb|ALL92406.1| hypothetical protein AKK22_05835 [Escherichia coli]
gb|KQL78680.1| hypothetical protein ExPEC_2156 [Escherichia coli]
gb|KRQ04071.1| hypothetical protein ASO15_03520 [Escherichia coli O157:H7]
gb|KRR51937.1| hypothetical protein EC2732_15228 [Escherichia coli VL2732]
gb|KRR57419.1| hypothetical protein ECK71_15578 [Escherichia coli K71]
gb|KRR61072.1| hypothetical protein EC2874_12978 [Escherichia coli VL2874]
gb|ALN44697.1| hypothetical protein ASE18_00730 [Escherichia coli]
gb|KRT23017.1| hypothetical protein ASU34_02105 [Escherichia coli]
gb|KRV73614.1| hypothetical protein AO733_15640 [Escherichia coli]
gb|KRV99582.1| hypothetical protein AO737_17625 [Escherichia coli]
gb|KRW01766.1| hypothetical protein AO743_14780 [Escherichia coli]
gb|KST31769.1| hypothetical protein APZ13_11905 [Escherichia coli]
gb|KST32892.1| hypothetical protein APZ14_07370 [Escherichia coli]
gb|ALQ60171.1| hypothetical protein AB850_17445 [Escherichia coli]
gb|ALQ73565.1| hypothetical protein ATL78_13865 [Escherichia coli]
gb|KSW86143.1| hypothetical protein APT75_14620 [Escherichia coli]
gb|KSX64525.1| hypothetical protein APT88_21075 [Escherichia coli]
gb|KSX82433.1| hypothetical protein APT93_10280 [Escherichia coli]
gb|KSX85541.1| hypothetical protein APT94_14260 [Escherichia coli]
gb|KSY09387.1| hypothetical protein APT97_23240 [Escherichia coli]
gb|KSY14727.1| hypothetical protein APT99_22905 [Escherichia coli]
gb|KSY42365.1| hypothetical protein APU01_15895 [Escherichia coli]
gb|KSY50204.1| hypothetical protein APU06_06365 [Escherichia coli]
gb|KSY64732.1| hypothetical protein APU07_15720 [Escherichia coli]
gb|KSY74783.1| hypothetical protein APU10_22670 [Escherichia coli]
gb|KSY83706.1| hypothetical protein APU13_11120 [Escherichia coli]
gb|KSY92212.1| hypothetical protein APU12_10120 [Escherichia coli]
gb|KSY94076.1| hypothetical protein APU16_12300 [Escherichia coli]
gb|KSZ11239.1| hypothetical protein APU18_23795 [Escherichia coli]
emb|CRL87260.1| conserved hypothetical protein [Escherichia coli]
gb|ALT53008.1| hypothetical protein AUO99_24985 [Escherichia coli]
gb|KUG70237.1| hypothetical protein ARC81_15225 [Escherichia coli]
gb|KUG76218.1| hypothetical protein ARC97_05705 [Escherichia coli]
gb|KUG77932.1| hypothetical protein ARC96_03565 [Escherichia coli]
gb|KUG83356.1| hypothetical protein ARC90_15990 [Escherichia coli]
gb|KUG87924.1| hypothetical protein ARC95_10420 [Escherichia coli]
gb|KUG89258.1| hypothetical protein ARC88_05565 [Escherichia coli]
gb|KUG95635.1| hypothetical protein ARC92_15230 [Escherichia coli]
gb|KUG97010.1| hypothetical protein ARC93_13380 [Escherichia coli]
gb|KUH07932.1| hypothetical protein ARC83_13435 [Escherichia coli]
gb|KUH18595.1| hypothetical protein ARC89_17850 [Escherichia coli]
gb|KUH27866.1| hypothetical protein ARC91_14480 [Escherichia coli]
gb|KUH29902.1| hypothetical protein ARC98_06310 [Escherichia coli]
gb|ALV68116.1| hypothetical protein FH07_08045 [Escherichia coli]
gb|ALX51371.1| hypothetical protein AVR67_03500 [Escherichia coli]
gb|ALX56517.1| hypothetical protein AVR68_03235 [Escherichia coli]
gb|ALX61556.1| hypothetical protein AVR73_03440 [Escherichia coli]
gb|ALY12119.1| hypothetical protein ACN002_0661 [Escherichia coli]
emb|CUW82197.1| conserved hypothetical protein [Escherichia coli]
gb|KUR34660.1| hypothetical protein AWF56_07280 [Escherichia coli]
gb|KUR38827.1| hypothetical protein AWF57_23260 [Escherichia coli]
gb|ALZ54536.1| hypothetical protein FORC11_0605 [Shigella sonnei]
gb|KUR85642.1| hypothetical protein AWE63_18805 [Escherichia coli]
gb|KUR93545.1| hypothetical protein AWE64_06350 [Escherichia coli]
gb|KUR94717.1| hypothetical protein AWE57_10190 [Escherichia coli]
gb|KUS04081.1| hypothetical protein AWE52_02140 [Escherichia coli]
gb|KUS05593.1| hypothetical protein AWE54_09600 [Escherichia coli]
gb|KUS07619.1| hypothetical protein AWE61_12960 [Escherichia coli]
gb|KUS08021.1| hypothetical protein AWE62_08200 [Escherichia coli]
gb|KUS08135.1| hypothetical protein AWE59_00405 [Escherichia coli]
gb|KUS26905.1| hypothetical protein AWE68_07560 [Escherichia coli]
gb|KUS30053.1| hypothetical protein AWE67_13845 [Escherichia coli]
gb|KUS31756.1| hypothetical protein AWE56_04810 [Escherichia coli]
gb|KUS33659.1| hypothetical protein AWE69_06835 [Escherichia coli]
gb|KUS44213.1| hypothetical protein AWE55_01075 [Escherichia coli]
gb|KUS47838.1| hypothetical protein AWE70_06265 [Escherichia coli]
gb|KUS55264.1| hypothetical protein AWE72_00845 [Escherichia coli]
gb|KUS56167.1| hypothetical protein AWE71_05870 [Escherichia coli]
gb|KUS61895.1| hypothetical protein AWE60_06270 [Escherichia coli]
gb|KUS64063.1| hypothetical protein AWE53_07580 [Escherichia coli]
gb|KUS73167.1| hypothetical protein AWE73_07310 [Escherichia coli]
gb|KUS75647.1| hypothetical protein AWE76_20190 [Escherichia coli]
gb|KUS76085.1| hypothetical protein AWE77_08445 [Escherichia coli]
gb|KUS79914.1| hypothetical protein AWE78_14895 [Escherichia coli]
gb|KUS89128.1| hypothetical protein AWE74_03105 [Escherichia coli]
gb|KUS96498.1| hypothetical protein AWE81_05560 [Escherichia coli]
gb|KUT02357.1| hypothetical protein AWE79_04960 [Escherichia coli]
gb|KUT06144.1| hypothetical protein AWE80_08710 [Escherichia coli]
gb|KUT07794.1| hypothetical protein AWE83_03215 [Escherichia coli]
gb|KUT17808.1| hypothetical protein AWE82_06825 [Escherichia coli]
gb|KUT25005.1| hypothetical protein AWE84_10290 [Escherichia coli]
gb|KUT25929.1| hypothetical protein AWE95_03660 [Escherichia coli]
gb|KUT26836.1| hypothetical protein AWE58_09310 [Escherichia coli]
gb|KUT36563.1| hypothetical protein AWE98_18055 [Escherichia coli]
gb|KUT43825.1| hypothetical protein AWE96_05960 [Escherichia coli]
gb|KUT49346.1| hypothetical protein AWE97_23680 [Escherichia coli]
gb|KUT51608.1| hypothetical protein AWE99_10175 [Escherichia coli]
gb|KUT57738.1| hypothetical protein AWF02_03425 [Escherichia coli]
gb|KUT59992.1| hypothetical protein AWF00_07290 [Escherichia coli]
gb|KUT62765.1| hypothetical protein AWF01_00795 [Escherichia coli]
gb|KUT65232.1| hypothetical protein AWF03_15975 [Escherichia coli]
gb|KUT69700.1| hypothetical protein AWF05_15765 [Escherichia coli]
gb|KUT78513.1| hypothetical protein AWF07_05260 [Escherichia coli]
gb|KUT89010.1| hypothetical protein AWF08_11630 [Escherichia coli]
gb|KUT99222.1| hypothetical protein AWF09_08905 [Escherichia coli]
gb|KUU00369.1| hypothetical protein AWF12_07565 [Escherichia coli]
gb|KUU01193.1| hypothetical protein AWF11_05430 [Escherichia coli]
gb|KUU08244.1| hypothetical protein AWF15_12435 [Escherichia coli]
gb|KUU12791.1| hypothetical protein AWF16_00415 [Escherichia coli]
gb|KUU15867.1| hypothetical protein AWF13_04430 [Escherichia coli]
gb|KUU30040.1| hypothetical protein AWF17_09500 [Escherichia coli]
gb|KUU31594.1| hypothetical protein AWF18_07295 [Escherichia coli]
gb|KUU40538.1| hypothetical protein AWF20_00875 [Escherichia coli]
gb|KUU45504.1| hypothetical protein AWF21_09575 [Escherichia coli]
gb|KUU46623.1| hypothetical protein AWF22_23050 [Escherichia coli]
gb|KUU50684.1| hypothetical protein AWF23_07925 [Escherichia coli]
gb|KUU60941.1| hypothetical protein AWF26_14080 [Escherichia coli]
gb|KUU62536.1| hypothetical protein AWF24_06205 [Escherichia coli]
gb|KUU64608.1| hypothetical protein AWF29_04825 [Escherichia coli]
gb|KUU70394.1| hypothetical protein AWF27_17820 [Escherichia coli]
gb|KUU76335.1| hypothetical protein AWF32_17085 [Escherichia coli]
gb|KUU79017.1| hypothetical protein AWF30_08430 [Escherichia coli]
gb|KUU81637.1| hypothetical protein AWF33_10230 [Escherichia coli]
gb|KUU84261.1| hypothetical protein AWF34_09880 [Escherichia coli]
gb|KUU93377.1| hypothetical protein AWF35_15525 [Escherichia coli]
gb|KUU98361.1| hypothetical protein AWF36_08615 [Escherichia coli]
gb|KUV10732.1| hypothetical protein AWF37_08515 [Escherichia coli]
gb|KUV11345.1| hypothetical protein AWF38_07655 [Escherichia coli]
gb|KUV14528.1| hypothetical protein AWF40_15470 [Escherichia coli]
gb|KUV19677.1| hypothetical protein AWF41_15920 [Escherichia coli]
gb|KUV23093.1| hypothetical protein AWF39_05505 [Escherichia coli]
gb|KUV32334.1| hypothetical protein AWF43_10845 [Escherichia coli]
gb|KUV34144.1| hypothetical protein AWF44_15635 [Escherichia coli]
gb|KUV37977.1| hypothetical protein AWF42_05235 [Escherichia coli]
gb|KUV42580.1| hypothetical protein AWE91_16560 [Escherichia coli]
gb|KUV53047.1| hypothetical protein AWE89_03850 [Escherichia coli]
gb|KUV60211.1| hypothetical protein AWF45_08185 [Escherichia coli]
gb|KUV63388.1| hypothetical protein AWE93_06805 [Escherichia coli]
gb|KUV63843.1| hypothetical protein AWF46_17900 [Escherichia coli]
gb|KUV66958.1| hypothetical protein AWF47_20265 [Escherichia coli]
gb|KUV80644.1| hypothetical protein AWF48_04800 [Escherichia coli]
gb|KUV82832.1| hypothetical protein AWF49_10870 [Escherichia coli]
gb|KUV85021.1| hypothetical protein AWF50_14970 [Escherichia coli]
gb|KUV90709.1| hypothetical protein AWF51_07235 [Escherichia coli]
gb|KUV92550.1| hypothetical protein AWF52_16470 [Escherichia coli]
gb|KUV98063.1| hypothetical protein AWF53_03375 [Escherichia coli]
gb|KUW00986.1| hypothetical protein AWF54_12815 [Escherichia coli]
gb|KUW07119.1| hypothetical protein AWF55_12850 [Escherichia coli]
gb|KUW24677.1| hypothetical protein AWF59_08950 [Escherichia coli]
gb|KUW25721.1| hypothetical protein AWF58_06420 [Escherichia coli]
gb|KUW30800.1| hypothetical protein AWF62_16215 [Escherichia coli]
gb|KUW33330.1| hypothetical protein AWF61_08710 [Escherichia coli]
gb|KUW39382.1| hypothetical protein AWF60_04025 [Escherichia coli]
gb|KUW46109.1| hypothetical protein AWF64_12830 [Escherichia coli]
gb|KUW47740.1| hypothetical protein AWF65_12735 [Escherichia coli]
gb|KUW48715.1| hypothetical protein AWF63_08625 [Escherichia coli]
gb|KUW54188.1| hypothetical protein AWF66_18680 [Escherichia coli]
gb|KUW60435.1| hypothetical protein AWF68_13780 [Escherichia coli]
gb|KUW69187.1| hypothetical protein AWF67_22285 [Escherichia coli]
gb|KUW80722.1| hypothetical protein AWF69_04905 [Escherichia coli]
gb|KUW87418.1| hypothetical protein AWF72_14990 [Escherichia coli]
gb|KUW95194.1| hypothetical protein AWF75_16110 [Escherichia coli]
gb|KUW96805.1| hypothetical protein AWF73_07800 [Escherichia coli]
gb|KUX00533.1| hypothetical protein AWF74_09115 [Escherichia coli]
gb|KUX03113.1| hypothetical protein AWF77_19985 [Escherichia coli]
gb|KUX08730.1| hypothetical protein AWF76_07425 [Escherichia coli]
gb|KUX12918.1| hypothetical protein AWF78_10005 [Escherichia coli]
gb|KUX17951.1| hypothetical protein AWF79_12105 [Escherichia coli]
gb|KUX23147.1| hypothetical protein AWF80_07930 [Escherichia coli]
gb|KUX24903.1| hypothetical protein AWF81_13345 [Escherichia coli]
gb|KUX31844.1| hypothetical protein AWF82_02565 [Escherichia coli]
gb|KUX40197.1| hypothetical protein AWF85_00065 [Escherichia coli]
gb|KUX42770.1| hypothetical protein AWF86_15990 [Escherichia coli]
gb|KUX45925.1| hypothetical protein AWF83_21665 [Escherichia coli]
gb|KUX53606.1| hypothetical protein AWF87_09290 [Escherichia coli]
gb|KUX62708.1| hypothetical protein AWF88_20590 [Escherichia coli]
gb|KUX64376.1| hypothetical protein AWF89_06895 [Escherichia coli]
gb|KUX66788.1| hypothetical protein AWF91_17500 [Escherichia coli]
gb|KUX71110.1| hypothetical protein AWF90_07825 [Escherichia coli]
gb|KUX73828.1| hypothetical protein AWF92_19095 [Escherichia coli]
gb|KUX79622.1| hypothetical protein AWF94_05015 [Escherichia coli]
gb|KUX84089.1| hypothetical protein AWF93_14710 [Escherichia coli]
gb|KUX89039.1| hypothetical protein AWF95_14735 [Escherichia coli]
gb|KUX98277.1| hypothetical protein AWF96_00150 [Escherichia coli]
gb|KUX98706.1| hypothetical protein AWF97_17110 [Escherichia coli]
gb|KUY07826.1| hypothetical protein AWF98_08305 [Escherichia coli]
gb|KUY10500.1| hypothetical protein AWF99_15450 [Escherichia coli]
gb|KVI22556.1| hypothetical protein AWF31_22825 [Escherichia coli]
gb|KVI23136.1| hypothetical protein AWE90_07325 [Escherichia coli]
gb|KVI24061.1| hypothetical protein AWF84_06860 [Escherichia coli]
gb|KWV17387.1| hypothetical protein AWH70_03365 [Escherichia coli]
gb|AMB55259.1| hypothetical protein AWB62_16750 [Escherichia coli]
gb|KWW01917.1| hypothetical protein VK87_0211100 [Escherichia fergusonii]
gb|KWW02505.1| hypothetical protein VP22_0202325 [Escherichia fergusonii]
gb|KWW09168.1| hypothetical protein VL22_0218940 [Escherichia fergusonii]
gb|AMC97880.1| hypothetical protein AW869_17295 [Escherichia coli str. K-12
substr. MG1655]
gb|KXC13609.1| hypothetical protein AWE30_00495 [Escherichia coli]
gb|AMG16112.1| hypothetical protein AL477_12285 [Shigella sonnei]
gb|AMG79634.1| hypothetical protein JEONG1266_16880 [Escherichia coli O157:H7]
gb|AMH21563.1| hypothetical protein C2566_06840 [Escherichia coli B]
gb|AMH25774.1| hypothetical protein C3029_06840 [Escherichia coli B]
gb|AMH29400.1| hypothetical protein DHB4_02980 [Escherichia coli K-12]
gb|AMH33963.1| hypothetical protein C3026_03215 [Escherichia coli K-12]
gb|KXG62135.1| hypothetical protein LT31_00907 [Escherichia coli]
gb|KXG63397.1| hypothetical protein LT29_02083 [Escherichia coli]
gb|KXG67824.1| hypothetical protein LT28_00583 [Escherichia coli]
gb|KXG70521.1| hypothetical protein LT30_03108 [Escherichia coli]
gb|AMF88383.1| hypothetical protein AL551_08815 [Escherichia coli]
gb|KXG91549.1| hypothetical protein HMPREF3041_04316 [Escherichia coli]
gb|KXG91737.1| hypothetical protein HMPREF3040_04670 [Escherichia coli]
gb|KXH91947.1| hypothetical protein AXE67_03195 [Escherichia coli]
gb|KXH93143.1| hypothetical protein AXE68_05470 [Escherichia coli]
gb|KXH97226.1| hypothetical protein AXE66_15505 [Escherichia coli]
gb|KXI08029.1| hypothetical protein AXE69_14025 [Escherichia coli]
emb|CUW02996.1| hypothetical protein JF733_0587 [Escherichia coli]
gb|AMK98520.1| hypothetical protein AWN69_00145 [Escherichia coli str. K-12
substr. MG1655]
gb|AML03813.1| hypothetical protein AVR74_03030 [Escherichia coli]
gb|AML08772.1| hypothetical protein AVR75_03055 [Escherichia coli]
gb|AML13378.1| hypothetical protein AVR72_03245 [Escherichia coli]
gb|AML18344.1| hypothetical protein AVR69_03250 [Escherichia coli]
gb|KXK73502.1| hypothetical protein AUS51_22545 [Escherichia coli]
gb|KXK78480.1| hypothetical protein AUS52_18135 [Escherichia coli]
gb|KXK81860.1| hypothetical protein AUS13_01175 [Escherichia coli]
gb|KXK94091.1| hypothetical protein AXH17_23080 [Escherichia coli]
gb|KXK99379.1| hypothetical protein AXH15_23780 [Escherichia coli]
gb|KXL01500.1| hypothetical protein AXH20_08830 [Escherichia coli]
gb|KXL09569.1| hypothetical protein AXH13_19005 [Escherichia coli]
gb|KXL14597.1| hypothetical protein AXH19_17585 [Escherichia coli]
gb|KXL15789.1| hypothetical protein AXH11_10630 [Escherichia coli]
gb|KXL16970.1| hypothetical protein AXH16_17425 [Escherichia coli]
gb|KXL27304.1| hypothetical protein AXH14_22405 [Escherichia coli]
gb|KXL27957.1| hypothetical protein AXH10_07130 [Escherichia coli]
gb|KXL30338.1| hypothetical protein AXH12_13785 [Escherichia coli]
gb|KXL37372.1| hypothetical protein AXH18_21730 [Escherichia coli]
gb|KXL57834.1| hypothetical protein AUS12_19830 [Escherichia coli]
gb|KXL62885.1| hypothetical protein AUS22_11285 [Escherichia coli]
gb|KXL65648.1| hypothetical protein AUS26_05720 [Escherichia coli]
gb|KXL76841.1| hypothetical protein AUS15_02500 [Escherichia coli]
gb|KXL80430.1| hypothetical protein AUS48_08375 [Escherichia coli]
gb|KXL86384.1| hypothetical protein AUS14_04275 [Escherichia coli]
gb|KXL90447.1| hypothetical protein AUS49_04305 [Escherichia coli]
gb|KXL92423.1| hypothetical protein AUS16_00330 [Escherichia coli]
gb|KXL96874.1| hypothetical protein AUS17_10280 [Escherichia coli]
gb|KXM12803.1| hypothetical protein AUS19_09850 [Escherichia coli]
gb|KXM13421.1| hypothetical protein AUS50_06090 [Escherichia coli]
gb|KXM14017.1| hypothetical protein AUS24_12575 [Escherichia coli]
gb|KXM22508.1| hypothetical protein AUS20_14960 [Escherichia coli]
gb|KXM23210.1| hypothetical protein AUS21_17360 [Escherichia coli]
gb|KXM26372.1| hypothetical protein AUS25_13675 [Escherichia coli]
gb|KXM35813.1| hypothetical protein AUS23_11420 [Escherichia coli]
gb|KXM40703.1| hypothetical protein AUS29_01620 [Escherichia coli]
gb|KXM40839.1| hypothetical protein AUS28_18170 [Escherichia coli]
gb|KXM54272.1| hypothetical protein AUS30_14955 [Escherichia coli]
gb|KXM58164.1| hypothetical protein AUS32_13485 [Escherichia coli]
gb|KXM64248.1| hypothetical protein AUS33_03770 [Escherichia coli]
gb|KXM69579.1| hypothetical protein AUS34_17745 [Escherichia coli]
gb|KXM76273.1| hypothetical protein AUS31_06195 [Escherichia coli]
gb|KXM79195.1| hypothetical protein AUS36_13120 [Escherichia coli]
gb|KXM88391.1| hypothetical protein AUS41_11290 [Escherichia coli]
gb|KXM91554.1| hypothetical protein AUS39_10270 [Escherichia coli]
gb|KXM94694.1| hypothetical protein AUS37_12735 [Escherichia coli]
gb|KXN00452.1| hypothetical protein AUS46_01960 [Escherichia coli]
gb|KXN08245.1| hypothetical protein AUS38_06255 [Escherichia coli]
gb|KXN10687.1| hypothetical protein AUS47_10205 [Escherichia coli]
gb|KXN21551.1| hypothetical protein AUS18_19580 [Escherichia coli]
gb|KXN23179.1| hypothetical protein AUS40_16440 [Escherichia coli]
gb|KXN31300.1| hypothetical protein AUS45_26410 [Escherichia coli]
gb|KXN36079.1| hypothetical protein AUS35_00795 [Escherichia coli]
gb|KXN38141.1| hypothetical protein AUS42_11315 [Escherichia coli]
gb|KXN43744.1| hypothetical protein AUS53_07735 [Escherichia coli]
gb|KXN48178.1| hypothetical protein AUS44_13690 [Escherichia coli]
gb|KXN50983.1| hypothetical protein AUS43_02030 [Escherichia coli]
gb|KXN56905.1| hypothetical protein AUS27_17525 [Escherichia coli]
gb|KXP17107.1| hypothetical protein AUQ36_22645 [Escherichia coli]
gb|KXP17713.1| hypothetical protein AUP75_19035 [Escherichia coli]
gb|KXP20048.1| hypothetical protein AUP76_11560 [Escherichia coli]
gb|KXP32480.1| hypothetical protein AUQ35_17105 [Escherichia coli]
gb|KXP35765.1| hypothetical protein AUP97_18270 [Escherichia coli]
gb|KXP38282.1| hypothetical protein AUP79_03660 [Escherichia coli]
gb|KXP46177.1| hypothetical protein AUQ30_11865 [Escherichia coli]
gb|KXP50867.1| hypothetical protein AUQ34_16035 [Escherichia coli]
gb|KXP51522.1| hypothetical protein AUQ19_13915 [Escherichia coli]
gb|KXP59351.1| hypothetical protein AUP86_09530 [Escherichia coli]
gb|KXP62362.1| hypothetical protein AUP84_18005 [Escherichia coli]
gb|KXP69827.1| hypothetical protein AUP82_07985 [Escherichia coli]
gb|KXP73305.1| hypothetical protein AUQ08_09575 [Escherichia coli]
gb|KXP79261.1| hypothetical protein AUP83_00595 [Escherichia coli]
gb|KXP83279.1| hypothetical protein AUP80_20310 [Escherichia coli]
gb|KXP86062.1| hypothetical protein AUP77_09210 [Escherichia coli]
gb|KXP88222.1| hypothetical protein AUP78_00330 [Escherichia coli]
gb|KXP94057.1| hypothetical protein AUP90_19125 [Escherichia coli]
gb|KXP94743.1| hypothetical protein AUP87_20200 [Escherichia coli]
gb|KXP97126.1| hypothetical protein AUP85_11415 [Escherichia coli]
gb|KXQ06524.1| hypothetical protein AUP98_20080 [Escherichia coli]
gb|KXQ14689.1| hypothetical protein AUP96_01815 [Escherichia coli]
gb|KXQ17022.1| hypothetical protein AUP95_14715 [Escherichia coli]
gb|KXQ18792.1| hypothetical protein AUP92_15700 [Escherichia coli]
gb|KXQ25962.1| hypothetical protein AUP94_12240 [Escherichia coli]
gb|KXQ32036.1| hypothetical protein AUQ03_09965 [Escherichia coli]
gb|KXQ32811.1| hypothetical protein AUP88_14935 [Escherichia coli]
gb|KXQ40068.1| hypothetical protein AUQ01_10650 [Escherichia coli]
gb|KXQ45339.1| hypothetical protein AUP89_12905 [Escherichia coli]
gb|KXQ48242.1| hypothetical protein AUP93_14060 [Escherichia coli]
gb|KXQ52231.1| hypothetical protein AUQ04_19670 [Escherichia coli]
gb|KXQ55445.1| hypothetical protein AUQ09_17965 [Escherichia coli]
gb|KXQ63277.1| hypothetical protein AUQ00_20690 [Escherichia coli]
gb|KXQ65398.1| hypothetical protein AUQ07_05345 [Escherichia coli]
gb|KXQ69626.1| hypothetical protein AUQ10_20050 [Escherichia coli]
gb|KXQ78487.1| hypothetical protein AUQ18_17755 [Escherichia coli]
gb|KXQ85407.1| hypothetical protein AUQ02_10240 [Escherichia coli]
gb|KXQ88325.1| hypothetical protein AUQ06_19820 [Escherichia coli]
gb|KXQ96890.1| hypothetical protein AUQ17_08565 [Escherichia coli]
gb|KXQ97857.1| hypothetical protein AUQ05_15380 [Escherichia coli]
gb|KXR04382.1| hypothetical protein AUQ14_16040 [Escherichia coli]
gb|KXR09244.1| hypothetical protein AUQ12_17790 [Escherichia coli]
gb|KXR11049.1| hypothetical protein AUQ15_08745 [Escherichia coli]
gb|KXR18416.1| hypothetical protein AUQ21_20730 [Escherichia coli]
gb|KXR23842.1| hypothetical protein AUQ16_01985 [Escherichia coli]
gb|KXR29385.1| hypothetical protein AUQ20_08430 [Escherichia coli]
gb|KXR30065.1| hypothetical protein AUQ24_20175 [Escherichia coli]
gb|KXR34178.1| hypothetical protein AUQ22_11045 [Escherichia coli]
gb|KXR41246.1| hypothetical protein AUQ31_22750 [Escherichia coli]
gb|KXR41472.1| hypothetical protein AUQ27_15605 [Escherichia coli]
gb|KXR52427.1| hypothetical protein AUQ26_06380 [Escherichia coli]
gb|KXR54730.1| hypothetical protein AUQ11_21255 [Escherichia coli]
gb|KXR55498.1| hypothetical protein AUQ32_16520 [Escherichia coli]
gb|KXR57629.1| hypothetical protein AUQ28_21200 [Escherichia coli]
gb|KXR68666.1| hypothetical protein AUQ33_19430 [Escherichia coli]
gb|KXR74147.1| hypothetical protein AUQ23_08380 [Escherichia coli]
gb|KXR78574.1| hypothetical protein AUQ29_22560 [Escherichia coli]
gb|KXR79345.1| hypothetical protein AUQ25_18070 [Escherichia coli]
gb|KXR87072.1| hypothetical protein AUQ13_21630 [Escherichia coli]
gb|KXR94469.1| hypothetical protein AUP91_19835 [Escherichia coli]
gb|KXR96611.1| hypothetical protein AUP81_18675 [Escherichia coli]
gb|AMM35426.1| hypothetical protein AVR76_03250 [Escherichia coli]
emb|CUU92653.1| conserved hypothetical protein [Escherichia coli]
gb|KXU68986.1| hypothetical protein AWN71_23150 [Escherichia coli]
gb|KXU72075.1| hypothetical protein AWN70_00905 [Escherichia coli]
gb|KXU75283.1| hypothetical protein AWN72_08570 [Escherichia coli]
emb|CUX86023.1| conserved hypothetical protein [Escherichia coli]
gb|AMQ50217.1| hypothetical protein AX202_03240 [Escherichia coli JJ1887]
gb|AMR22388.1| hypothetical protein A0259_06905 [Shigella sp. PAMC 28760]
gb|KYL41202.1| hypothetical protein ECEG1_03395 [Escherichia coli]
gb|KYN61114.1| hypothetical protein AZ620_13025 [Escherichia coli]
gb|KYN62221.1| hypothetical protein AZ625_11910 [Escherichia coli]
gb|KYO64239.1| hypothetical protein LT27_03675 [Escherichia coli]
gb|KYO71588.1| hypothetical protein LT26_01756 [Escherichia coli]
gb|KYR16505.1| hypothetical protein AMK98_07330 [Escherichia coli]
gb|KYR17800.1| hypothetical protein AMK99_05690 [Escherichia coli]
gb|KYR19944.1| hypothetical protein AML01_20155 [Escherichia coli]
gb|KYR23983.1| hypothetical protein AML03_25665 [Escherichia coli]
gb|KYR29913.1| hypothetical protein AML02_10225 [Escherichia coli]
gb|KYR35402.1| hypothetical protein AML04_21985 [Escherichia coli]
gb|KYR36106.1| hypothetical protein AML05_22885 [Escherichia coli]
gb|KYR46135.1| hypothetical protein AML06_16615 [Escherichia coli]
gb|KYR56714.1| hypothetical protein AML08_20710 [Escherichia coli]
gb|KYR61016.1| hypothetical protein AML09_15290 [Escherichia coli]
gb|KYR72183.1| hypothetical protein AML10_11470 [Escherichia coli]
gb|KYR73483.1| hypothetical protein AML11_02685 [Escherichia coli]
gb|KYR79216.1| hypothetical protein AML12_15520 [Escherichia coli]
gb|KYR81674.1| hypothetical protein AML13_11745 [Escherichia coli]
gb|KYR97913.1| hypothetical protein AML15_06025 [Escherichia coli]
gb|KYS05580.1| hypothetical protein AML17_10500 [Escherichia coli]
gb|KYS06455.1| hypothetical protein AML18_14175 [Escherichia coli]
gb|KYS07281.1| hypothetical protein AML16_00865 [Escherichia coli]
gb|KYS14272.1| hypothetical protein AML20_21145 [Escherichia coli]
gb|KYS23249.1| hypothetical protein AML21_15820 [Escherichia coli]
gb|KYS30775.1| hypothetical protein AML22_00720 [Escherichia coli]
gb|KYS33346.1| hypothetical protein AML24_20615 [Escherichia coli]
gb|KYS43881.1| hypothetical protein AML23_08855 [Escherichia coli]
gb|KYS44438.1| hypothetical protein AML25_08515 [Escherichia coli]
gb|KYS48941.1| hypothetical protein AML26_12700 [Escherichia coli]
gb|KYS58999.1| hypothetical protein AML27_02860 [Escherichia coli]
gb|KYS61158.1| hypothetical protein AML28_07730 [Escherichia coli]
gb|KYS77749.1| hypothetical protein AML33_19685 [Escherichia coli]
gb|KYS84627.1| hypothetical protein AML34_16465 [Escherichia coli]
gb|KYS90046.1| hypothetical protein AML35_19515 [Escherichia coli]
gb|KYS95341.1| hypothetical protein AML40_12160 [Escherichia coli]
gb|KYS99783.1| hypothetical protein AML41_13780 [Escherichia coli]
gb|KYT08169.1| hypothetical protein AML43_18930 [Escherichia coli]
gb|KYT16639.1| hypothetical protein AML44_07325 [Escherichia coli]
gb|KYT21149.1| hypothetical protein AML47_26150 [Escherichia coli]
gb|KYT26009.1| hypothetical protein AML46_06990 [Escherichia coli]
gb|KYT29737.1| hypothetical protein AML48_08725 [Escherichia coli]
gb|KYT34301.1| hypothetical protein AML29_05045 [Escherichia coli]
gb|KYT34612.1| hypothetical protein AML51_20610 [Escherichia coli]
gb|KYT49451.1| hypothetical protein AML45_19295 [Escherichia coli]
gb|KYT52086.1| hypothetical protein AML38_05990 [Escherichia coli]
gb|KYT54305.1| hypothetical protein AML49_17240 [Escherichia coli]
gb|KYT68685.1| hypothetical protein AML52_16615 [Escherichia coli]
gb|KYT76122.1| hypothetical protein AML54_04600 [Escherichia coli]
gb|KYT77128.1| hypothetical protein AML60_13695 [Escherichia coli]
gb|KYT82422.1| hypothetical protein AML78_21210 [Escherichia coli]
gb|KYT84678.1| hypothetical protein AML64_16390 [Escherichia coli]
gb|KYT94770.1| hypothetical protein AML55_07915 [Escherichia coli]
gb|KYT96157.1| hypothetical protein AML53_21740 [Escherichia coli]
gb|KYU07188.1| hypothetical protein AML66_00275 [Escherichia coli]
gb|KYU08662.1| hypothetical protein AML57_24005 [Escherichia coli]
gb|KYU17507.1| hypothetical protein AML58_13315 [Escherichia coli]
gb|KYU23175.1| hypothetical protein AML61_04400 [Escherichia coli]
gb|KYU25693.1| hypothetical protein AML59_20345 [Escherichia coli]
gb|KYU32845.1| hypothetical protein AML62_15225 [Escherichia coli]
gb|KYU45141.1| hypothetical protein AML65_01265 [Escherichia coli]
gb|KYU51799.1| hypothetical protein AML67_08960 [Escherichia coli]
gb|KYU55840.1| hypothetical protein AML72_03295 [Escherichia coli]
gb|KYU59820.1| hypothetical protein AML68_13760 [Escherichia coli]
gb|KYU63414.1| hypothetical protein AML73_07590 [Escherichia coli]
gb|KYU74212.1| hypothetical protein AML74_09175 [Escherichia coli]
gb|KYU76833.1| hypothetical protein AML75_13925 [Escherichia coli]
gb|KYU83633.1| hypothetical protein AML76_05970 [Escherichia coli]
gb|KYU90886.1| hypothetical protein AML77_12620 [Escherichia coli]
gb|KYU92113.1| hypothetical protein AML79_23550 [Escherichia coli]
gb|KYU99625.1| hypothetical protein AML80_13870 [Escherichia coli]
gb|KYV03442.1| hypothetical protein AML81_01430 [Escherichia coli]
gb|KYV06384.1| hypothetical protein AML69_13940 [Escherichia coli]
gb|KYV13617.1| hypothetical protein AML36_24165 [Escherichia coli]
gb|KYV14143.1| hypothetical protein AML70_21360 [Escherichia coli]
gb|KYV27015.1| hypothetical protein AML37_16310 [Escherichia coli]
gb|KYV30886.1| hypothetical protein AML39_11610 [Escherichia coli]
gb|KYV32694.1| hypothetical protein AMK77_12340 [Escherichia coli]
gb|KYV40875.1| hypothetical protein AMK76_17985 [Escherichia coli]
gb|KYV47269.1| hypothetical protein AMK78_21140 [Escherichia coli]
gb|KYV48461.1| hypothetical protein AMK79_01555 [Escherichia coli]
gb|KYV52759.1| hypothetical protein AMK80_17645 [Escherichia coli]
gb|KYV56725.1| hypothetical protein AMK81_08275 [Escherichia coli]
gb|KYV67220.1| hypothetical protein AMK82_08490 [Escherichia coli]
gb|KYV73311.1| hypothetical protein AMK84_02040 [Escherichia coli]
gb|KYV79904.1| hypothetical protein AMK85_18045 [Escherichia coli]
gb|KYV80940.1| hypothetical protein AMK86_19355 [Escherichia coli]
gb|KYV95463.1| hypothetical protein AMK89_24305 [Escherichia coli]
gb|KYV98490.1| hypothetical protein AMK90_19525 [Escherichia coli]
gb|KYW08336.1| hypothetical protein AMK91_20400 [Escherichia coli]
gb|KYW18757.1| hypothetical protein AMK93_14965 [Escherichia coli]
gb|KYW28779.1| hypothetical protein AMK95_01865 [Escherichia coli]
gb|KYW32149.1| hypothetical protein AMK92_08170 [Escherichia coli]
gb|KYW35338.1| hypothetical protein AMK94_05955 [Escherichia coli]
gb|KYW42125.1| hypothetical protein AMK97_19135 [Escherichia coli]
gb|KYW44151.1| hypothetical protein AMK96_09310 [Escherichia coli]
gb|KYW52266.1| hypothetical protein AML83_16475 [Escherichia coli]
gb|KYW53943.1| hypothetical protein AML82_09130 [Escherichia coli]
gb|KYW56172.1| hypothetical protein AML84_03975 [Escherichia coli]
gb|KYW64061.1| hypothetical protein AML85_16495 [Escherichia coli]
gb|KYW75784.1| hypothetical protein AML87_15820 [Escherichia coli]
gb|KYW80556.1| hypothetical protein AML88_12445 [Escherichia coli]
gb|AMU81312.1| hypothetical protein Y979_03665 [Escherichia coli str. Sanji]
gb|KYZ93580.1| hypothetical protein ACM49_05745 [Escherichia coli]
gb|KYZ97984.1| hypothetical protein ACM47_12030 [Escherichia coli]
gb|KYZ98453.1| hypothetical protein ACM48_18720 [Escherichia coli]
gb|AMW44881.1| hypothetical protein ARC77_22835 [Escherichia coli]
gb|AMW50278.1| hypothetical protein AR439_21560 [Escherichia coli]
gb|AMX12261.1| hypothetical protein A4X18_01675 [Escherichia coli]
gb|AMX32612.1| hypothetical protein A4R39_21075 [Escherichia coli]
gb|AMX37327.1| hypothetical protein A4R38_20260 [Escherichia coli]
gb|AMX38647.1| hypothetical protein A4R37_01065 [Escherichia coli]
gb|KZF36776.1| hypothetical protein AZE29_06480 [Escherichia coli APEC O2]
gb|KZH00569.1| hypothetical protein AWG39_23835 [Escherichia coli]
gb|KZH01032.1| hypothetical protein AWG47_15125 [Escherichia coli]
gb|KZH07038.1| hypothetical protein AWG42_20035 [Escherichia coli]
gb|KZH10248.1| hypothetical protein AWG44_15890 [Escherichia coli]
gb|KZH15402.1| hypothetical protein AWG35_06370 [Escherichia coli]
gb|KZH20445.1| hypothetical protein AWG33_07115 [Escherichia coli]
gb|KZH23402.1| hypothetical protein AWG38_18340 [Escherichia coli]
gb|KZH34829.1| hypothetical protein AWG36_16255 [Escherichia coli]
gb|KZH36480.1| hypothetical protein AWG37_15205 [Escherichia coli]
gb|KZH42494.1| hypothetical protein AWG54_09425 [Escherichia coli]
gb|KZH47494.1| hypothetical protein AWG57_15450 [Escherichia coli]
gb|KZH52354.1| hypothetical protein AWG43_21285 [Escherichia coli]
gb|KZH53024.1| hypothetical protein AWG40_25330 [Escherichia coli]
gb|KZH56754.1| hypothetical protein AWG49_24925 [Escherichia coli]
gb|KZH72761.1| hypothetical protein AWG53_01285 [Escherichia coli]
gb|KZH73106.1| hypothetical protein AWG51_13055 [Escherichia coli]
gb|KZH74853.1| hypothetical protein AWG48_15730 [Escherichia coli]
gb|KZH75649.1| hypothetical protein AWG52_04835 [Escherichia coli]
gb|KZH83200.1| hypothetical protein AWG59_05710 [Escherichia coli]
gb|KZH86585.1| hypothetical protein AWG56_07680 [Escherichia coli]
gb|KZH94007.1| hypothetical protein AWG61_06710 [Escherichia coli]
gb|KZI01901.1| hypothetical protein AWG58_26240 [Escherichia coli]
gb|KZI08575.1| hypothetical protein AWG60_04490 [Escherichia coli]
gb|KZI15581.1| hypothetical protein AWG67_10570 [Escherichia coli]
gb|KZI16551.1| hypothetical protein AWG50_24535 [Escherichia coli]
gb|KZI21218.1| hypothetical protein AWG64_11215 [Escherichia coli]
gb|KZI32076.1| hypothetical protein AWG62_04010 [Escherichia coli]
gb|KZI32302.1| hypothetical protein AWG66_25145 [Escherichia coli]
gb|KZI34019.1| hypothetical protein AWG75_19025 [Escherichia coli]
gb|KZI38985.1| hypothetical protein AWG72_20700 [Escherichia coli]
gb|KZI44034.1| hypothetical protein AWG68_08870 [Escherichia coli]
gb|KZI45426.1| hypothetical protein AWG78_11505 [Escherichia coli]
gb|KZI52242.1| hypothetical protein AWG65_21810 [Escherichia coli]
gb|KZI63222.1| hypothetical protein AWG70_07685 [Escherichia coli]
gb|KZI65348.1| hypothetical protein AWG71_21255 [Escherichia coli]
gb|KZI68065.1| hypothetical protein AWG69_03570 [Escherichia coli]
gb|KZI69125.1| hypothetical protein AWG74_13800 [Escherichia coli]
gb|KZI77260.1| hypothetical protein AWG77_15740 [Escherichia coli]
gb|KZI81580.1| hypothetical protein AWG81_19085 [Escherichia coli]
gb|KZI81942.1| hypothetical protein AWG76_07615 [Escherichia coli]
gb|KZI90245.1| hypothetical protein AWG85_09560 [Escherichia coli]
gb|KZI96050.1| hypothetical protein AWG84_03765 [Escherichia coli]
gb|KZJ08650.1| hypothetical protein AWG89_06545 [Escherichia coli]
gb|KZJ11595.1| hypothetical protein AWG93_18970 [Escherichia coli]
gb|KZJ13073.1| hypothetical protein AWG88_06185 [Escherichia coli]
gb|KZJ14683.1| hypothetical protein AWG79_14545 [Escherichia coli]
gb|KZJ21836.1| hypothetical protein AWG73_11050 [Escherichia coli]
gb|KZJ28875.1| hypothetical protein AWG87_16425 [Escherichia coli]
gb|KZJ29851.1| hypothetical protein AWG83_10845 [Escherichia coli]
gb|KZJ35709.1| hypothetical protein AWG80_12500 [Escherichia coli]
gb|KZJ41294.1| hypothetical protein AWG92_18330 [Escherichia coli]
gb|KZJ48364.1| hypothetical protein AWG90_00455 [Escherichia coli]
gb|KZJ55271.1| hypothetical protein AWG98_10695 [Escherichia coli]
gb|KZJ60601.1| hypothetical protein AWG86_10270 [Escherichia coli]
gb|KZJ71209.1| hypothetical protein AWG99_26260 [Escherichia coli]
gb|KZJ75028.1| hypothetical protein AWG91_12480 [Escherichia coli]
gb|KZJ75229.1| hypothetical protein AWG95_01830 [Escherichia coli]
gb|KZJ86657.1| hypothetical protein AWG97_08965 [Escherichia coli]
gb|KZJ87137.1| hypothetical protein AWG94_14330 [Escherichia coli]
gb|KZJ91393.1| hypothetical protein AWG96_11575 [Escherichia coli]
gb|KZK00839.1| hypothetical protein AWH00_03725 [Escherichia coli]
gb|KZO66338.1| hypothetical protein AAW07_17105 [Escherichia coli]
gb|KZO76775.1| hypothetical protein TH56_06735 [Escherichia coli]
gb|KZO78015.1| hypothetical protein AAW05_18245 [Escherichia coli]
gb|KZO83942.1| hypothetical protein TH54_13270 [Escherichia coli]
gb|KZO89158.1| hypothetical protein TH55_00535 [Escherichia coli]
gb|KZP37657.1| hypothetical protein XF29_19075 [Escherichia coli]
gb|KZP41677.1| hypothetical protein XF27_00290 [Escherichia coli]
gb|KZP43437.1| hypothetical protein XF28_21950 [Escherichia coli]
gb|OAC06260.1| hypothetical protein RIKO2299_20c00640 [Escherichia coli]
gb|OAC07934.1| hypothetical protein UVM2_10c00630 [Escherichia coli]
gb|OAC16210.1| hypothetical protein RIKO2305_13c00400 [Escherichia coli]
gb|OAC17506.1| hypothetical protein EC13107_7c00630 [Escherichia coli]
gb|OAC25658.1| hypothetical protein RIKO2340_13c00630 [Escherichia coli]
gb|OAC26636.1| hypothetical protein EC2772a_15c00770 [Escherichia coli]
gb|OAC33276.1| hypothetical protein RIKO2351_27c00680 [Escherichia coli]
gb|OAC36641.1| hypothetical protein RIKO2331_54c02640 [Escherichia coli]
gb|OAC38796.1| hypothetical protein RIKO2308_15c00630 [Escherichia coli]
gb|OAC45043.1| hypothetical protein EC3234A_6c00630 [Escherichia coli]
gb|OAE57901.1| hypothetical protein A7J46_13810 [Escherichia coli]
gb|OAE74174.1| hypothetical protein A7J65_15165 [Escherichia coli]
gb|OAF24535.1| hypothetical protein AVR70_24415 [Escherichia coli]
gb|OAF27493.1| hypothetical protein AXK32_18230 [Escherichia coli]
gb|OAF31649.1| hypothetical protein AXK31_22145 [Escherichia coli]
gb|OAF34082.1| hypothetical protein AXK34_01775 [Escherichia coli]
gb|OAF36860.1| hypothetical protein AXK30_19500 [Escherichia coli]
gb|OAF40991.1| hypothetical protein AXK33_14340 [Escherichia coli]
gb|OAF51685.1| hypothetical protein AXK35_11935 [Escherichia coli]
gb|OAF96470.1| hypothetical protein PPECC79_6200 [Escherichia coli PCN079]
gb|OAI35241.1| hypothetical protein A6M24_16720 [Escherichia coli]
gb|ANE61330.1| hypothetical protein A5956_16950 [Escherichia coli]
gb|ANE66222.1| hypothetical protein A5955_18630 [Escherichia coli]
gb|OAJ77458.1| hypothetical protein A5959_22985 [Escherichia coli]
gb|OAJ81217.1| hypothetical protein A5957_24630 [Escherichia coli]
gb|OAM49230.1| hypothetical protein A6732_12260 [Escherichia coli]
emb|SAP44481.1| Protein of uncharacterised function (DUF1451) [Klebsiella oxytoca]
gb|OAN05598.1| hypothetical protein AU469_002255 [Escherichia coli O157:H7]
gb|OAO41242.1| hypothetical protein OP01_03525 [Escherichia coli]
gb|OAO48101.1| hypothetical protein OP02_03465 [Escherichia coli]
gb|OAO48538.1| hypothetical protein OO99_12280 [Escherichia coli]
gb|OAO55885.1| hypothetical protein OO98_04665 [Escherichia coli]
gb|OAO61806.1| hypothetical protein OP00_03240 [Escherichia coli]
gb|OAO64081.1| hypothetical protein OO97_15060 [Escherichia coli]
gb|OAO75197.1| hypothetical protein OK10_03860 [Escherichia coli]
gb|ANG67285.1| hypothetical protein A8V31_03655 [Escherichia coli O157:H7]
gb|ANG72835.1| hypothetical protein A8V32_03665 [Escherichia coli O157:H7]
gb|ANG78465.1| hypothetical protein A8V30_03660 [Escherichia coli O157:H7]
gb|OAP70909.1| hypothetical protein A8A56_00685 [Escherichia coli]
gb|OAR84645.1| hypothetical protein AYO03_05380 [Escherichia coli]
gb|OAR96470.1| hypothetical protein AYO02_09870 [Escherichia coli]
gb|OAS04827.1| hypothetical protein AYO07_15535 [Escherichia coli]
gb|OAS91576.1| hypothetical protein A6I92_03770 [Escherichia coli]
gb|OAT65227.1| hypothetical protein A9D68_04870 [Escherichia coli]
gb|OAV60059.1| hypothetical protein A6I93_16630 [Escherichia coli]
gb|ANJ36153.1| hypothetical protein A9K64_17055 [Escherichia coli]
gb|ANJ41609.1| hypothetical protein A9Z04_19565 [Escherichia coli]
gb|OAY12642.1| hypothetical protein A9Y77_13350 [Escherichia coli]
gb|ANK05989.1| ybeL [Escherichia coli O25b:H4]
gb|ANK10177.1| hypothetical protein A9X67_15875 [Escherichia coli]
emb|CTQ84039.1| conserved hypothetical protein [Escherichia coli]
gb|ANK52283.1| hypothetical protein WM90_10835 [Escherichia coli]
gb|ANM81402.1| hypothetical protein A8V37_02290 [Escherichia coli]
gb|ANK31395.1| hypothetical protein WM48_03380 [Escherichia coli]
gb|OBU91863.1| hypothetical protein AWH50_010395 [Escherichia coli]
gb|ANO87832.1| hypothetical protein GJ11_03515 [Escherichia coli]
gb|ANP06157.1| hypothetical protein CP48_03355 [Escherichia coli]
gb|ANP16872.1| hypothetical protein GJ12_03900 [Escherichia coli]
gb|ANP31678.1| hypothetical protein AB847_07060 [Escherichia coli]
gb|ANO76809.1| hypothetical protein CO57_03990 [Escherichia coli]
gb|ANQ04376.1| hypothetical protein A9C00_21265 [Escherichia coli]
gb|ANO30571.1| hypothetical protein BAY41_17885 [Escherichia coli]
gb|ANR85041.1| hypothetical protein BA058_20795 [Escherichia coli]
gb|OBZ41973.1| hypothetical protein A9X41_07625 [Escherichia coli]
gb|OBZ43162.1| hypothetical protein A9X39_07625 [Escherichia coli]
gb|OBZ48956.1| hypothetical protein A9X40_00235 [Escherichia coli]
gb|OCC41774.1| hypothetical protein AWZ64_01535 [Shigella sonnei]
gb|OCC42614.1| hypothetical protein AWZ62_01915 [Shigella sonnei]
gb|OCC42899.1| hypothetical protein AWZ63_04745 [Shigella sonnei]
gb|OCC45261.1| hypothetical protein AW010_04790 [Shigella sonnei]
gb|OCC53487.1| hypothetical protein AWZ66_07075 [Shigella sonnei]
gb|OCC54788.1| hypothetical protein AWZ65_01535 [Shigella sonnei]
gb|OCC56041.1| hypothetical protein AW009_09685 [Shigella sonnei]
gb|OCC59503.1| hypothetical protein AW007_07010 [Shigella sonnei]
gb|OCC64030.1| hypothetical protein AW008_20885 [Shigella sonnei]
gb|OCC71839.1| hypothetical protein AW001_06780 [Shigella sonnei]
gb|OCC73753.1| hypothetical protein AW000_05705 [Shigella sonnei]
gb|OCC81256.1| hypothetical protein AW003_11485 [Shigella sonnei]
gb|OCC85400.1| hypothetical protein AWZ97_00895 [Shigella sonnei]
gb|OCC89721.1| hypothetical protein AWZ98_18425 [Shigella sonnei]
gb|OCC90707.1| hypothetical protein AWZ99_16400 [Shigella sonnei]
gb|OCD03947.1| hypothetical protein AWZ96_17495 [Shigella sonnei]
gb|OCD05306.1| hypothetical protein AWZ95_01525 [Shigella sonnei]
gb|OCD06885.1| hypothetical protein AWZ94_01235 [Shigella sonnei]
gb|OCD10632.1| hypothetical protein AWZ92_08670 [Shigella sonnei]
gb|OCD11019.1| hypothetical protein AWZ93_05955 [Shigella sonnei]
gb|OCD18862.1| hypothetical protein AWZ91_14700 [Shigella sonnei]
gb|OCD22494.1| hypothetical protein AWZ89_08315 [Shigella sonnei]
gb|OCD29836.1| hypothetical protein AWZ90_15040 [Shigella sonnei]
gb|OCD33242.1| hypothetical protein AWZ87_09625 [Shigella sonnei]
gb|OCD34103.1| hypothetical protein AWZ88_16855 [Shigella sonnei]
gb|OCD37418.1| hypothetical protein AWZ85_09300 [Shigella sonnei]
gb|OCD40998.1| hypothetical protein AWZ86_20025 [Shigella sonnei]
gb|OCD48463.1| hypothetical protein AWZ84_00160 [Shigella sonnei]
gb|OCD56692.1| hypothetical protein AWZ70_01575 [Shigella sonnei]
gb|OCD59345.1| hypothetical protein AWZ73_11280 [Shigella sonnei]
gb|OCD60996.1| hypothetical protein AWZ69_06385 [Shigella sonnei]
gb|OCD63199.1| hypothetical protein AW028_04165 [Shigella sonnei]
gb|OCD69224.1| hypothetical protein AW027_17765 [Shigella sonnei]
gb|OCD75590.1| hypothetical protein AW026_04620 [Shigella sonnei]
gb|OCD83251.1| hypothetical protein AW024_14580 [Shigella sonnei]
gb|OCD86127.1| hypothetical protein AW025_00995 [Shigella sonnei]
gb|OCD86259.1| hypothetical protein AW023_06680 [Shigella sonnei]
gb|OCD89928.1| hypothetical protein AW022_02875 [Shigella sonnei]
gb|OCD97347.1| hypothetical protein AW021_13050 [Shigella sonnei]
gb|OCD99227.1| hypothetical protein AW020_07190 [Shigella sonnei]
gb|OCE08224.1| hypothetical protein AW019_17310 [Shigella sonnei]
gb|OCE09681.1| hypothetical protein AW018_13745 [Shigella sonnei]
gb|OCE13931.1| hypothetical protein AW017_05020 [Shigella sonnei]
gb|OCE20312.1| hypothetical protein AW015_17170 [Shigella sonnei]
gb|OCE23687.1| hypothetical protein AW016_10845 [Shigella sonnei]
gb|OCE25691.1| hypothetical protein AW013_07900 [Shigella sonnei]
gb|OCE31020.1| hypothetical protein AW012_03360 [Shigella sonnei]
gb|OCE34034.1| hypothetical protein AW014_13480 [Shigella sonnei]
gb|OCE42694.1| hypothetical protein AW011_03360 [Shigella sonnei]
gb|OCE46372.1| hypothetical protein AW006_15855 [Shigella sonnei]
gb|OCE48165.1| hypothetical protein AW004_09265 [Shigella sonnei]
gb|OCE50524.1| hypothetical protein AW005_14835 [Shigella sonnei]
gb|OCE60456.1| hypothetical protein AWZ82_09670 [Shigella sonnei]
gb|OCE60754.1| hypothetical protein AW002_17585 [Shigella sonnei]
gb|OCE63037.1| hypothetical protein AWZ83_14255 [Shigella sonnei]
gb|OCE71622.1| hypothetical protein AWZ80_02085 [Shigella sonnei]
gb|OCE73492.1| hypothetical protein AWZ81_16185 [Shigella sonnei]
gb|OCE73734.1| hypothetical protein AWZ79_07865 [Shigella sonnei]
gb|OCE86595.1| hypothetical protein AWZ78_16405 [Shigella sonnei]
gb|OCE87594.1| hypothetical protein AWZ76_04230 [Shigella sonnei]
gb|OCE89070.1| hypothetical protein AWZ77_12210 [Shigella sonnei]
gb|OCE91121.1| hypothetical protein AWZ75_05320 [Shigella sonnei]
gb|OCE91846.1| hypothetical protein AWZ74_05475 [Shigella sonnei]
gb|OCE99201.1| hypothetical protein AWZ72_00625 [Shigella sonnei]
gb|OCF00437.1| hypothetical protein AWZ71_05830 [Shigella sonnei]
gb|OCF12530.1| hypothetical protein AWZ68_02570 [Shigella sonnei]
gb|OCF12635.1| hypothetical protein AWZ61_05810 [Shigella sonnei]
gb|OCF17827.1| hypothetical protein AWZ67_15485 [Shigella sonnei]
emb|SCA71898.1| hypothetical protein NCTC86EC_02468 [Escherichia coli]
gb|OCJ83685.1| hypothetical protein BCM29_06360 [Escherichia coli]
gb|OCJ88515.1| hypothetical protein BCF76_05065 [Escherichia coli]
gb|OCJ91416.1| hypothetical protein BCH06_00340 [Escherichia coli]
gb|OCJ98929.1| hypothetical protein BCD90_16940 [Escherichia coli]
gb|OCK03530.1| hypothetical protein BCD89_12380 [Escherichia coli]
gb|ANV94203.1| hypothetical protein BB344_10745 [Escherichia coli]
gb|OCK69404.1| hypothetical protein BBZ58_01775 [Escherichia coli]
gb|ANW28154.1| hypothetical protein BB405_04040 [Escherichia coli]
gb|ANW38709.1| hypothetical protein A9L45_03845 [Escherichia coli O157:H7]
gb|OCO30907.1| hypothetical protein AN669_0222195 [Escherichia coli]
gb|OCQ16864.1| hypothetical protein AGA39_02395 [Escherichia coli]
gb|OCQ27225.1| hypothetical protein A6I94_16400 [Escherichia coli]
gb|OCQ28830.1| hypothetical protein A6I95_03765 [Escherichia coli]
gb|OCQ46709.1| hypothetical protein BA191_06580 [Escherichia coli]
gb|OCS61365.1| hypothetical protein BBZ49_05320 [Escherichia coli]
gb|OCS64770.1| hypothetical protein BBZ51_17115 [Escherichia coli]
gb|OCS65699.1| hypothetical protein BBZ53_05315 [Escherichia coli]
gb|OCS72720.1| hypothetical protein BBZ52_02385 [Escherichia coli]
gb|OCS75826.1| hypothetical protein BBZ50_16110 [Escherichia coli]
gb|OCS78646.1| hypothetical protein BBZ54_03515 [Escherichia coli]
gb|OCT07386.1| hypothetical protein ECO37_04345 [Escherichia coli]
gb|OCW54521.1| hypothetical protein BEI66_21570 [Escherichia coli]
gb|OCW80262.1| hypothetical protein A8R19_03885 [Escherichia coli]
gb|AOD12675.1| hypothetical protein A7402_25035 [Escherichia coli]
gb|ODA87854.1| hypothetical protein A9D65_17210 [Escherichia coli]
gb|ODB48369.1| hypothetical protein A9J90_06065 [Escherichia coli]
gb|ODB52390.1| hypothetical protein A9J89_16925 [Escherichia coli]
gb|ODG73722.1| hypothetical protein BFF49_02875 [Shigella sp. FC2045]
gb|ODG80595.1| hypothetical protein BFF50_02880 [Shigella sp. FC2928]
gb|ODG88395.1| hypothetical protein BFF48_03150 [Shigella sp. FC1882]
gb|ODG89169.1| hypothetical protein BFF47_03200 [Shigella sp. FC1764]
gb|ODH15636.1| hypothetical protein A6V28_18435 [Escherichia coli]
gb|ODH21814.1| hypothetical protein A6804_17050 [Escherichia coli]
gb|ODH30273.1| hypothetical protein A6803_11290 [Escherichia coli]
gb|ODH32709.1| hypothetical protein A6413_20855 [Escherichia coli]
gb|ODH42504.1| hypothetical protein A6412_09140 [Escherichia coli]
gb|ODJ34185.1| hypothetical protein BFR12_03185 [Shigella sp. FC2833]
gb|ODJ40346.1| hypothetical protein A6I96_04180 [Escherichia coli]
gb|ODJ43982.1| hypothetical protein A6I97_02985 [Escherichia coli]
gb|AOM47309.1| hypothetical protein FORC28_4329 [Escherichia coli]
gb|AOM54340.1| hypothetical protein BCV59_07435 [Escherichia coli]
gb|AOM61515.1| hypothetical protein CFSAN004177_19155 [Escherichia coli]
gb|AOM68946.1| hypothetical protein MS6198_06970 [Escherichia coli]
gb|ODQ05607.1| hypothetical protein BGK49_09920 [Shigella sp. FC1544]
gb|ODQ10207.1| hypothetical protein BGK52_09620 [Shigella sp. FC1056]
gb|ODQ11325.1| hypothetical protein BGK51_00110 [Shigella sp. FC569]
gb|AOO68948.1| hypothetical protein NEB5A_02805 [Escherichia coli]
gb|OEB96924.1| hypothetical protein AP216_26820 [Escherichia coli]
gb|OEG33857.1| hypothetical protein BHQ32_03225 [Shigella sp. FC2117]
gb|OEG35820.1| hypothetical protein BHQ35_03175 [Shigella sp. FC2175]
gb|OEG36809.1| hypothetical protein BHQ33_03170 [Shigella sp. FC2125]
gb|OEG39167.1| hypothetical protein BHQ36_09885 [Shigella sp. FC2531]
gb|OEG39756.1| hypothetical protein BHQ37_09705 [Shigella sp. FC2541]
gb|OEG47014.1| hypothetical protein BHQ38_03195 [Shigella sp. FC2710]
gb|OEG50641.1| hypothetical protein BHQ39_09675 [Shigella sp. FC3196]
gb|OEG68982.1| hypothetical protein A7H95_04370 [Escherichia coli]
gb|AOR18974.1| hypothetical protein BBP24_06785 [Escherichia coli]
gb|OEI03708.1| hypothetical protein A9R47_16415 [Escherichia coli]
gb|OEI04097.1| hypothetical protein A9R46_20240 [Escherichia coli]
gb|OEI11814.1| hypothetical protein A9R45_08265 [Escherichia coli]
gb|OEI15773.1| hypothetical protein A9R48_20815 [Escherichia coli]
gb|OEI24185.1| hypothetical protein A9R49_15460 [Escherichia coli]
gb|OEI24579.1| hypothetical protein A9R52_00535 [Escherichia coli]
gb|OEI34674.1| hypothetical protein A9R50_20145 [Escherichia coli]
gb|OEI36191.1| hypothetical protein A9R44_15345 [Escherichia coli]
gb|OEI37506.1| hypothetical protein A9R55_01960 [Escherichia coli]
gb|OEI40681.1| hypothetical protein A9R54_07580 [Escherichia coli]
gb|OEI56293.1| hypothetical protein A9R51_00275 [Escherichia coli]
gb|OEI57360.1| hypothetical protein A9R53_12325 [Escherichia coli]
gb|OEI59398.1| hypothetical protein A9R56_09455 [Escherichia coli]
gb|OEI63452.1| hypothetical protein A9R57_11210 [Escherichia coli]
gb|OEI95498.1| hypothetical protein BHE87_09725 [Shigella sp. FC1708]
gb|OEI97765.1| hypothetical protein BHE88_09700 [Shigella sp. FC1737]
gb|OEJ01868.1| hypothetical protein BHE85_03155 [Shigella sp. FC1567]
gb|OEL42833.1| hypothetical protein BHF05_09945 [Escherichia coli]
gb|OEL45077.1| hypothetical protein BHF06_15805 [Escherichia coli]
gb|OEL49507.1| hypothetical protein BHF04_17690 [Escherichia coli]
gb|OEL59771.1| hypothetical protein BHF08_06085 [Escherichia coli]
gb|OEL61272.1| hypothetical protein BHF07_04920 [Escherichia coli]
gb|OEL63812.1| hypothetical protein BHF11_22910 [Escherichia coli]
gb|OEL70903.1| hypothetical protein BHF09_01555 [Escherichia coli]
gb|OEL72911.1| hypothetical protein BHF10_14725 [Escherichia coli]
gb|OEL81677.1| hypothetical protein BHF12_08790 [Escherichia coli]
gb|OEL83502.1| hypothetical protein BHF13_14135 [Escherichia coli]
gb|OEL90935.1| hypothetical protein BHF14_00740 [Escherichia coli]
gb|OEL95078.1| hypothetical protein BHF15_07005 [Escherichia coli]
gb|OEL98827.1| hypothetical protein BHF16_10380 [Escherichia coli]
gb|OEM05454.1| hypothetical protein BHF17_02290 [Escherichia coli]
gb|OEM06486.1| hypothetical protein BHF19_19960 [Escherichia coli]
gb|OEM14890.1| hypothetical protein BHF18_00410 [Escherichia coli]
gb|OEM17956.1| hypothetical protein BHF21_13800 [Escherichia coli]
gb|OEM21361.1| hypothetical protein BHF22_12000 [Escherichia coli]
gb|OEM27264.1| hypothetical protein BHF20_18650 [Escherichia coli]
gb|OEM30570.1| hypothetical protein BHF24_08410 [Escherichia coli]
gb|OEM39706.1| hypothetical protein BHF25_14185 [Escherichia coli]
gb|OEM42184.1| hypothetical protein BHF26_01755 [Escherichia coli]
gb|OEM52678.1| hypothetical protein BHF28_08645 [Escherichia coli]
gb|OEM57694.1| hypothetical protein BHF29_07330 [Escherichia coli]
gb|OEM61355.1| hypothetical protein BHF31_21360 [Escherichia coli]
gb|OEM64760.1| hypothetical protein BHF30_03975 [Escherichia coli]
gb|OEM67225.1| hypothetical protein BHF32_20930 [Escherichia coli]
gb|OEM77386.1| hypothetical protein BHF33_07885 [Escherichia coli]
gb|OEM79239.1| hypothetical protein BHF34_17855 [Escherichia coli]
gb|OEM84583.1| hypothetical protein BHF35_17045 [Escherichia coli]
gb|OEM89866.1| hypothetical protein BHF36_15460 [Escherichia coli]
gb|OEM96314.1| hypothetical protein BHF37_07915 [Escherichia coli]
gb|OEM99489.1| hypothetical protein BHF39_19070 [Escherichia coli]
gb|OEN04543.1| hypothetical protein BHF38_07065 [Escherichia coli]
gb|OEN10597.1| hypothetical protein BHF40_08085 [Escherichia coli]
gb|OEN16512.1| hypothetical protein BHF41_04990 [Escherichia coli]
gb|OEN16900.1| hypothetical protein BHF42_18685 [Escherichia coli]
gb|OEN25485.1| hypothetical protein BHF43_04650 [Escherichia coli]
gb|OEN26765.1| hypothetical protein BHF45_21035 [Escherichia coli]
gb|OEN37060.1| hypothetical protein BHF46_03900 [Escherichia coli]
gb|OEN41832.1| hypothetical protein BHF47_12275 [Escherichia coli]
gb|OEN43379.1| hypothetical protein BHF44_06195 [Escherichia coli]
gb|OEN50696.1| hypothetical protein BHF48_00980 [Escherichia coli]
gb|OEN53221.1| hypothetical protein BHF50_20955 [Escherichia coli]
gb|OEN55050.1| hypothetical protein BHF49_09040 [Escherichia coli]
gb|OEN60438.1| hypothetical protein BHF51_23420 [Escherichia coli]
gb|OEN65436.1| hypothetical protein BHF52_20705 [Escherichia coli]
gb|OEN74433.1| hypothetical protein BHF54_10790 [Escherichia coli]
gb|OEN80734.1| hypothetical protein BHF53_06425 [Escherichia coli]
gb|OEN84856.1| hypothetical protein BHF56_15200 [Escherichia coli]
gb|OEN88689.1| hypothetical protein BHF55_00320 [Escherichia coli]
gb|OEN93492.1| hypothetical protein BHF58_15860 [Escherichia coli]
gb|OEN94735.1| hypothetical protein BHF57_20200 [Escherichia coli]
gb|OEN94826.1| hypothetical protein BHF59_12595 [Escherichia coli]
gb|OEO03464.1| hypothetical protein BHF60_21415 [Escherichia coli]
gb|OEO07317.1| hypothetical protein BHF61_19895 [Escherichia coli]
gb|OEO14851.1| hypothetical protein BHF62_21075 [Escherichia coli]
gb|OEO21374.1| hypothetical protein BHF23_05255 [Escherichia coli]
gb|AOT33795.1| hypothetical protein FORC31_3339 [Escherichia coli]
gb|AOV23011.1| hypothetical protein A4C50_20465 [Escherichia coli O157:H7]
gb|AOV28371.1| hypothetical protein A4C44_20465 [Escherichia coli O157:H7]
gb|AOV33727.1| hypothetical protein A4C45_20485 [Escherichia coli O157:H7]
gb|AOV39150.1| hypothetical protein A4C38_20745 [Escherichia coli O157:H7]
gb|AOV44500.1| hypothetical protein A4C51_20440 [Escherichia coli O157:H7]
gb|AOV49907.1| hypothetical protein A4C39_20730 [Escherichia coli O157:H7]
gb|AOV55263.1| hypothetical protein A4C47_20460 [Escherichia coli O157:H7]
gb|OFE29522.1| hypothetical protein BBJ27_06170 [Escherichia coli]
emb|SDO51079.1| Zinc-ribbon containing domain-containing protein [Shigella sonnei]
gb|AOX53640.1| hypothetical protein BHW76_20480 [Escherichia coli]
gb|AOX59035.1| hypothetical protein BHW77_20480 [Escherichia coli]
gb|OHV11328.1| hypothetical protein BKN13_09020 [Escherichia coli]
gb|OHW36653.1| hypothetical protein BKL90_02135 [Escherichia coli]
emb|SEQ50396.1| Zinc-ribbon containing domain-containing protein [Escherichia coli]
gb|APA27224.1| hypothetical protein ATO45_18340 [Escherichia coli]
gb|OII47239.1| hypothetical protein BFX81_23115 [Escherichia coli]
gb|OII52012.1| hypothetical protein BFX01_24345 [Escherichia coli]
gb|APA43637.1| hypothetical protein AU473_23345 [Escherichia coli]
gb|OII79117.1| hypothetical protein BHF00_24305 [Escherichia coli]
gb|OII84352.1| hypothetical protein BHE98_22800 [Escherichia coli]
gb|OII85045.1| hypothetical protein BHE99_21700 [Escherichia coli]
gb|OII90958.1| hypothetical protein BHF02_24895 [Escherichia coli]
gb|OIJ00773.1| hypothetical protein BHF03_19255 [Escherichia coli]
gb|OIJ03730.1| hypothetical protein BHF01_23495 [Escherichia coli]
emb|SCQ11481.1| hypothetical protein ECK802_3138 [Escherichia coli]
gb|APC50933.1| hypothetical protein BL257_02855 [Escherichia coli str. K-12
substr. W3110]
gb|OIU84225.1| hypothetical protein BGM15_17920 [Escherichia coli]
gb|OIY20041.1| hypothetical protein BJK29_08665 [Escherichia coli]
gb|OIY27275.1| hypothetical protein BJK26_07430 [Escherichia coli]
gb|OIY35654.1| hypothetical protein BJK38_03340 [Escherichia coli]
gb|OIY41135.1| hypothetical protein BJK34_13540 [Escherichia coli]
gb|OIY43956.1| hypothetical protein BJK28_01730 [Escherichia coli]
gb|OIY46905.1| hypothetical protein BJK31_10045 [Escherichia coli]
gb|OIY55324.1| hypothetical protein BJK27_03200 [Escherichia coli]
gb|OIY57812.1| hypothetical protein BJK36_04635 [Escherichia coli]
gb|OIY68061.1| hypothetical protein BJK35_12880 [Escherichia coli]
gb|OIY69719.1| hypothetical protein BJK24_02720 [Escherichia coli]
gb|OIY74970.1| hypothetical protein BJK39_01835 [Escherichia coli]
gb|OIY80047.1| hypothetical protein BJK25_03580 [Escherichia coli]
gb|OIY86376.1| hypothetical protein BJK30_11740 [Escherichia coli]
gb|OIY87007.1| hypothetical protein BJK44_08865 [Escherichia coli]
gb|OIY95316.1| hypothetical protein BJK33_08455 [Escherichia coli]
gb|OIY98583.1| hypothetical protein BJK32_03065 [Escherichia coli]
gb|OIZ01710.1| hypothetical protein BJK41_09170 [Escherichia coli]
gb|OIZ12159.1| hypothetical protein BJK40_24265 [Escherichia coli]
gb|OIZ14365.1| hypothetical protein BJK43_13745 [Escherichia coli]
gb|OIZ20275.1| hypothetical protein BJK23_01265 [Escherichia coli]
gb|OIZ25692.1| hypothetical protein BJK37_04940 [Escherichia coli]
gb|OIZ31234.1| hypothetical protein BJK42_01270 [Escherichia coli]
gb|OIZ61175.1| hypothetical protein BJI68_21940 [Escherichia coli]
gb|OIZ71896.1| hypothetical protein BM756_15555 [Escherichia coli]
gb|OIZ82278.1| hypothetical protein BMW25_22910 [Escherichia coli]
gb|OIZ84854.1| hypothetical protein BM751_07405 [Escherichia coli]
gb|OIZ94882.1| hypothetical protein BMS05_12690 [Escherichia coli]
gb|OJF28184.1| hypothetical protein AUR51_03410 [Escherichia coli]
gb|OJF31959.1| hypothetical protein AV889_03200 [Escherichia coli]
gb|OJF34777.1| hypothetical protein AP219_03310 [Escherichia coli]
gb|OJF43953.1| hypothetical protein AUR53_03355 [Escherichia coli]
gb|OJF45895.1| hypothetical protein AP220_03365 [Escherichia coli]
gb|OJF51878.1| hypothetical protein AP221_03355 [Escherichia coli]
gb|OJF60200.1| hypothetical protein AUR52_04015 [Escherichia coli]
gb|OJF61661.1| hypothetical protein AP222_03340 [Escherichia coli]
gb|OJF65630.1| hypothetical protein AUR50_08540 [Escherichia coli]
gb|OJF88382.1| hypothetical protein AQF51_14805 [Escherichia coli]
emb|SHD59950.1| conserved hypothetical protein [Escherichia coli]
gb|APE52448.1| hypothetical protein BSG22_03435 [Escherichia coli]
gb|APE57391.1| hypothetical protein BSG21_03435 [Escherichia coli]
gb|APE62270.1| hypothetical protein BSG23_03435 [Escherichia coli]
gb|APE67113.1| hypothetical protein BSG24_03435 [Escherichia coli]
gb|APE81159.1| hypothetical protein FORC29_3545 [Escherichia coli]
gb|APE93109.1| hypothetical protein FORC41_3282 [Escherichia coli]
gb|OJH25542.1| hypothetical protein ECNA114_001365 [Escherichia coli NA114]
gb|APG37333.1| hypothetical protein BLJ80_22610 [Escherichia coli]
gb|API02583.1| hypothetical protein BFL22_03705 [Escherichia coli]
gb|API08191.1| hypothetical protein BFL24_03655 [Escherichia coli]
gb|API13783.1| hypothetical protein BFL21_03655 [Escherichia coli]
gb|API19331.1| hypothetical protein BFL23_03715 [Escherichia coli]
gb|API25019.1| hypothetical protein BFL18_03900 [Escherichia coli]
gb|API30461.1| hypothetical protein BFL16_03705 [Escherichia coli]
gb|API36137.1| hypothetical protein BFL17_03695 [Escherichia coli]
gb|API46422.1| hypothetical protein BSZ13_06590 [Escherichia coli]
gb|OJK10918.1| hypothetical protein BK238_23745 [Escherichia coli]
gb|OJK20595.1| hypothetical protein BK236_08435 [Escherichia coli]
gb|OJK25810.1| hypothetical protein BK237_04515 [Escherichia coli]
gb|OJK29677.1| hypothetical protein BK239_01000 [Escherichia coli]
gb|OJK34581.1| hypothetical protein BK241_14795 [Escherichia coli]
gb|OJK37286.1| hypothetical protein BK240_15745 [Escherichia coli]
gb|OJK43141.1| hypothetical protein BK242_06460 [Escherichia coli]
gb|OJK48681.1| hypothetical protein BK243_21055 [Escherichia coli]
gb|OJK51209.1| hypothetical protein BK245_08770 [Escherichia coli]
gb|OJK57740.1| hypothetical protein BK244_18105 [Escherichia coli]
gb|OJK63678.1| hypothetical protein BK246_13505 [Escherichia coli]
gb|OJK70664.1| hypothetical protein BK247_05990 [Escherichia coli]
gb|OJK76978.1| hypothetical protein BK248_02985 [Escherichia coli]
gb|OJK77610.1| hypothetical protein BK249_23520 [Escherichia coli]
gb|OJK80815.1| hypothetical protein BK250_24095 [Escherichia coli]
gb|OJK90372.1| hypothetical protein BK252_15840 [Escherichia coli]
gb|OJK96135.1| hypothetical protein BK251_09765 [Escherichia coli]
gb|OJL03125.1| hypothetical protein BK253_15030 [Escherichia coli]
gb|OJL06157.1| hypothetical protein BK254_07950 [Escherichia coli]
gb|OJL08385.1| hypothetical protein BK255_13850 [Escherichia coli]
gb|OJL22623.1| hypothetical protein BK256_00320 [Escherichia coli]
gb|OJL24092.1| hypothetical protein BK258_06800 [Escherichia coli]
gb|OJL26940.1| hypothetical protein BK257_10810 [Escherichia coli]
gb|OJL31341.1| hypothetical protein BK260_21900 [Escherichia coli]
gb|OJL34045.1| hypothetical protein BK259_14470 [Escherichia coli]
gb|OJL41169.1| hypothetical protein BK263_16985 [Escherichia coli]
gb|OJL44972.1| hypothetical protein BK264_24550 [Escherichia coli]
gb|OJL49169.1| hypothetical protein BK261_24110 [Escherichia coli]
gb|OJL57876.1| hypothetical protein BK262_07180 [Escherichia coli]
gb|OJL61897.1| hypothetical protein BK265_16270 [Escherichia coli]
gb|OJL68264.1| hypothetical protein BK267_08710 [Escherichia coli]
gb|OJL70958.1| hypothetical protein BK269_23145 [Escherichia coli]
gb|OJL73545.1| hypothetical protein BK268_21295 [Escherichia coli]
gb|OJL85120.1| hypothetical protein BK266_02905 [Escherichia coli]
gb|OJL88547.1| hypothetical protein BK270_13765 [Escherichia coli]
gb|OJL93901.1| hypothetical protein BK271_19055 [Escherichia coli]
gb|OJL94653.1| hypothetical protein BK272_15585 [Escherichia coli]
gb|OJM02293.1| hypothetical protein BK273_22130 [Escherichia coli]
gb|OJM03809.1| hypothetical protein BK274_19640 [Escherichia coli]
gb|OJM12998.1| hypothetical protein BK276_23465 [Escherichia coli]
gb|OJM21559.1| hypothetical protein BK275_11990 [Escherichia coli]
gb|OJM24630.1| hypothetical protein BK277_05515 [Escherichia coli]
gb|OJM27339.1| hypothetical protein BK278_24360 [Escherichia coli]
gb|OJM33420.1| hypothetical protein BK280_15385 [Escherichia coli]
gb|OJM39521.1| hypothetical protein BK279_04720 [Escherichia coli]
gb|OJM47202.1| hypothetical protein BK281_11630 [Escherichia coli]
gb|OJM47637.1| hypothetical protein BK282_16560 [Escherichia coli]
gb|OJM54138.1| hypothetical protein BK283_17495 [Escherichia coli]
gb|OJM58048.1| hypothetical protein BK284_24350 [Escherichia coli]
gb|OJM59517.1| hypothetical protein BK285_20105 [Escherichia coli]
gb|OJM74236.1| hypothetical protein BK288_21220 [Escherichia coli]
gb|OJM74894.1| hypothetical protein BK286_02725 [Escherichia coli]
gb|OJM79918.1| hypothetical protein BK287_03495 [Escherichia coli]
gb|OJM87120.1| hypothetical protein BK291_18470 [Escherichia coli]
gb|OJM88169.1| hypothetical protein BK289_12150 [Escherichia coli]
gb|OJM90337.1| hypothetical protein BK292_19540 [Escherichia coli]
gb|OJN00188.1| hypothetical protein BK293_17555 [Escherichia coli]
gb|OJN06724.1| hypothetical protein BK295_17845 [Escherichia coli]
gb|OJN11522.1| hypothetical protein BK294_04970 [Escherichia coli]
gb|OJN16971.1| hypothetical protein BK298_25625 [Escherichia coli]
gb|OJN19225.1| hypothetical protein BK296_04445 [Escherichia coli]
gb|OJN28325.1| hypothetical protein BK297_13115 [Escherichia coli]
gb|OJN28416.1| hypothetical protein BK299_17180 [Escherichia coli]
gb|OJN40398.1| hypothetical protein BK300_03910 [Escherichia coli]
gb|OJN41818.1| hypothetical protein BK302_19555 [Escherichia coli]
gb|OJN43727.1| hypothetical protein BK301_18110 [Escherichia coli]
gb|OJN55579.1| hypothetical protein BK303_10310 [Escherichia coli]
gb|OJN56080.1| hypothetical protein BK305_22155 [Escherichia coli]
gb|OJN66423.1| hypothetical protein BK306_09615 [Escherichia coli]
gb|OJN68774.1| hypothetical protein BK304_07055 [Escherichia coli]
gb|OJN74579.1| hypothetical protein BK307_08905 [Escherichia coli]
gb|OJN74702.1| hypothetical protein BK309_21890 [Escherichia coli]
gb|OJN85632.1| hypothetical protein BK290_05910 [Escherichia coli]
gb|OJN88145.1| hypothetical protein BK310_15965 [Escherichia coli]
gb|OJO01415.1| hypothetical protein BK308_06025 [Escherichia coli]
gb|OJO01590.1| hypothetical protein BK311_01595 [Escherichia coli]
gb|OJO06798.1| hypothetical protein BK312_06125 [Escherichia coli]
gb|OJO06890.1| hypothetical protein BK313_21440 [Escherichia coli]
gb|OJO13465.1| hypothetical protein BK315_25195 [Escherichia coli]
gb|OJO16113.1| hypothetical protein BK314_13330 [Escherichia coli]
gb|OJO22480.1| hypothetical protein BK316_17120 [Escherichia coli]
gb|OJO32475.1| hypothetical protein BK317_11070 [Escherichia coli]
gb|OJO38343.1| hypothetical protein BK318_02835 [Escherichia coli]
gb|OJO38458.1| hypothetical protein BK319_16650 [Escherichia coli]
gb|OJO47304.1| hypothetical protein BK320_03230 [Escherichia coli]
gb|OJO54368.1| hypothetical protein BK321_04455 [Escherichia coli]
gb|OJO55208.1| hypothetical protein BK322_07925 [Escherichia coli]
gb|OJO60399.1| hypothetical protein BK323_07305 [Escherichia coli]
gb|OJO64561.1| hypothetical protein BK325_18320 [Escherichia coli]
gb|OJO68257.1| hypothetical protein BK326_20775 [Escherichia coli]
gb|OJO77239.1| hypothetical protein BK327_16040 [Escherichia coli]
gb|OJO85161.1| hypothetical protein BK328_16130 [Escherichia coli]
gb|OJO85371.1| hypothetical protein BK329_20165 [Escherichia coli]
gb|OJO87108.1| hypothetical protein BK330_13855 [Escherichia coli]
gb|OJO96872.1| hypothetical protein BK331_19495 [Escherichia coli]
gb|OJP01805.1| hypothetical protein BK333_20790 [Escherichia coli]
gb|OJP10429.1| hypothetical protein BK332_01030 [Escherichia coli]
gb|OJP11892.1| hypothetical protein BK334_18925 [Escherichia coli]
gb|OJP18126.1| hypothetical protein BK336_14845 [Escherichia coli]
gb|OJP25313.1| hypothetical protein BK335_07180 [Escherichia coli]
gb|OJP27934.1| hypothetical protein BK337_16230 [Escherichia coli]
gb|OJP28944.1| hypothetical protein BK338_22110 [Escherichia coli]
gb|OJP38781.1| hypothetical protein BK339_08480 [Escherichia coli]
gb|OJP44340.1| hypothetical protein BK340_12685 [Escherichia coli]
gb|OJP46231.1| hypothetical protein BK342_13075 [Escherichia coli]
gb|OJP53352.1| hypothetical protein BK341_09580 [Escherichia coli]
gb|OJP60106.1| hypothetical protein BK343_04860 [Escherichia coli]
gb|OJP60172.1| hypothetical protein BK344_19445 [Escherichia coli]
gb|OJP64567.1| hypothetical protein BK345_19445 [Escherichia coli]
gb|OJP65815.1| hypothetical protein BK346_22955 [Escherichia coli]
gb|OJP74333.1| hypothetical protein BK347_19670 [Escherichia coli]
gb|OJP80022.1| hypothetical protein BK348_18880 [Escherichia coli]
gb|OJP91371.1| hypothetical protein BK349_04940 [Escherichia coli]
gb|OJP94830.1| hypothetical protein BK352_16510 [Escherichia coli]
gb|OJP99798.1| hypothetical protein BK351_05810 [Escherichia coli]
gb|OJQ05409.1| hypothetical protein BK350_05845 [Escherichia coli]
gb|OJQ05687.1| hypothetical protein BK354_10235 [Escherichia coli]
gb|OJQ10491.1| hypothetical protein BK353_17775 [Escherichia coli]
gb|OJQ16836.1| hypothetical protein BK355_10030 [Escherichia coli]
gb|OJQ21801.1| hypothetical protein BK356_11160 [Escherichia coli]
gb|OJQ23484.1| hypothetical protein BK357_17420 [Escherichia coli]
gb|OJQ31659.1| hypothetical protein BK359_21695 [Escherichia coli]
gb|OJQ31980.1| hypothetical protein BK358_09070 [Escherichia coli]
gb|OJQ37278.1| hypothetical protein BK360_18200 [Escherichia coli]
gb|OJQ44063.1| hypothetical protein BK363_21895 [Escherichia coli]
gb|OJQ50056.1| hypothetical protein BK361_07100 [Escherichia coli]
gb|OJQ54219.1| hypothetical protein BK362_14980 [Escherichia coli]
gb|OJQ59422.1| hypothetical protein BK365_16795 [Escherichia coli]
gb|OJQ65892.1| hypothetical protein BK364_05630 [Escherichia coli]
gb|OJQ69601.1| hypothetical protein BK366_12700 [Escherichia coli]
gb|OJQ79334.1| hypothetical protein BK368_04185 [Escherichia coli]
gb|OJQ81997.1| hypothetical protein BK367_00280 [Escherichia coli]
gb|OJQ88400.1| hypothetical protein BK369_00980 [Escherichia coli]
gb|OJQ90322.1| hypothetical protein BK370_06370 [Escherichia coli]
gb|OJQ94874.1| hypothetical protein BK371_10390 [Escherichia coli]
gb|OJR01692.1| hypothetical protein BK372_04095 [Escherichia coli]
gb|OJR06751.1| hypothetical protein BK374_16960 [Escherichia coli]
gb|OJR07916.1| hypothetical protein BK373_00190 [Escherichia coli]
gb|OJR14758.1| hypothetical protein BK375_15130 [Escherichia coli]
gb|OJR17767.1| hypothetical protein BK376_20190 [Escherichia coli]
gb|OJR22626.1| hypothetical protein BK377_06090 [Escherichia coli]
gb|OJR32264.1| hypothetical protein BK379_12920 [Escherichia coli]
gb|OJR38152.1| hypothetical protein BK378_00735 [Escherichia coli]
gb|OJR47541.1| hypothetical protein BK381_14275 [Escherichia coli]
gb|OJR50088.1| hypothetical protein BK382_01115 [Escherichia coli]
gb|OJR53424.1| hypothetical protein BK383_18005 [Escherichia coli]
gb|OJR60421.1| hypothetical protein BK385_11500 [Escherichia coli]
gb|OJR67042.1| hypothetical protein BK386_06285 [Escherichia coli]
gb|OJR69266.1| hypothetical protein BK384_18985 [Escherichia coli]
gb|OJR75954.1| hypothetical protein BK388_11035 [Escherichia coli]
gb|OJR80315.1| hypothetical protein BK389_15600 [Escherichia coli]
gb|OJR88131.1| hypothetical protein BK390_00550 [Escherichia coli]
gb|OJR91251.1| hypothetical protein BK392_19250 [Escherichia coli]
gb|OJR92577.1| hypothetical protein BK387_13255 [Escherichia coli]
gb|OJS00956.1| hypothetical protein BK391_13955 [Escherichia coli]
gb|OJS03483.1| hypothetical protein BK393_19965 [Escherichia coli]
gb|OJS05438.1| hypothetical protein BK394_20840 [Escherichia coli]
gb|OJS10893.1| hypothetical protein BK395_20150 [Escherichia coli]
gb|OJS23558.1| hypothetical protein BK397_20880 [Escherichia coli]
gb|OJS25992.1| hypothetical protein BK398_00920 [Escherichia coli]
gb|OJS27596.1| hypothetical protein BK396_13910 [Escherichia coli]
gb|OJS35409.1| hypothetical protein BK399_20295 [Escherichia coli]
gb|OJS39766.1| hypothetical protein BK401_06145 [Escherichia coli]
gb|OJS47398.1| hypothetical protein BK402_07495 [Escherichia coli]
gb|OJS58449.1| hypothetical protein BK405_11010 [Escherichia coli]
gb|OJS62155.1| hypothetical protein BK404_08350 [Escherichia coli]
gb|OJS65112.1| hypothetical protein BK407_20885 [Escherichia coli]
gb|OJS74523.1| hypothetical protein BK408_20360 [Escherichia coli]
gb|OJS75946.1| hypothetical protein BK406_02995 [Escherichia coli]
gb|OJS83507.1| hypothetical protein BK409_07210 [Escherichia coli]
gb|OJS88980.1| hypothetical protein BK400_14985 [Escherichia coli]
gb|OJZ32124.1| hypothetical protein BSO19_16620 [Escherichia coli]
gb|APJ62212.1| hypothetical protein RG25_10740 [Escherichia coli]
gb|APJ73492.1| hypothetical protein RG27_18345 [Escherichia coli]
gb|APJ75012.1| hypothetical protein RG28_01325 [Escherichia coli]
gb|APJ81256.1| hypothetical protein RG30_05735 [Escherichia coli]
gb|APJ88020.1| hypothetical protein RG31_16765 [Escherichia coli]
gb|APJ91562.1| hypothetical protein RG32_11785 [Escherichia coli]
gb|APJ94828.1| hypothetical protein RG33_04105 [Escherichia coli]
gb|APK00175.1| hypothetical protein RG34_05625 [Escherichia coli]
gb|APK07215.1| hypothetical protein RG35_16945 [Escherichia coli]
gb|APK09860.1| hypothetical protein RG36_06115 [Escherichia coli]
gb|APK14688.1| hypothetical protein RG37_05020 [Escherichia coli]
gb|APK22728.1| hypothetical protein RG38_23485 [Escherichia coli]
gb|APK23712.1| hypothetical protein RG39_03015 [Escherichia coli]
gb|APK28579.1| hypothetical protein RG40_04230 [Escherichia coli]
gb|APK34645.1| hypothetical protein RG41_12530 [Escherichia coli]
gb|APK38266.1| hypothetical protein RG42_05860 [Escherichia coli]
gb|APK44789.1| hypothetical protein RG43_16870 [Escherichia coli]
gb|APK50121.1| hypothetical protein RG44_18775 [Escherichia coli]
gb|APK57295.1| hypothetical protein RG46_09235 [Escherichia coli]
gb|APK62358.1| hypothetical protein RG47_12790 [Escherichia coli]
gb|APK67777.1| hypothetical protein RG48_17790 [Escherichia coli]
gb|APK70416.1| hypothetical protein RG49_07355 [Escherichia coli]
gb|APK76683.1| hypothetical protein RG50_16935 [Escherichia coli]
gb|APK78927.1| hypothetical protein RG51_02430 [Escherichia coli]
gb|APK87232.1| hypothetical protein RG52_22715 [Escherichia coli]
gb|APK87864.1| hypothetical protein RG53_01905 [Escherichia coli]
gb|APK96035.1| hypothetical protein RG54_21510 [Escherichia coli]
gb|APK97495.1| hypothetical protein RG55_02970 [Escherichia coli]
gb|APL02239.1| hypothetical protein RG56_02315 [Escherichia coli]
gb|APL06831.1| hypothetical protein RG57_00275 [Escherichia coli]
gb|APL12024.1| hypothetical protein RG58_02315 [Escherichia coli]
gb|APL20150.1| hypothetical protein RG59_19300 [Escherichia coli]
gb|APL23680.1| hypothetical protein RG60_13305 [Escherichia coli]
gb|APL29528.1| hypothetical protein RG61_17215 [Escherichia coli]
gb|APL35161.1| hypothetical protein RG62_21330 [Escherichia coli]
gb|APL38529.1| hypothetical protein RG63_13270 [Escherichia coli]
gb|APL43673.1| hypothetical protein RG64_14145 [Escherichia coli]
gb|APL48093.1| hypothetical protein RG65_13790 [Escherichia coli]
gb|APL54699.1| hypothetical protein RG67_00475 [Escherichia coli]
gb|APL63213.1| hypothetical protein RG68_22745 [Escherichia coli]
gb|APL67101.1| hypothetical protein RG69_17415 [Escherichia coli]
gb|APL67614.1| hypothetical protein RG69_20125 [Escherichia coli]
gb|APL69435.1| hypothetical protein RG70_02420 [Escherichia coli]
gb|APL73881.1| hypothetical protein RG71_01820 [Escherichia coli]
gb|APL81306.1| hypothetical protein RG72_16580 [Escherichia coli]
gb|APL90717.1| hypothetical protein RG73_13195 [Escherichia coli]
gb|APL50024.1| hypothetical protein RG66_00270 [Escherichia coli]
gb|OKA60285.1| hypothetical protein BHL56_10930 [Escherichia coli]
gb|OKB71512.1| hypothetical protein BMT50_01425 [Escherichia coli]
gb|OKB77653.1| hypothetical protein BMT49_04825 [Escherichia coli]
gb|OKB81831.1| hypothetical protein BMT52_25260 [Escherichia coli]
gb|OKB83075.1| hypothetical protein BMT51_19410 [Escherichia coli]
gb|OKB89244.1| hypothetical protein BMT53_06920 [Escherichia coli]
gb|OKL75812.1| hypothetical protein AM328_004347 [Escherichia coli]
gb|OKL94596.1| hypothetical protein AM427_000670 [Escherichia coli]
gb|OKO57735.1| hypothetical protein BSF34_04140 [Escherichia coli]
gb|OKP63382.1| hypothetical protein A8A03_15455 [Escherichia coli]
gb|OKS66903.1| hypothetical protein BTW13_17290 [Escherichia coli]
gb|OKS96537.1| hypothetical protein ACN56_05270 [Escherichia coli]
gb|OKS98767.1| hypothetical protein ACN58_16165 [Escherichia coli]
gb|OKT02442.1| hypothetical protein ACN55_26935 [Escherichia coli]
gb|OKT04471.1| hypothetical protein ACN54_08685 [Escherichia coli]
gb|OKT17556.1| hypothetical protein ACN61_08065 [Escherichia coli]
gb|OKT20580.1| hypothetical protein ACN57_21845 [Escherichia coli]
gb|OKT25684.1| hypothetical protein ACN62_27315 [Escherichia coli]
gb|OKT29519.1| hypothetical protein ACN66_15955 [Escherichia coli]
gb|OKT38018.1| hypothetical protein ACN63_18685 [Escherichia coli]
gb|OKT40305.1| hypothetical protein ACN60_23440 [Escherichia coli]
gb|OKT41715.1| hypothetical protein ACN65_23480 [Escherichia coli]
gb|OKT50298.1| hypothetical protein ACN64_25090 [Escherichia coli]
gb|OKT58956.1| hypothetical protein ACN73_16560 [Escherichia coli]
gb|OKT66639.1| hypothetical protein ACN71_16855 [Escherichia coli]
gb|OKT70170.1| hypothetical protein ACN67_24775 [Escherichia coli]
gb|OKT79322.1| hypothetical protein ACN69_23155 [Escherichia coli]
gb|OKT85597.1| hypothetical protein ACN70_18435 [Escherichia coli]
gb|OKT89117.1| hypothetical protein ACN75_14550 [Escherichia coli]
gb|OKT94471.1| hypothetical protein ACN72_24080 [Escherichia coli]
gb|OKU00756.1| hypothetical protein ACN80_21090 [Escherichia coli]
gb|OKU01107.1| hypothetical protein ACN74_20630 [Escherichia coli]
gb|OKU08023.1| hypothetical protein ACN77_23625 [Escherichia coli]
gb|OKU17914.1| hypothetical protein ACN76_19770 [Escherichia coli]
gb|OKU24661.1| hypothetical protein ACN78_17330 [Escherichia coli]
gb|OKU29526.1| hypothetical protein ACN81_02970 [Escherichia coli]
gb|OKU35435.1| hypothetical protein ACN83_27050 [Escherichia coli]
gb|OKU36756.1| hypothetical protein ACN84_15590 [Escherichia coli]
gb|OKU47770.1| hypothetical protein ACN86_19480 [Escherichia coli]
gb|OKU54342.1| hypothetical protein ACN82_13540 [Escherichia coli]
gb|OKU57046.1| hypothetical protein ACN85_25240 [Escherichia coli]
gb|OKU64097.1| hypothetical protein ACN88_13850 [Escherichia coli]
gb|OKU70073.1| hypothetical protein AWP48_28910 [Escherichia coli]
gb|OKU74247.1| hypothetical protein AWJ24_23540 [Escherichia coli]
gb|OKU79163.1| hypothetical protein AWP45_04830 [Escherichia coli]
gb|OKV01193.1| hypothetical protein ACN87_03585 [Escherichia coli]
gb|OKV02744.1| hypothetical protein AWP46_03350 [Escherichia coli]
gb|OKV07402.1| hypothetical protein AWP52_22400 [Escherichia coli]
gb|OKV24277.1| hypothetical protein AWP49_26025 [Escherichia coli]
gb|OKV31128.1| hypothetical protein AWP55_18155 [Escherichia coli]
gb|OKV36375.1| hypothetical protein AWP56_17355 [Escherichia coli]
gb|OKV44332.1| hypothetical protein AWP58_22170 [Escherichia coli]
gb|OKV46234.1| hypothetical protein AWP59_15055 [Escherichia coli]
gb|OKV57224.1| hypothetical protein AWP59_00010 [Escherichia coli]
gb|OKV62000.1| hypothetical protein AWP57_26165 [Escherichia coli]
gb|OKV63240.1| hypothetical protein AWP63_13920 [Escherichia coli]
gb|OKV68419.1| hypothetical protein AWP61_06855 [Escherichia coli]
gb|OKV72258.1| hypothetical protein AWP60_24210 [Escherichia coli]
gb|OKV78140.1| hypothetical protein AWP64_23405 [Escherichia coli]
gb|OKV91647.1| hypothetical protein AWP66_00605 [Escherichia coli]
gb|OKV94612.1| hypothetical protein AWP67_03465 [Escherichia coli]
gb|OKV95425.1| hypothetical protein AWP68_28595 [Escherichia coli]
gb|OKV97060.1| hypothetical protein AWP65_17670 [Escherichia coli]
gb|OKW10244.1| hypothetical protein AWP72_23735 [Escherichia coli]
gb|OKW16774.1| hypothetical protein AWP70_21740 [Escherichia coli]
gb|OKW25955.1| hypothetical protein AWP71_23700 [Escherichia coli]
gb|OKW32369.1| hypothetical protein AWP77_24970 [Escherichia coli]
gb|OKW38744.1| hypothetical protein AWP74_02175 [Escherichia coli]
gb|OKW40147.1| hypothetical protein AWP78_26555 [Escherichia coli]
gb|OKW53453.1| hypothetical protein AWP76_16450 [Escherichia coli]
gb|OKW57565.1| hypothetical protein AWP73_23650 [Escherichia coli]
gb|OKW60142.1| hypothetical protein AWP83_15910 [Escherichia coli]
gb|OKW64159.1| hypothetical protein AWP73_14340 [Escherichia coli]
gb|OKW67161.1| hypothetical protein AWP82_15610 [Escherichia coli]
gb|OKW68662.1| hypothetical protein AWP84_27890 [Escherichia coli]
gb|OKW84890.1| hypothetical protein AWP85_09245 [Escherichia coli]
gb|OKW87446.1| hypothetical protein AWP88_26210 [Escherichia coli]
gb|OKW95912.1| hypothetical protein AWP80_20505 [Escherichia coli]
gb|OKW96597.1| hypothetical protein AWP87_17300 [Escherichia coli]
gb|OKX03115.1| hypothetical protein AWP89_25875 [Escherichia coli]
gb|OKX08480.1| hypothetical protein AWP93_21805 [Escherichia coli]
gb|OKX11784.1| hypothetical protein AWP86_29360 [Escherichia coli]
gb|OKX21065.1| hypothetical protein AWP90_23160 [Escherichia coli]
gb|OKX25243.1| hypothetical protein AWP96_10935 [Escherichia coli]
gb|OKX31944.1| hypothetical protein AWP91_23685 [Escherichia coli]
gb|OKX32303.1| hypothetical protein AWP92_27820 [Escherichia coli]
gb|OKX46490.1| hypothetical protein AWP97_25645 [Escherichia coli]
gb|OKX57718.1| hypothetical protein AWP94_18065 [Escherichia coli]
gb|OKX67540.1| hypothetical protein AWP95_19280 [Escherichia coli]
gb|OKX69479.1| hypothetical protein AWP98_07860 [Escherichia coli]
gb|APQ22492.1| hypothetical protein BTD92_03230 [Escherichia coli]
gb|OLL64854.1| hypothetical protein BSK24_17090 [Escherichia coli]
gb|APT03960.1| hypothetical protein BJJ90_19125 [Escherichia coli]
gb|OLN80861.1| hypothetical protein UG47_00300 [Escherichia coli]
gb|OLO97896.1| hypothetical protein BHG39_18010 [Escherichia coli]
gb|APT63544.1| hypothetical protein BUE82_17440 [Escherichia coli]
gb|OLR37649.1| hypothetical protein UG58_01405 [Escherichia coli O25b:H4-ST131]
gb|OLR86115.1| hypothetical protein BUE81_17315 [Escherichia coli]
gb|OLS70497.1| hypothetical protein BJG07_18005 [Escherichia coli]
gb|OLS74449.1| hypothetical protein BJD19_12925 [Escherichia coli]
gb|OLS80955.1| hypothetical protein BJG04_03225 [Escherichia coli]
gb|OLS83889.1| hypothetical protein BJG05_19575 [Escherichia coli]
gb|OLS89852.1| hypothetical protein BJG06_07410 [Escherichia coli]
gb|OLS93440.1| hypothetical protein BJG03_00100 [Escherichia coli]
gb|OLS97740.1| hypothetical protein BJG08_13180 [Escherichia coli]
gb|OLY55660.1| hypothetical protein BM748_016150 [Escherichia coli]
gb|OLY90029.1| hypothetical protein A8O33_19460 [Escherichia coli O157:H43]
gb|OMG96895.1| hypothetical protein A8M31_10845 [Escherichia coli]
gb|OMH01173.1| hypothetical protein BW691_18770 [Escherichia coli]
gb|APW94096.1| hypothetical protein BVJ48_16385 [Escherichia coli]
gb|OMI47628.1| hypothetical protein MP33_01370 [Escherichia coli N37058PS]
gb|OMI48025.1| hypothetical protein MP34_19305 [Escherichia coli N37122PS]
gb|OMI52934.1| hypothetical protein Q676_14155 [Escherichia coli N40607]
gb|OMI58854.1| hypothetical protein MP35_05880 [Escherichia coli N40513]
gb|OMI62587.1| hypothetical protein EP55_24905 [Escherichia coli N37139PS]
gb|OMI69940.1| hypothetical protein MP32_11735 [Escherichia coli N36410PS]
gb|OMI75163.1| hypothetical protein MP31_01595 [Escherichia coli N36254PS]
emb|SIX30316.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX09466.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC89921.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC27019.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB26742.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC24313.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX36484.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ37301.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX56930.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH43956.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC72440.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB37456.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC42759.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC49060.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY02776.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB04539.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB82780.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC33757.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB89831.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB47003.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX28064.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB96142.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB13590.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX12729.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI20468.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX23251.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH46577.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA65792.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH83281.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB03161.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH40781.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW99210.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH44302.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB12388.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB11449.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB37320.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB38197.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB38730.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB65970.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI05496.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC26323.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB24282.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI05575.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX15604.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB55678.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ25109.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW84856.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX05091.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX18385.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX28909.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX11897.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ03798.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH94035.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW98728.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA40593.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA40108.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ52003.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC92544.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX86418.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA14589.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG39102.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH79221.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF55047.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH85361.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY32361.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB03518.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH56979.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH90023.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH16163.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX06843.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA81403.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG29346.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH82295.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC58382.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC26562.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB53140.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG28598.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA15711.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG58640.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG83994.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ28002.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ91987.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA16684.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW89281.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG00363.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA28835.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ61561.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA17835.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG29922.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG88003.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ22087.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ55527.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK37747.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA40083.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB25926.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY89343.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB05655.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF58587.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX38011.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX08736.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ81225.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA26301.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH35558.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI40949.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX17714.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA12997.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX15148.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI03222.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ21752.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK00573.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX08061.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB78348.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG97231.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ63410.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG89477.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK71321.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY04489.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX06126.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI20075.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA37882.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK43339.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK71433.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ18959.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX60530.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ11663.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI81367.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW95293.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ26192.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI19026.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI30497.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW85995.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ54559.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ12392.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI85856.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX36616.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF92753.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY97723.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB19851.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ99645.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB11920.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX67224.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC20659.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ08949.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI15765.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH13642.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ57477.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX30220.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK32911.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI14417.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW87225.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ38811.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK03790.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ45560.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ42088.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX03072.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX18550.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI02689.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI69919.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB05605.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ52813.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI96377.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG58470.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG14285.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ08955.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA67249.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA85976.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW89308.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ31195.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ92429.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX72828.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW90529.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG22713.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW77469.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ22974.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ80845.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ79913.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG45558.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG43091.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI90739.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY87110.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK07185.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH71916.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB83600.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ27545.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX06179.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX70432.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE66541.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI78673.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ00011.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ43464.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK26039.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF09976.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA18902.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ67384.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA53890.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI30186.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI97443.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ99411.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX74964.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ55878.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ18227.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG68175.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA30789.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY93625.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG41031.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK02977.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJH86500.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ29134.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF96442.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA55891.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB16121.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB36871.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ04907.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE87071.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI72607.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ91642.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF90085.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF41040.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD08435.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE95625.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA93858.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF08975.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF97122.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJA44484.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ74022.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI99432.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC07977.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF53321.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF00065.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC11951.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ80908.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG03087.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI98513.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ37013.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF85807.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG06297.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE89199.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB18992.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ74213.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW92469.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG58900.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE38012.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE73662.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE91888.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF89393.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF48458.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJB00013.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG00570.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK43178.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX36175.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE09661.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW83388.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC00202.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIY58871.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF02182.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIX42194.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD46347.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG01407.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE86901.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF69415.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG18200.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ02935.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJI21664.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG01328.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD72117.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ40778.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD41494.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG42400.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD59030.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF51388.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE56539.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE28097.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD47906.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE43029.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJG14303.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIW90480.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF52493.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK16115.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJJ92666.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SIZ16578.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF80155.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK05677.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE02062.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE53613.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD31034.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE26565.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC92580.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC93486.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJC84072.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD25652.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF14268.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF87938.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD69049.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD52867.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE14845.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF15149.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE74777.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJF51074.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD56335.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE36776.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD21572.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE30860.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD78959.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE07490.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE27279.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE18900.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD25229.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJK00136.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD74660.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD05160.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD31899.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD11233.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE25738.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD17230.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJD91257.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJE21837.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
gb|ONF80856.1| hypothetical protein BZL66_20695 [Escherichia coli]
gb|ONG16840.1| hypothetical protein BWR13_05545 [Escherichia coli]
gb|ONG17701.1| hypothetical protein BWX43_23795 [Escherichia coli]
gb|ONG20345.1| hypothetical protein BXT95_15500 [Escherichia coli]
gb|ONG28086.1| hypothetical protein BW690_14710 [Escherichia coli]
emb|SJK87373.1| conserved hypothetical protein [Escherichia coli]
gb|ONK33925.1| hypothetical protein BZ158_24775 [Escherichia coli]
gb|ONK38750.1| hypothetical protein BZ157_15395 [Escherichia coli]
emb|SJL96794.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJL97297.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJL96737.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJL96919.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJL97195.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
emb|SJL96795.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
gb|ONN29804.1| hypothetical protein AYC64_16325 [Escherichia coli]
emb|SJM22239.1| putative F0F1-type ATP synthase, subunit b [Shigella sonnei]
gb|OOC73187.1| hypothetical protein BWP21_11335 [Escherichia coli]
gb|OOC76384.1| hypothetical protein BWP17_23245 [Escherichia coli]
gb|OOD51127.1| hypothetical protein BWP18_16280 [Escherichia coli]
gb|AQP90562.1| hypothetical protein BWL12_03630 [Escherichia coli]
gb|OOG29874.1| hypothetical protein ICBEC72H_21600 [Escherichia coli]
gb|OOH60875.1| hypothetical protein BMT64_12790 [Escherichia coli]
gb|OOH67456.1| hypothetical protein BMT65_04825 [Escherichia coli]
gb|OOH74758.1| hypothetical protein BMU01_00020 [Escherichia coli]
gb|OOH89184.1| hypothetical protein BMT63_09295 [Escherichia coli]
gb|OOI14567.1| hypothetical protein BMT57_11910 [Escherichia coli]
gb|OOI18857.1| hypothetical protein BMT98_14975 [Escherichia coli]
gb|OOI20428.1| hypothetical protein BMT85_17055 [Escherichia coli]
gb|OOI32182.1| hypothetical protein BMT86_15245 [Escherichia coli]
gb|OOI34323.1| hypothetical protein BMT61_14260 [Escherichia coli]
gb|OOI37052.1| hypothetical protein BMT60_00470 [Escherichia coli]
gb|OOI42511.1| hypothetical protein BMT62_18290 [Escherichia coli]
gb|OOI44708.1| hypothetical protein BMU06_18695 [Escherichia coli]
gb|OOI53391.1| hypothetical protein BMT75_18570 [Escherichia coli]
gb|OOI54193.1| hypothetical protein BMT89_10665 [Escherichia coli]
gb|OOI62369.1| hypothetical protein BMT59_13630 [Escherichia coli]
gb|OOI69440.1| hypothetical protein BMU02_14665 [Escherichia coli]
gb|OOI69523.1| hypothetical protein BMT66_12785 [Escherichia coli]
gb|OOI76397.1| hypothetical protein BMU05_16480 [Escherichia coli]
gb|OOI87809.1| hypothetical protein BMT88_14075 [Escherichia coli]
gb|OOI90601.1| hypothetical protein BMT56_13200 [Escherichia coli]
gb|OOI96223.1| hypothetical protein BMT76_15050 [Escherichia coli]
gb|OOJ01736.1| hypothetical protein BMT74_13375 [Escherichia coli]
gb|OOJ10415.1| hypothetical protein BMT94_00080 [Escherichia coli]
gb|OOJ10959.1| hypothetical protein BMT73_12425 [Escherichia coli]
gb|OOJ17251.1| hypothetical protein BMU00_13595 [Escherichia coli]
gb|OOJ18070.1| hypothetical protein BMT97_18530 [Escherichia coli]
gb|OOJ26313.1| hypothetical protein BMT90_15615 [Escherichia coli]
gb|OOJ32150.1| hypothetical protein BMT96_14655 [Escherichia coli]
gb|OOJ35205.1| hypothetical protein BMT87_10470 [Escherichia coli]
gb|OOJ43159.1| hypothetical protein BMT79_05750 [Escherichia coli]
gb|OOJ46116.1| hypothetical protein BMT72_18635 [Escherichia coli]
gb|OOJ48322.1| hypothetical protein BMT77_14595 [Escherichia coli]
gb|OOJ57089.1| hypothetical protein BMT70_14140 [Escherichia coli]
gb|OOJ60782.1| hypothetical protein BMT84_13150 [Escherichia coli]
gb|OOJ66985.1| hypothetical protein BMT71_12605 [Escherichia coli]
gb|OOJ73269.1| hypothetical protein BMT68_14010 [Escherichia coli]
gb|OOJ77020.1| hypothetical protein BMT82_00470 [Escherichia coli]
gb|OOJ80279.1| hypothetical protein BMT58_14145 [Escherichia coli]
gb|OOJ87458.1| hypothetical protein BMU04_04445 [Escherichia coli]
gb|OOJ88333.1| hypothetical protein BMU03_19440 [Escherichia coli]
gb|OOJ95761.1| hypothetical protein BMT78_11840 [Escherichia coli]
gb|OOJ99578.1| hypothetical protein BMT80_21365 [Escherichia coli]
gb|OOK09289.1| hypothetical protein BMT93_01195 [Escherichia coli]
gb|OOK12081.1| hypothetical protein BMT92_15045 [Escherichia coli]
gb|OOK12348.1| hypothetical protein BMT69_16430 [Escherichia coli]
gb|OOK20809.1| hypothetical protein BMT83_14265 [Escherichia coli]
gb|OOK27385.1| hypothetical protein BMT91_14275 [Escherichia coli]
gb|OOK33623.1| hypothetical protein BMT67_10535 [Escherichia coli]
gb|OOK34255.1| hypothetical protein BMT99_14200 [Escherichia coli]
gb|OOK62351.1| hypothetical protein BMT95_01200 [Escherichia coli]
gb|OOM84593.1| hypothetical protein BWR05_15985 [Escherichia coli]
gb|OON48604.1| hypothetical protein BV389_16510 [Escherichia coli]
gb|OON75044.1| hypothetical protein B1R43_17285 [Escherichia coli]
gb|AQU96266.1| hypothetical protein B1200_13825 [Escherichia coli]
gb|OOO78182.1| hypothetical protein AJR18_010945 [Shigella boydii]
gb|OOO81025.1| hypothetical protein AJR32_010645 [Shigella sonnei]
gb|OOO89543.1| hypothetical protein AJR19_014620 [Shigella dysenteriae]
gb|OOO90367.1| hypothetical protein AJR20_013650 [Shigella dysenteriae]
gb|OOO91401.1| hypothetical protein AJR21_019300 [Shigella dysenteriae]
gb|OOP19387.1| hypothetical protein AJR26_004975 [Shigella flexneri]
gb|OOP24461.1| hypothetical protein AJR29_019635 [Shigella flexneri]
gb|OOP36372.1| hypothetical protein AJR31_003975 [Shigella sonnei]
gb|AQV21543.1| hypothetical protein BE957_21550 [Escherichia coli]
gb|AQV27127.1| hypothetical protein BE964_23135 [Escherichia coli]
gb|AQV31215.1| hypothetical protein BE963_17365 [Escherichia coli]
gb|AQV36536.1| hypothetical protein BE933_16930 [Escherichia coli]
gb|AQV43378.1| hypothetical protein BE959_26225 [Escherichia coli]
gb|AQV44605.1| hypothetical protein BE966_01825 [Escherichia coli]
gb|AQV52226.1| hypothetical protein BE949_13875 [Escherichia coli]
gb|AQV58579.1| hypothetical protein BE941_20135 [Escherichia coli]
gb|AQV60664.1| hypothetical protein BE928_01665 [Escherichia coli]
gb|AQV67364.1| hypothetical protein BE930_11045 [Escherichia coli]
gb|AQV75759.1| hypothetical protein BE932_26820 [Escherichia coli]
gb|AQV79753.1| hypothetical protein BE962_16615 [Escherichia coli]
gb|AQV86722.1| hypothetical protein BE940_26920 [Escherichia coli]
gb|AQV89552.1| hypothetical protein BE948_13275 [Escherichia coli]
gb|AQW03228.1| hypothetical protein BE939_20360 [Escherichia coli]
gb|AQW05696.1| hypothetical protein BE946_06075 [Escherichia coli]
gb|AQW10325.1| hypothetical protein BE965_03115 [Escherichia coli]
gb|AQW18377.1| hypothetical protein BE937_18060 [Escherichia coli]
gb|OOV70629.1| hypothetical protein B1739_09445 [Escherichia coli]
gb|OOW17215.1| hypothetical protein B1732_13380 [Escherichia coli]
gb|OOW22590.1| hypothetical protein B1733_12095 [Escherichia coli]
gb|OOW27857.1| hypothetical protein B1734_11370 [Escherichia coli]
gb|AQW72092.1| hypothetical protein B2H83_04340 [Escherichia coli M8]
gb|AQX95736.1| hypothetical protein B0908_03230 [Escherichia coli NU14]
gb|OPH63655.1| hypothetical protein B1763_09575 [Escherichia coli O157:H7]
gb|OPH68932.1| hypothetical protein B1764_10910 [Escherichia coli O157:H7]
gb|OPH73440.1| hypothetical protein B1765_11130 [Escherichia coli O157:H7]
gb|OPI34732.1| hypothetical protein BFQ16_07295 [Escherichia coli]
gb|OPI35137.1| hypothetical protein BFQ20_01670 [Escherichia coli]
gb|OPI40755.1| hypothetical protein BFQ11_11365 [Escherichia coli]
gb|OPI48572.1| hypothetical protein BFQ13_17735 [Escherichia coli]
gb|OPI54482.1| hypothetical protein BFQ10_01505 [Escherichia coli]
gb|OPI59738.1| hypothetical protein BFQ23_01835 [Escherichia coli]
gb|OPI63766.1| hypothetical protein BFQ27_14675 [Escherichia coli]
gb|OPI64290.1| hypothetical protein BFQ07_02415 [Escherichia coli]
gb|OPI70739.1| hypothetical protein BFQ19_17255 [Escherichia coli]
gb|OPI76694.1| hypothetical protein BFQ26_00750 [Escherichia coli]
gb|OPI79713.1| hypothetical protein BFQ22_08090 [Escherichia coli]
gb|OPI87544.1| hypothetical protein BFQ08_13410 [Escherichia coli]
gb|OPI91414.1| hypothetical protein BFQ09_06875 [Escherichia coli]
gb|OPI95304.1| hypothetical protein BFQ12_02845 [Escherichia coli]
gb|OPJ10496.1| hypothetical protein BFQ06_02410 [Escherichia coli]
gb|OPJ10697.1| hypothetical protein BFQ15_18815 [Escherichia coli]
gb|OPJ12855.1| hypothetical protein BFQ17_03495 [Escherichia coli]
gb|OPJ21105.1| hypothetical protein BFQ21_08060 [Escherichia coli]
gb|OPJ23330.1| hypothetical protein BFQ24_02650 [Escherichia coli]
gb|OPJ27691.1| hypothetical protein BFQ25_02000 [Escherichia coli]
gb|OPJ34833.1| hypothetical protein BFX88_15295 [Escherichia coli]
gb|OPJ37104.1| hypothetical protein BFQ14_00705 [Escherichia coli]
gb|OPJ38102.1| hypothetical protein BFQ18_02700 [Escherichia coli]
gb|OPJ46071.1| hypothetical protein BFX89_11190 [Escherichia coli]
gb|OPJ53961.1| hypothetical protein BFX87_18475 [Escherichia coli]
gb|AQZ31359.1| hypothetical protein USML2_20620 [Escherichia coli]
gb|AQZ78559.1| hypothetical protein Eco28_03684 [Escherichia coli]
gb|AQZ87405.1| hypothetical protein EC725_19710 [Escherichia coli]
gb|ARA03807.1| hypothetical protein EC780_21310 [Escherichia coli]
gb|ARA08800.1| hypothetical protein EC767_18965 [Escherichia coli]
gb|ARA16464.1| hypothetical protein AM365_05730 [Escherichia coli]
gb|ARA32791.1| hypothetical protein AM448_17810 [Escherichia coli]
gb|ARA35745.1| hypothetical protein AM440_08170 [Escherichia coli]
gb|ARA65043.1| hypothetical protein AM483_16725 [Escherichia coli]
gb|OQK72263.1| hypothetical protein BWR58_03095 [Shigella sonnei]
gb|ARD50475.1| hypothetical protein BHT24_03705 [Escherichia coli]
gb|ARD76416.1| hypothetical protein AYL54_01205 [Escherichia coli]
gb|ARD80293.1| hypothetical protein AYR48_01205 [Escherichia coli]
gb|ARE48496.1| hypothetical protein B6N50_16415 [Escherichia coli C]
dbj|BAX10023.1| hypothetical protein MRY16002_c6890 [Escherichia coli]
dbj|BAX15050.1| hypothetical protein MRY15117_c06400 [Escherichia coli]
dbj|BAX19980.1| hypothetical protein MRY15131_c06380 [Escherichia coli]
gb|ORC99273.1| hypothetical protein A4T35_03300 [Escherichia coli]
gb|ORD02789.1| hypothetical protein A4T55_02070 [Escherichia coli]
gb|ORD06816.1| hypothetical protein A4T34_13075 [Escherichia coli]
gb|ORD10166.1| hypothetical protein A4T36_20920 [Escherichia coli]
gb|ORD18214.1| hypothetical protein A4T37_02250 [Escherichia coli]
gb|ORD29887.1| hypothetical protein A4T38_02255 [Escherichia coli]
gb|ORD32067.1| hypothetical protein A4T40_06840 [Escherichia coli]
gb|ORD44654.1| hypothetical protein A4T44_02430 [Escherichia coli]
gb|ORD47386.1| hypothetical protein A4T41_03920 [Escherichia coli]
gb|ORD51998.1| hypothetical protein A4T50_18145 [Escherichia coli]
gb|ORD61963.1| hypothetical protein A4T48_02445 [Escherichia coli]
gb|ORD67118.1| hypothetical protein A4T52_15690 [Escherichia coli]
gb|ORD73577.1| hypothetical protein A4T53_02655 [Escherichia coli]
gb|ORD79454.1| hypothetical protein A4T54_17340 [Escherichia coli]
gb|ORD81706.1| hypothetical protein A4T33_16975 [Escherichia coli]
gb|ORD89983.1| hypothetical protein A4T56_02440 [Escherichia coli]
gb|ORE75075.1| hypothetical protein B6D27_17050 [Escherichia coli]
gb|ORE77169.1| hypothetical protein B6D24_16125 [Escherichia coli]
gb|ARH96387.1| putative uncharacterized protein YbeL [Escherichia coli]
gb|ORJ78472.1| hypothetical protein BHS81_03780 [Escherichia coli]
gb|ORR85550.1| hypothetical protein BGP68_03740 [Escherichia coli]
gb|ORR85730.1| hypothetical protein BGP69_03470 [Escherichia coli]
gb|ORR98782.1| hypothetical protein BGP67_03445 [Escherichia coli]
gb|ORS48151.1| hypothetical protein BIQ91_21975 [Escherichia coli]
gb|ORS48633.1| hypothetical protein BIQ89_12530 [Escherichia coli]
gb|ORS50750.1| hypothetical protein BIQ90_03815 [Escherichia coli]
gb|ORS59085.1| hypothetical protein BIQ88_15625 [Escherichia coli]
gb|ORS65389.1| hypothetical protein BHS95_03290 [Escherichia coli]
gb|ORS72652.1| hypothetical protein BHS94_04155 [Escherichia coli]
gb|ORS80293.1| hypothetical protein BHS93_03620 [Escherichia coli]
gb|ORS80660.1| hypothetical protein BHS91_03360 [Escherichia coli]
gb|ORS86671.1| hypothetical protein BHS90_03245 [Escherichia coli]
gb|ORS94449.1| hypothetical protein BHS88_03255 [Escherichia coli]
gb|ORS95308.1| hypothetical protein BHS89_04000 [Escherichia coli]
gb|ORT06418.1| hypothetical protein BHS85_03365 [Escherichia coli]
gb|ORT09186.1| hypothetical protein BHS87_03375 [Escherichia coli]
gb|ORT10498.1| hypothetical protein BHS84_03235 [Escherichia coli]
gb|ORT21417.1| hypothetical protein BGP71_03985 [Escherichia coli]
gb|ORT24757.1| hypothetical protein BIQ83_03390 [Escherichia coli]
gb|ORT25650.1| hypothetical protein BGP70_03395 [Escherichia coli]
gb|ORT32357.1| hypothetical protein BIQ81_03315 [Escherichia coli]
gb|ORT35980.1| hypothetical protein BIQ80_03305 [Escherichia coli]
gb|ORT40771.1| hypothetical protein BHT55_03200 [Escherichia coli]
gb|ORT45721.1| hypothetical protein BIQ85_03575 [Escherichia coli]
emb|SMB32430.1| FIG002095: hypothetical protein [Escherichia coli]
emb|SMB32428.1| FIG002095: hypothetical protein [Escherichia coli]
gb|OSB88433.1| hypothetical protein B7482_09875 [Escherichia coli]
gb|OSB93557.1| hypothetical protein B7483_04525 [Escherichia coli]
gb|OSC12546.1| hypothetical protein B8A24_15655 [Escherichia coli]
gb|OSC17369.1| hypothetical protein B7980_18260 [Escherichia coli]
emb|SMH56431.1| Zinc-ribbon containing domain-containing protein [Escherichia coli]
gb|ARJ97188.1| hypothetical protein BCD20_17725 [Escherichia coli]
gb|OSK03838.1| hypothetical protein L082_10388 [Escherichia coli SHECO001]
gb|OSK14139.1| hypothetical protein EAOG_02406 [Escherichia coli R527]
gb|OSK16762.1| putative alpha helical protein [Escherichia coli FVEC1465]
gb|OSK28504.1| putative alpha helical protein [Escherichia coli M056]
gb|OSK29919.1| methyl-accepting chemotaxis protein [Escherichia coli B574]
gb|OSK32706.1| putative alpha helical protein [Escherichia coli TA144]
gb|OSK40754.1| putative alpha helical protein [Escherichia coli E267]
gb|OSK43796.1| methyl-accepting chemotaxis protein [Escherichia coli B671]
gb|OSK50098.1| methyl-accepting chemotaxis protein [Escherichia coli B108]
gb|OSK51438.1| putative alpha helical protein [Escherichia coli H588]
gb|OSK55686.1| putative alpha helical protein [Escherichia coli H413]
gb|OSK62027.1| putative alpha helical protein [Escherichia coli E560]
gb|OSK69220.1| methyl-accepting chemotaxis protein [Escherichia coli B921]
gb|OSK73147.1| putative alpha helical protein [Escherichia coli E1114]
gb|OSK77767.1| putative alpha helical protein [Escherichia coli H223]
gb|OSK80775.1| putative alpha helical protein [Escherichia coli H001]
gb|OSK89484.1| methyl-accepting chemotaxis protein [Escherichia coli B367]
gb|OSK89881.1| putative alpha helical protein [Escherichia coli H378]
gb|OSK96409.1| putative alpha helical protein [Escherichia coli TA447]
gb|OSK99747.1| putative alpha helical protein [Escherichia coli E1002]
gb|OSL10069.1| putative alpha helical protein [Escherichia coli H296]
gb|OSL14809.1| putative alpha helical protein [Escherichia coli H305]
gb|OSL15314.1| putative alpha helical protein [Escherichia coli H386]
gb|OSL19354.1| methyl-accepting chemotaxis protein [Escherichia coli B175]
gb|OSL24380.1| putative alpha helical protein [Escherichia coli TA255]
gb|OSL37604.1| putative alpha helical protein [Escherichia coli H617]
gb|OSL43640.1| putative alpha helical protein [Escherichia coli H461]
gb|OSL49561.1| putative alpha helical protein [Escherichia coli H605]
gb|OSL59644.1| putative alpha helical protein [Escherichia coli H454]
gb|OSL63114.1| putative alpha helical protein [Escherichia coli H383]
gb|OSL65412.1| putative alpha helical protein [Escherichia coli H420]
gb|OSL75538.1| putative alpha helical protein [Escherichia coli TA054]
gb|OSL77815.1| putative alpha helical protein [Escherichia coli TA014]
gb|OSL80854.1| putative alpha helical protein [Escherichia coli TA008]
gb|OSL85942.1| putative alpha helical protein [Escherichia coli TA249]
gb|OSL96139.1| putative alpha helical protein [Escherichia coli T426]
gb|OSM05830.1| putative alpha helical protein [Escherichia coli E1118]
gb|OSM08150.1| putative alpha helical protein [Escherichia coli R424]
gb|OSM85525.1| hypothetical protein L317_14805 [Escherichia coli SHECO003]
gb|OSM91485.1| hypothetical protein L316_11409 [Escherichia coli SHECO002]
gb|OSP33013.1| hypothetical protein B9P94_06670 [Escherichia coli]
gb|ARM39734.1| hypothetical protein AWH44_03575 [Escherichia coli]
gb|ARM80775.1| hypothetical protein B9W17_19845 [Escherichia coli]
gb|OSY82627.1| hypothetical protein AVR71_03240 [Escherichia coli]
gb|ARQ22858.1| hypothetical protein BMI82_03370 [Escherichia coli]
gb|OTA12623.1| hypothetical protein BCR79_17005 [Escherichia coli]
gb|OTB23246.1| hypothetical protein B9G66_19685 [Escherichia coli]
gb|OTB30840.1| hypothetical protein B9G68_00395 [Escherichia coli]
gb|OTB33766.1| hypothetical protein AW057_15540 [Escherichia coli]
gb|OTB41790.1| hypothetical protein AW059_00735 [Escherichia coli]
gb|OTB44566.1| hypothetical protein AW060_14055 [Escherichia coli]
gb|OTB49531.1| hypothetical protein AW058_14590 [Escherichia coli]
gb|OTB50805.1| hypothetical protein AW061_22710 [Escherichia coli]
gb|OTB55988.1| hypothetical protein AW062_15435 [Escherichia coli]
gb|OTB64005.1| hypothetical protein AW065_15870 [Escherichia coli]
gb|OTB68991.1| hypothetical protein AW063_18760 [Escherichia coli]
gb|OTB80864.1| hypothetical protein AW068_12890 [Escherichia coli]
gb|OTB87634.1| hypothetical protein AW067_03560 [Escherichia coli]
gb|OTB91197.1| hypothetical protein AW070_12035 [Escherichia coli]
gb|OTB97580.1| hypothetical protein AW066_11035 [Escherichia coli]
gb|OTC03057.1| hypothetical protein AW072_18995 [Escherichia coli]
gb|OTC15171.1| hypothetical protein AW074_10070 [Escherichia coli]
gb|OTC16728.1| hypothetical protein AW071_08375 [Escherichia coli]
gb|OTC22681.1| hypothetical protein AW073_11105 [Escherichia coli]
gb|OTC27575.1| hypothetical protein AW077_13540 [Escherichia coli]
gb|OTC36760.1| hypothetical protein AW076_03935 [Escherichia coli]
gb|OTC39702.1| hypothetical protein AW075_09565 [Escherichia coli]
gb|OTC41556.1| hypothetical protein AW079_15975 [Escherichia coli]
gb|OTC49517.1| hypothetical protein AW078_16010 [Escherichia coli]
gb|OTC50987.1| hypothetical protein AW080_14820 [Escherichia coli]
gb|OTC58819.1| hypothetical protein AW081_12280 [Escherichia coli]
gb|OTC71272.1| hypothetical protein AW083_11325 [Escherichia coli]
gb|OTC76932.1| hypothetical protein AW084_06160 [Escherichia coli]
gb|OTC80416.1| hypothetical protein AW085_13890 [Escherichia coli]
gb|OTC86287.1| hypothetical protein AW086_18155 [Escherichia coli]
gb|OTC91916.1| hypothetical protein AW088_08535 [Escherichia coli]
gb|OTC97754.1| hypothetical protein AW087_12160 [Escherichia coli]
gb|OTD05351.1| hypothetical protein AW089_02330 [Escherichia coli]
gb|OTD08313.1| hypothetical protein AW093_18100 [Escherichia coli]
gb|OTD10304.1| hypothetical protein AW090_06770 [Escherichia coli]
gb|OTD21730.1| hypothetical protein AW092_02875 [Escherichia coli]
gb|OTD22445.1| hypothetical protein AW091_16305 [Escherichia coli]
gb|OTD24108.1| hypothetical protein AW094_19620 [Escherichia coli]
gb|OTD38974.1| hypothetical protein AW095_01735 [Escherichia coli]
gb|OTD39913.1| hypothetical protein AW097_11260 [Escherichia coli]
gb|OTD44153.1| hypothetical protein AW096_07305 [Escherichia coli]
gb|OTD50702.1| hypothetical protein AW098_07575 [Escherichia coli]
gb|OTD54748.1| hypothetical protein AW100_08520 [Escherichia coli]
gb|OTD60606.1| hypothetical protein AW099_08420 [Escherichia coli]
gb|OTD63490.1| hypothetical protein AW101_16970 [Escherichia coli]
gb|OTD69113.1| hypothetical protein AW102_14645 [Escherichia coli]
gb|OTD73883.1| hypothetical protein AW103_16035 [Escherichia coli]
gb|OTD82769.1| hypothetical protein AW105_12395 [Escherichia coli]
gb|OTD92319.1| hypothetical protein AW108_16730 [Escherichia coli]
gb|OTD94885.1| hypothetical protein AW107_02825 [Escherichia coli]
gb|OTD99825.1| hypothetical protein AW106_14390 [Escherichia coli]
gb|OTE09652.1| hypothetical protein AW109_10100 [Escherichia coli]
gb|OTE13302.1| hypothetical protein AW110_04875 [Escherichia coli]
gb|OTE20120.1| hypothetical protein AW112_02295 [Escherichia coli]
gb|OTE22391.1| hypothetical protein AW111_15590 [Escherichia coli]
gb|OTE26359.1| hypothetical protein AW113_15890 [Escherichia coli]
gb|OTE31350.1| hypothetical protein AW116_17545 [Escherichia coli]
gb|OTE37371.1| hypothetical protein AW114_14215 [Escherichia coli]
gb|OTE52989.1| hypothetical protein AW119_04825 [Escherichia coli]
gb|OTE53364.1| hypothetical protein AW115_11270 [Escherichia coli]
gb|OTE58228.1| hypothetical protein AW118_17110 [Escherichia coli]
gb|OTE65691.1| hypothetical protein AW121_14700 [Escherichia coli]
gb|OTE69458.1| hypothetical protein AW120_11500 [Escherichia coli]
gb|OTE77760.1| hypothetical protein AW122_06025 [Escherichia coli]
gb|OTE79331.1| hypothetical protein AW123_17475 [Escherichia coli]
gb|OTE83989.1| hypothetical protein B1K92_20950 [Escherichia coli]
gb|OTE91176.1| hypothetical protein B1K96_20490 [Escherichia coli]
gb|ARR36233.1| hypothetical protein CA593_25940 [Escherichia coli]
gb|ARR42475.1| hypothetical protein B9127_25485 [Shigella sonnei]
gb|ARR59857.1| hypothetical protein CA268_10785 [Escherichia coli]
gb|ARR67745.1| hypothetical protein CA270_24245 [Escherichia coli]
gb|OTV02566.1| hypothetical protein BA733_11510 [Escherichia coli]
gb|OTV07917.1| hypothetical protein BA734_17130 [Escherichia coli]
gb|OTV08806.1| hypothetical protein BA735_13545 [Escherichia coli]
gb|OTV16616.1| hypothetical protein BA736_12615 [Escherichia coli]
gb|OTV33344.1| hypothetical protein BA737_09060 [Escherichia coli]
gb|OTV34255.1| hypothetical protein BA738_09050 [Escherichia coli]
gb|OTV47297.1| hypothetical protein BA731_12670 [Escherichia coli]
gb|OTV51299.1| hypothetical protein BA732_14770 [Escherichia coli]
gb|OUD13483.1| hypothetical protein BVA22_18575 [Escherichia coli M4]
gb|ARS07210.1| hypothetical protein BZ172_19125 [Shigella sonnei]
gb|OUF49746.1| hypothetical protein AZZ59_000095 [Escherichia coli]
gb|OUF59083.1| hypothetical protein AZZ87_003295 [Escherichia coli]
gb|OUF61369.1| hypothetical protein AZZ93_004276 [Escherichia coli]
gb|OUF62127.1| hypothetical protein AZZ88_003291 [Escherichia coli]
gb|OUF73548.1| hypothetical protein AZ004_004394 [Escherichia coli]
gb|OUF74621.1| hypothetical protein AZ005_002992 [Escherichia coli]
gb|OUF82880.1| hypothetical protein AZ024_000329 [Escherichia coli]
gb|OUF88499.1| hypothetical protein G97194_004166 [Escherichia coli]
gb|OUF89518.1| hypothetical protein AZ040_003703 [Escherichia coli]
gb|OUF91212.1| hypothetical protein AZ030_000713 [Escherichia coli]
gb|OUG02643.1| hypothetical protein AZ041_000656 [Escherichia coli]
gb|OUG06921.1| hypothetical protein AZ048_003217 [Escherichia coli]
gb|OUG09017.1| hypothetical protein AZ049_003022 [Escherichia coli]
gb|OUG16397.1| hypothetical protein AZZ65_004414 [Escherichia coli]
gb|OUG26097.1| hypothetical protein AZZ66_000580 [Escherichia coli]
gb|OUG34693.1| hypothetical protein AZZ83_000371 [Escherichia coli]
gb|OUJ64928.1| hypothetical protein BZK32_07625 [Escherichia coli]
gb|OUJ67295.1| hypothetical protein BZK35_15130 [Escherichia coli]
gb|OUJ90817.1| hypothetical protein BW735_08960 [Escherichia coli]
gb|OUK50767.1| hypothetical protein BZL33_16475 [Escherichia coli]
gb|OUK71507.1| hypothetical protein BZL34_06535 [Escherichia coli]
gb|OUK89113.1| hypothetical protein BZL68_02215 [Escherichia coli]
gb|OUK97562.1| hypothetical protein BZL69_08405 [Escherichia coli]
gb|OUL01683.1| hypothetical protein BZL70_01535 [Escherichia coli]
gb|OUL12002.1| hypothetical protein B0698_20160 [Escherichia coli]
gb|ART15400.1| hypothetical protein EC95JB1_04702 [Escherichia coli]
gb|ART23204.1| hypothetical protein EC95NR1_04878 [Escherichia coli]
gb|ART45141.1| hypothetical protein DNNLJILF_03961 [Escherichia coli]
gb|OUP40625.1| hypothetical protein B5F26_15285 [Escherichia coli]
gb|OUR41059.1| hypothetical protein AZ025_003800 [Escherichia coli]
gb|OUR42487.1| hypothetical protein AZZ60_003712 [Escherichia coli]
gb|OUR59116.1| hypothetical protein AZZ92_000636 [Escherichia coli]
gb|ARV31200.1| hypothetical protein BS635_15820 [Escherichia coli]
gb|ARV35954.1| hypothetical protein BUQ71_15840 [Escherichia coli]
gb|ARV50354.1| hypothetical protein BZY74_15130 [Escherichia coli]
gb|OUZ67975.1| hypothetical protein CBL19_05535 [Shigella sonnei]
gb|OUZ80613.1| hypothetical protein CBW45_13385 [Shigella flexneri]
gb|OUZ85398.1| hypothetical protein CBL22_13565 [Shigella flexneri]
gb|OUZ94751.1| hypothetical protein CBL17_05865 [Shigella sonnei]
gb|OUZ98245.1| hypothetical protein CBL23_05085 [Shigella sonnei]
gb|OVA44194.1| hypothetical protein UP79_08460 [Escherichia coli]
gb|OVA45515.1| hypothetical protein UP76_14850 [Escherichia coli]
gb|OVA48920.1| hypothetical protein UP77_13640 [Escherichia coli]
gb|OVA57502.1| hypothetical protein UP83_13400 [Escherichia coli]
gb|OVA61952.1| hypothetical protein UP86_13690 [Escherichia coli]
gb|OVA66666.1| hypothetical protein UP92_12755 [Escherichia coli]
gb|OVA70746.1| hypothetical protein UP94_20585 [Escherichia coli]
gb|OVA80981.1| hypothetical protein UP98_09135 [Escherichia coli]
gb|OVA85572.1| hypothetical protein UQ00_01525 [Escherichia coli]
gb|OVA91301.1| hypothetical protein UQ01_03430 [Escherichia coli]
gb|OVA94246.1| hypothetical protein UQ02_15085 [Escherichia coli]
gb|OVB00502.1| hypothetical protein UQ04_07910 [Escherichia coli]
gb|OVB07039.1| hypothetical protein UQ05_06630 [Escherichia coli]
gb|OVB13093.1| hypothetical protein UQ07_11500 [Escherichia coli]
gb|OVB17623.1| hypothetical protein UQ06_02695 [Escherichia coli]
gb|OVB22747.1| hypothetical protein UQ11_10565 [Escherichia coli]
gb|OVB27955.1| hypothetical protein UQ16_12030 [Escherichia coli]
gb|OVB29024.1| hypothetical protein UQ12_18050 [Escherichia coli]
gb|OVB39469.1| hypothetical protein UQ20_06085 [Escherichia coli]
gb|OVB48771.1| hypothetical protein UQ26_01885 [Escherichia coli]
gb|OVB50323.1| hypothetical protein UQ27_02475 [Escherichia coli]
gb|OVB51794.1| hypothetical protein UQ38_20880 [Escherichia coli]
gb|OVB58731.1| hypothetical protein UQ42_17925 [Escherichia coli]
gb|OVB62548.1| hypothetical protein UQ43_16795 [Escherichia coli]
gb|OVB70966.1| hypothetical protein UP72_09055 [Escherichia coli]
gb|OVB73756.1| hypothetical protein UP74_20980 [Escherichia coli]
gb|OVB77954.1| hypothetical protein UP75_20310 [Escherichia coli]
gb|OVB84471.1| hypothetical protein UP73_20680 [Escherichia coli]
gb|OVB92381.1| hypothetical protein UP78_10385 [Escherichia coli]
gb|OVB96852.1| hypothetical protein UP80_14205 [Escherichia coli]
gb|OVC04976.1| hypothetical protein UP81_00270 [Escherichia coli]
gb|OVC10565.1| hypothetical protein UP82_05190 [Escherichia coli]
gb|OVC14949.1| hypothetical protein UP84_05595 [Escherichia coli]
gb|OVC19189.1| hypothetical protein UP85_10470 [Escherichia coli]
gb|OVC25127.1| hypothetical protein UP87_08775 [Escherichia coli]
gb|OVC28904.1| hypothetical protein UP88_13520 [Escherichia coli]
gb|OVC36249.1| hypothetical protein UP89_08925 [Escherichia coli]
gb|OVC43418.1| hypothetical protein UP90_05265 [Escherichia coli]
gb|OVC46113.1| hypothetical protein UP91_09060 [Escherichia coli]
gb|OVC50426.1| hypothetical protein UP93_14830 [Escherichia coli]
gb|OVC60988.1| hypothetical protein UP95_02095 [Escherichia coli]
gb|OVC61735.1| hypothetical protein UP96_11370 [Escherichia coli]
gb|OVC69542.1| hypothetical protein UP97_02445 [Escherichia coli]
gb|OVC74166.1| hypothetical protein UP99_10725 [Escherichia coli]
gb|OVC76789.1| hypothetical protein UQ03_15870 [Escherichia coli]
gb|OVC84200.1| hypothetical protein UQ08_08280 [Escherichia coli]
gb|OVC93182.1| hypothetical protein UQ09_07200 [Escherichia coli]
gb|OVC93686.1| hypothetical protein UQ10_09720 [Escherichia coli]
gb|OVC99590.1| hypothetical protein UQ13_16960 [Escherichia coli]
gb|OVD10335.1| hypothetical protein UQ15_00430 [Escherichia coli]
gb|OVD13340.1| hypothetical protein UQ14_00430 [Escherichia coli]
gb|OVD18039.1| hypothetical protein UQ17_12895 [Escherichia coli]
gb|OVD21154.1| hypothetical protein UQ18_13350 [Escherichia coli]
gb|OVD25950.1| hypothetical protein UQ19_14435 [Escherichia coli]
gb|OVD32171.1| hypothetical protein UQ21_18540 [Escherichia coli]
gb|OVD38384.1| hypothetical protein UQ22_13930 [Escherichia coli]
gb|OVD41522.1| hypothetical protein UQ23_15185 [Escherichia coli]
gb|OVD54861.1| hypothetical protein UQ24_00400 [Escherichia coli]
gb|OVD55347.1| hypothetical protein UQ25_09450 [Escherichia coli]
gb|OVD58472.1| hypothetical protein UQ28_14770 [Escherichia coli]
gb|OVD64922.1| hypothetical protein UQ29_15305 [Escherichia coli]
gb|OVD70589.1| hypothetical protein UQ30_09940 [Escherichia coli]
gb|OVD77255.1| hypothetical protein UQ31_05260 [Escherichia coli]
gb|OVD82738.1| hypothetical protein UQ32_13080 [Escherichia coli]
gb|OVD87317.1| hypothetical protein UQ33_04800 [Escherichia coli]
gb|OVD92676.1| hypothetical protein UQ34_08415 [Escherichia coli]
gb|OVE03903.1| hypothetical protein UQ36_13045 [Escherichia coli]
gb|OVE04784.1| hypothetical protein UQ35_10865 [Escherichia coli]
gb|OVE19929.1| hypothetical protein UQ39_18035 [Escherichia coli]
gb|OVE26167.1| hypothetical protein UQ45_21710 [Escherichia coli]
gb|OVE27580.1| hypothetical protein UQ44_15245 [Escherichia coli]
gb|ARW87037.1| hypothetical protein AM396_09005 [Escherichia coli]
gb|ARW93770.1| hypothetical protein AM366_20395 [Escherichia coli]
gb|ARX15085.1| hypothetical protein AM408_16115 [Escherichia coli]
gb|ARX25168.1| hypothetical protein AM437_12695 [Escherichia coli]
gb|ARX31343.1| hypothetical protein AM398_19600 [Escherichia coli]
gb|ARX57504.1| hypothetical protein AM375_21025 [Escherichia coli]
gb|OVG00505.1| hypothetical protein B5L93_13255 [Escherichia coli]
gb|OVG47644.1| hypothetical protein B5L80_14970 [Escherichia coli]
gb|OVJ57864.1| hypothetical protein B8042_01490 [Escherichia coli]
gb|OVY47834.1| hypothetical protein B4P02_03600 [Escherichia coli]
gb|OWB94106.1| hypothetical protein A8M80_00195 [Escherichia coli]
gb|OWC03402.1| hypothetical protein A8M82_08965 [Escherichia coli]
gb|OWC06151.1| hypothetical protein A8M81_11515 [Escherichia coli]
gb|OWC10253.1| hypothetical protein A8G06_19580 [Escherichia coli]
gb|OWC13289.1| hypothetical protein A8G17_00850 [Escherichia coli]
gb|OWC19893.1| hypothetical protein A8G14_04760 [Escherichia coli]
gb|OWC28330.1| hypothetical protein A8G19_10390 [Escherichia coli]
gb|OWC30713.1| hypothetical protein A8G09_01085 [Escherichia coli]
gb|OWC35787.1| hypothetical protein A8F96_03020 [Escherichia coli]
gb|OWC43980.1| hypothetical protein A8F92_12770 [Escherichia coli]
gb|OWC47844.1| hypothetical protein A8F91_20550 [Escherichia coli]
gb|OWC52064.1| hypothetical protein A8F90_02450 [Escherichia coli]
gb|OWC56296.1| hypothetical protein A8G02_16045 [Escherichia coli]
gb|OWC58586.1| hypothetical protein A8F93_02675 [Escherichia coli]
gb|OWC63262.1| hypothetical protein A8F89_17010 [Escherichia coli]
gb|OWC69608.1| hypothetical protein A8F88_17665 [Escherichia coli]
gb|OWC83085.1| hypothetical protein A8F85_03940 [Escherichia coli]
gb|OWC90612.1| hypothetical protein A8F86_21945 [Escherichia coli]
gb|OWC93665.1| hypothetical protein A8F83_03215 [Escherichia coli]
gb|OWC96011.1| hypothetical protein A8F84_19285 [Escherichia coli]
gb|OWC96746.1| hypothetical protein A8F82_14540 [Escherichia coli]
gb|OWD04042.1| hypothetical protein A8F80_09165 [Escherichia coli]
gb|OWD10387.1| hypothetical protein A8C74_00515 [Escherichia coli]
gb|OWD11865.1| hypothetical protein A8C72_01175 [Escherichia coli]
gb|OWD22055.1| hypothetical protein A8C63_18860 [Escherichia coli]
gb|OWD22276.1| hypothetical protein A8C76_09985 [Escherichia coli]
gb|OWD34023.1| hypothetical protein A8C78_06985 [Escherichia coli]
gb|OWD34697.1| hypothetical protein A8C67_10175 [Escherichia coli]
gb|OWD38440.1| hypothetical protein A8C64_01350 [Escherichia coli]
gb|OWD46266.1| hypothetical protein A8C66_11210 [Escherichia coli]
gb|OWD52492.1| hypothetical protein A8C60_07845 [Escherichia coli]
gb|OWD53961.1| hypothetical protein A8C69_02355 [Escherichia coli]
gb|OWD58749.1| hypothetical protein A8C62_21100 [Escherichia coli]
gb|OWD59816.1| hypothetical protein A8C70_21575 [Escherichia coli]
gb|OWD67301.1| hypothetical protein A8C71_16855 [Escherichia coli]
gb|OWD73555.1| hypothetical protein A8C65_06525 [Escherichia coli]
gb|OWD78435.1| hypothetical protein A8C68_16350 [Escherichia coli]
gb|OWD84432.1| hypothetical protein A8M48_14550 [Escherichia coli]
gb|OWD85138.1| hypothetical protein A8M40_07990 [Escherichia coli]
gb|OWD94700.1| hypothetical protein A8M39_06500 [Escherichia coli]
gb|OWD99890.1| hypothetical protein A8M47_12325 [Escherichia coli]
gb|OWE08272.1| hypothetical protein A8M44_12600 [Escherichia coli]
gb|OWE09272.1| hypothetical protein A8M49_08480 [Escherichia coli]
gb|OWE16900.1| hypothetical protein A8M41_09900 [Escherichia coli]
gb|OWE22563.1| hypothetical protein A8M43_05595 [Escherichia coli]
gb|OWE39802.1| hypothetical protein A8M67_08860 [Escherichia coli]
gb|OWE45955.1| hypothetical protein A8G07_03270 [Escherichia coli]
gb|OWE51577.1| hypothetical protein A8M66_01855 [Escherichia coli]
gb|OWE56872.1| hypothetical protein A8M64_12885 [Escherichia coli]
gb|OWE57666.1| hypothetical protein A8M63_07380 [Escherichia coli]
gb|OWE67045.1| hypothetical protein A8M73_17835 [Escherichia coli]
gb|OWE74241.1| hypothetical protein A8M68_08610 [Escherichia coli]
gb|OWE78952.1| hypothetical protein A8M69_16225 [Escherichia coli]
gb|OWE80033.1| hypothetical protein A8M61_10355 [Escherichia coli]
gb|OWE92227.1| hypothetical protein A8M75_04740 [Escherichia coli]
gb|OWE94221.1| hypothetical protein A8M72_08620 [Escherichia coli]
gb|OWE94857.1| hypothetical protein A8M65_02385 [Escherichia coli]
gb|OWE98405.1| hypothetical protein A8M70_18420 [Escherichia coli]
gb|OWF03917.1| hypothetical protein A8M62_19555 [Escherichia coli]
gb|OWF12167.1| hypothetical protein A8M71_20875 [Escherichia coli]
gb|OWF17525.1| hypothetical protein A8M78_16895 [Escherichia coli]
gb|OWF26945.1| hypothetical protein A9X62_14185 [Escherichia coli]
gb|OWF27107.1| hypothetical protein A8M76_08890 [Escherichia coli]
gb|ARZ82564.1| hypothetical protein AM361_05890 [Escherichia coli]
gb|ARZ89433.1| hypothetical protein AM397_17210 [Escherichia coli]
gb|ASA43794.1| hypothetical protein CCL28_17775 [Escherichia coli]
gb|OWG46991.1| hypothetical protein CCE24_02200 [Escherichia coli]
gb|OWG47768.1| hypothetical protein CCE11_16480 [Escherichia coli]
gb|OWG51654.1| hypothetical protein CCE17_19565 [Escherichia coli]
gb|OWG61358.1| hypothetical protein CCE16_15825 [Escherichia coli]
gb|OWG61469.1| hypothetical protein CCE08_03120 [Escherichia coli]
gb|OWG65154.1| hypothetical protein CCE21_18045 [Escherichia coli]
gb|OWG71723.1| hypothetical protein CCE19_19235 [Escherichia coli]
gb|OWG74832.1| hypothetical protein CCE25_21445 [Escherichia coli]
gb|OWG78283.1| hypothetical protein CCE18_17415 [Escherichia coli]
gb|OWG86596.1| hypothetical protein CCE23_16990 [Escherichia coli]
gb|OWG87996.1| hypothetical protein CCE26_21475 [Escherichia coli]
gb|OWH00622.1| hypothetical protein CCE15_02200 [Escherichia coli]
gb|OWH03286.1| hypothetical protein CCE12_15240 [Escherichia coli]
gb|OWH04326.1| hypothetical protein CCE13_11520 [Escherichia coli]
gb|OWH12471.1| hypothetical protein CCE10_14500 [Escherichia coli]
gb|OWH19185.1| hypothetical protein CCE22_02200 [Escherichia coli]
gb|OWH23625.1| hypothetical protein CCE14_01315 [Escherichia coli]
gb|OWH28102.1| hypothetical protein CCE09_02200 [Escherichia coli]
gb|ASA61113.1| hypothetical protein CDH88_15175 [Escherichia coli]
gb|ASA66809.1| hypothetical protein CDH89_18150 [Escherichia coli]
gb|ASB81155.1| hypothetical protein AM384_23355 [Escherichia coli]
gb|ASC18420.1| hypothetical protein AM434_19680 [Escherichia coli]
gb|OWP97748.1| hypothetical protein B7455_10955 [Escherichia coli]
gb|OWR20490.1| hypothetical protein CD912_04005 [Shigella boydii]
gb|OWR39090.1| hypothetical protein BSQ42_07865 [Escherichia coli]
gb|OWS79536.1| hypothetical protein B7C52_15440 [Escherichia coli]
gb|OWS87551.1| hypothetical protein B7C53_00340 [Escherichia coli]
gb|ASE46555.1| hypothetical protein CEP72_05170 [Escherichia coli O157]
gb|ASF01156.1| hypothetical protein CEQ26_01790 [Escherichia coli O104:H4]
gb|ASG48917.1| hypothetical protein CES94_08065 [Escherichia coli]
gb|OWW48695.1| hypothetical protein CCS19_18465 [Escherichia coli]
gb|OWW54229.1| hypothetical protein CCS08_16900 [Escherichia coli]
gb|OWX86514.1| hypothetical protein BIQ87_03375 [Escherichia coli]
gb|OWX87254.1| hypothetical protein BIQ86_03985 [Escherichia coli]
gb|OWX92763.1| hypothetical protein BHS80_03270 [Escherichia coli]
gb|OWY55650.1| hypothetical protein CA947_08165 [Escherichia coli]
gb|ASI17430.1| hypothetical protein CE141_17390 [Escherichia coli]
gb|ASI52182.1| Hypothetical protein FORC43_3887 [Escherichia coli]
gb|ASJ31609.1| hypothetical protein ACJ74_20920 [Escherichia coli]
gb|ASJ33154.1| hypothetical protein ACJ76_03385 [Escherichia coli]
gb|ASL31294.1| hypothetical protein CEJ55_11810 [Escherichia coli]
gb|ASL60944.1| hypothetical protein FORC44_4191 [Escherichia coli]
gb|OXJ48364.1| hypothetical protein CDL30_06815 [Escherichia coli]
gb|OXJ48637.1| hypothetical protein CDL34_17095 [Escherichia coli]
gb|OXJ57328.1| hypothetical protein CDL53_07990 [Escherichia coli]
gb|OXJ59668.1| hypothetical protein CDL52_16640 [Escherichia coli]
gb|OXJ65823.1| hypothetical protein CDL51_12305 [Escherichia coli]
gb|OXJ70690.1| hypothetical protein CDL32_12430 [Escherichia coli]
gb|OXJ74177.1| hypothetical protein CDL50_18215 [Escherichia coli]
gb|OXJ80064.1| hypothetical protein CDL49_17460 [Escherichia coli]
gb|OXJ86981.1| hypothetical protein CDL48_04165 [Escherichia coli]
gb|OXJ89173.1| hypothetical protein CDL29_16820 [Escherichia coli]
gb|OXJ95088.1| hypothetical protein CDL46_24855 [Escherichia coli]
gb|OXJ95373.1| hypothetical protein CDL47_15235 [Escherichia coli]
gb|OXK07522.1| hypothetical protein CDL45_09395 [Escherichia coli]
gb|OXK08905.1| hypothetical protein CDL44_19575 [Escherichia coli]
gb|OXK11056.1| hypothetical protein CDL43_26405 [Escherichia coli]
gb|OXK22531.1| hypothetical protein CDL42_07155 [Escherichia coli]
gb|OXK27322.1| hypothetical protein CDL33_09730 [Escherichia coli]
gb|OXK29995.1| hypothetical protein CDL41_15160 [Escherichia coli]
gb|OXK31895.1| hypothetical protein CDL40_26750 [Escherichia coli]
gb|OXK41935.1| hypothetical protein CDL39_11330 [Escherichia coli]
gb|OXK42056.1| hypothetical protein CDL38_24965 [Escherichia coli]
gb|OXK46204.1| hypothetical protein CDL37_27170 [Escherichia coli]
gb|OXK56830.1| hypothetical protein CDL35_24430 [Escherichia coli]
gb|OXK58942.1| hypothetical protein CDL36_09035 [Escherichia coli]
gb|OXK70319.1| hypothetical protein CD801_12750 [Escherichia coli]
gb|OXK76731.1| hypothetical protein CD802_03495 [Escherichia coli]
gb|OXK79078.1| hypothetical protein CD807_03495 [Escherichia coli]
gb|OXK85979.1| hypothetical protein CD804_00660 [Escherichia coli]
gb|OXK87597.1| hypothetical protein CD821_13985 [Escherichia coli]
gb|OXK93035.1| hypothetical protein CD805_14840 [Escherichia coli]
gb|OXK94126.1| hypothetical protein CD803_18200 [Escherichia coli]
gb|OXL03715.1| hypothetical protein CD806_06640 [Escherichia coli]
gb|ASN30716.1| hypothetical protein B9130_12425 [Shigella sonnei]
gb|ASN36983.1| hypothetical protein B9129_24605 [Shigella sonnei]
gb|ASN43475.1| hypothetical protein B9128_14505 [Shigella sonnei]
gb|OXL48615.1| hypothetical protein CD786_12905 [Escherichia coli]
gb|OXL59797.1| hypothetical protein OA49_08170 [Escherichia coli]
gb|OXL63142.1| hypothetical protein OA52_03740 [Escherichia coli]
gb|OXL65628.1| hypothetical protein RO13_05865 [Escherichia coli]
gb|OXL72221.1| hypothetical protein OA53_14145 [Escherichia coli]
gb|OXL73756.1| hypothetical protein OA47_08045 [Escherichia coli]
gb|OXL77722.1| hypothetical protein OA51_17000 [Escherichia coli]
gb|ASO01484.1| hypothetical protein DS1UA2014_13655 [Escherichia coli]
gb|ASO82348.1| hypothetical protein AKN41_0696 [Escherichia coli]
gb|ASO87176.1| hypothetical protein AKO63_0681 [Escherichia coli]
gb|ASO91819.1| hypothetical protein AKO64_0638 [Escherichia coli]
gb|OXU83335.1| hypothetical protein CEB44_24795 [Escherichia coli]
gb|OXU88851.1| hypothetical protein CEB47_18510 [Escherichia coli]
gb|ASQ65619.1| DUF1451 domain containing protein [Escherichia coli NCCP15648]
gb|OXV13815.1| hypothetical protein CDL57_20500 [Escherichia coli]
gb|OXV24502.1| hypothetical protein CDL28_02620 [Escherichia coli]
gb|OXV30577.1| hypothetical protein CDL55_20530 [Escherichia coli]
gb|OXV37332.1| hypothetical protein CDL56_23015 [Escherichia coli]
gb|OXV38331.1| hypothetical protein CDL58_25285 [Escherichia coli]
gb|OXW67739.1| hypothetical protein CG417_05720 [Shigella sonnei]
gb|OXW81371.1| hypothetical protein CG420_06825 [Shigella sonnei]
gb|OXW92608.1| hypothetical protein CG424_05440 [Shigella boydii]
gb|OXX01165.1| hypothetical protein CG413_05475 [Shigella sonnei]
gb|OXX05718.1| hypothetical protein CG414_05200 [Shigella sonnei]
gb|OXX09690.1| hypothetical protein CG421_05265 [Shigella sonnei]
gb|OXX18850.1| hypothetical protein CG426_00955 [Shigella sonnei]
gb|OXZ55794.1| hypothetical protein RW70_00397 [Escherichia coli]
gb|OXZ60729.1| hypothetical protein RW69_00621 [Escherichia coli]
gb|OXZ61482.1| hypothetical protein RW71_00595 [Escherichia coli]
gb|OXZ61757.1| hypothetical protein RW67_03460 [Escherichia coli]
gb|OXZ69862.1| hypothetical protein RW74_02484 [Escherichia coli]
gb|OXZ71050.1| hypothetical protein RW76_02455 [Escherichia coli]
gb|OXZ78136.1| hypothetical protein RW68_01484 [Escherichia coli]
gb|OXZ83384.1| hypothetical protein RW77_02856 [Escherichia coli]
gb|OXZ91844.1| hypothetical protein RW79_00431 [Escherichia coli]
gb|OXZ93351.1| hypothetical protein RW72_00594 [Escherichia coli]
gb|OYA01260.1| hypothetical protein RW80_02652 [Escherichia coli]
gb|OYA04309.1| hypothetical protein RW75_00613 [Escherichia coli]
gb|OYA05789.1| hypothetical protein RW73_00375 [Escherichia coli]
gb|OYA09558.1| hypothetical protein RW85_03899 [Escherichia coli]
gb|OYA09794.1| hypothetical protein RW78_04612 [Escherichia coli]
gb|OYA19381.1| hypothetical protein RW81_00103 [Escherichia coli]
gb|OYA25463.1| hypothetical protein RW88_04064 [Escherichia coli]
gb|OYA29963.1| hypothetical protein RW82_00727 [Escherichia coli]
gb|OYA36835.1| hypothetical protein RW83_00341 [Escherichia coli]
gb|OYA37799.1| hypothetical protein RW91_03308 [Escherichia coli]
gb|OYA48783.1| hypothetical protein RW93_05110 [Escherichia coli]
gb|OYA50224.1| hypothetical protein RW89_00583 [Escherichia coli]
gb|OYA59918.1| hypothetical protein RW84_00467 [Escherichia coli]
gb|OYA62108.1| hypothetical protein RW94_00651 [Escherichia coli]
gb|OYA65663.1| hypothetical protein RW86_00383 [Escherichia coli]
gb|OYA71709.1| hypothetical protein RW92_03290 [Escherichia coli]
gb|OYA72464.1| hypothetical protein RW90_03268 [Escherichia coli]
gb|OYA73970.1| hypothetical protein RW87_00388 [Escherichia coli]
gb|OYA87579.1| hypothetical protein RW99_02589 [Escherichia coli]
gb|OYA88622.1| hypothetical protein RW95_00650 [Escherichia coli]
gb|OYA94066.1| hypothetical protein RW97_00444 [Escherichia coli]
gb|OYA96070.1| hypothetical protein RW96_02760 [Escherichia coli]
gb|OYA98244.1| hypothetical protein RX00_03609 [Escherichia coli]
gb|OYB08735.1| hypothetical protein RX07_04225 [Escherichia coli]
gb|OYB10707.1| hypothetical protein RX03_00412 [Escherichia coli]
gb|OYB14046.1| hypothetical protein RW98_00647 [Escherichia coli]
gb|OYB25593.1| hypothetical protein RX09_00632 [Escherichia coli]
gb|OYB27430.1| hypothetical protein RX01_00415 [Escherichia coli]
gb|OYB32874.1| hypothetical protein RX02_00621 [Escherichia coli]
gb|OYB38026.1| hypothetical protein RX08_02033 [Escherichia coli]
gb|OYB42236.1| hypothetical protein RX05_00626 [Escherichia coli]
gb|OYB45365.1| hypothetical protein RX12_13351 [Escherichia coli]
gb|OYB53851.1| hypothetical protein RX04_02088 [Escherichia coli]
gb|OYB54631.1| hypothetical protein RX06_01719 [Escherichia coli]
gb|OYB58255.1| hypothetical protein RX15_00398 [Escherichia coli]
gb|OYB65161.1| hypothetical protein RX10_03894 [Escherichia coli]
gb|OYB65975.1| hypothetical protein RX17_02193 [Escherichia coli]
gb|OYB71049.1| hypothetical protein RX13_00396 [Escherichia coli]
gb|OYB80943.1| hypothetical protein RX11_01950 [Escherichia coli]
gb|OYB82985.1| hypothetical protein RX18_00380 [Escherichia coli]
gb|OYB89248.1| hypothetical protein RX14_00267 [Escherichia coli]
gb|OYB92690.1| hypothetical protein RX21_01345 [Escherichia coli]
gb|OYB98451.1| hypothetical protein RX16_04896 [Escherichia coli]
gb|OYB99307.1| hypothetical protein RX19_02981 [Escherichia coli]
gb|OYC03054.1| hypothetical protein RX27_02395 [Escherichia coli]
gb|OYC04577.1| hypothetical protein RX26_03565 [Escherichia coli]
gb|OYC13655.1| hypothetical protein RX24_02684 [Escherichia coli]
gb|OYC23561.1| hypothetical protein RX20_00442 [Escherichia coli]
gb|OYC25341.1| hypothetical protein RX30_00370 [Escherichia coli]
gb|OYC28865.1| hypothetical protein RX29_03795 [Escherichia coli]
gb|OYC34575.1| hypothetical protein RX22_00418 [Escherichia coli]
gb|OYC38458.1| hypothetical protein RX23_00621 [Escherichia coli]
gb|OYC39957.1| hypothetical protein RX25_04678 [Escherichia coli]
gb|OYC42723.1| hypothetical protein RX28_02781 [Escherichia coli]
gb|OYC48705.1| hypothetical protein RX34_02073 [Escherichia coli]
gb|OYC54019.1| hypothetical protein RX33_04362 [Escherichia coli]
gb|OYC62655.1| hypothetical protein RX31_03568 [Escherichia coli]
gb|OYC63253.1| hypothetical protein RX36_01309 [Escherichia coli]
gb|OYC71009.1| hypothetical protein RX35_02340 [Escherichia coli]
gb|OYC76873.1| hypothetical protein RX32_02856 [Escherichia coli]
gb|OYC80524.1| hypothetical protein RX37_00593 [Escherichia coli]
gb|OYC84587.1| hypothetical protein RX38_02326 [Escherichia coli]
gb|OYD32130.1| hypothetical protein CA843_003795 [Escherichia coli]
gb|OYE20477.1| hypothetical protein CI676_08440 [Shigella sonnei]
gb|OYE21993.1| hypothetical protein CI675_09685 [Shigella sonnei]
gb|OYE50014.1| hypothetical protein CI674_20415 [Shigella sonnei]
gb|OYE54630.1| hypothetical protein CI633_07615 [Shigella sonnei]
gb|OYE67523.1| hypothetical protein CI632_07055 [Shigella sonnei]
gb|OYE81793.1| hypothetical protein CI631_08500 [Shigella sonnei]
gb|OYF30145.1| hypothetical protein CI782_23295 [Shigella sonnei]
gb|OYF62594.1| hypothetical protein CI642_16530 [Shigella sonnei]
gb|OYF77832.1| hypothetical protein CI641_02270 [Shigella sonnei]
gb|OYF86717.1| hypothetical protein CI640_18955 [Shigella sonnei]
gb|OYG12221.1| hypothetical protein CI650_18545 [Shigella sonnei]
gb|OYG56354.1| hypothetical protein CI730_23335 [Shigella sonnei]
gb|OYG57821.1| hypothetical protein CI733_19970 [Escherichia coli]
gb|OYG69158.1| hypothetical protein CI732_24260 [Shigella boydii]
gb|OYG78032.1| hypothetical protein CI731_22185 [Shigella sonnei]
gb|OYG81207.1| hypothetical protein CI728_03285 [Shigella sonnei]
gb|OYG93805.1| hypothetical protein CI729_04105 [Shigella sonnei]
gb|OYG95519.1| hypothetical protein CI727_09200 [Shigella sonnei]
gb|OYG95888.1| hypothetical protein CI726_21700 [Shigella sonnei]
gb|OYI00187.1| hypothetical protein CI701_15815 [Shigella sonnei]
gb|OYI01982.1| hypothetical protein CI725_25050 [Shigella sonnei]
gb|OYI10974.1| hypothetical protein CI724_18415 [Shigella sonnei]
gb|OYI20469.1| hypothetical protein CI700_14465 [Shigella sonnei]
gb|OYI43269.1| hypothetical protein CI695_09355 [Shigella sonnei]
gb|OYI46104.1| hypothetical protein CI694_22585 [Shigella boydii]
gb|OYI51731.1| hypothetical protein CI693_19425 [Shigella sonnei]
gb|OYI61767.1| hypothetical protein CI688_03435 [Shigella sonnei]
gb|OYI64217.1| hypothetical protein CI691_17290 [Shigella sonnei]
gb|OYI67742.1| hypothetical protein CI685_19010 [Shigella sonnei]
gb|OYI71058.1| hypothetical protein CI692_06685 [Shigella sonnei]
gb|OYI77972.1| hypothetical protein CI690_20295 [Shigella sonnei]
gb|OYI84153.1| hypothetical protein CI689_04410 [Shigella boydii]
gb|OYI94042.1| hypothetical protein CI686_00540 [Shigella sonnei]
gb|OYI99974.1| hypothetical protein CI687_19280 [Shigella boydii]
gb|OYJ20133.1| hypothetical protein CI738_20385 [Shigella sonnei]
gb|OYJ22719.1| hypothetical protein CI684_04535 [Shigella sonnei]
gb|OYJ48643.1| hypothetical protein CI669_23785 [Shigella sonnei]
gb|OYJ50633.1| hypothetical protein CI673_03825 [Shigella sonnei]
gb|OYJ65881.1| hypothetical protein CI735_03580 [Escherichia coli]
gb|OYJ69530.1| hypothetical protein CI668_19220 [Shigella sonnei]
gb|OYJ74776.1| hypothetical protein CI671_11290 [Shigella sonnei]
gb|OYJ80170.1| hypothetical protein CI672_02350 [Escherichia coli]
gb|OYK22503.1| hypothetical protein CI658_24675 [Shigella sonnei]
gb|OYK23116.1| hypothetical protein CI722_13535 [Shigella sonnei]
gb|OYK24461.1| hypothetical protein CI723_17230 [Shigella sonnei]
gb|OYK39908.1| hypothetical protein CI716_24140 [Escherichia coli]
gb|OYK40364.1| hypothetical protein CI720_11525 [Escherichia coli]
gb|OYK41191.1| hypothetical protein CI718_11535 [Escherichia coli]
gb|OYK55933.1| hypothetical protein CI714_08155 [Shigella sonnei]
gb|OYK58955.1| hypothetical protein CI721_11710 [Shigella sonnei]
gb|OYK62478.1| hypothetical protein CI712_24045 [Shigella sonnei]
gb|OYK64012.1| hypothetical protein CI713_01515 [Shigella sonnei]
gb|OYK67756.1| hypothetical protein CI717_23595 [Escherichia coli]
gb|OYK76790.1| hypothetical protein CI719_08445 [Shigella boydii]
gb|OYL19656.1| hypothetical protein CI715_12055 [Shigella sonnei]
gb|OYL23989.1| hypothetical protein CI768_16385 [Shigella sonnei]
gb|OYL35629.1| hypothetical protein CI770_26225 [Shigella sonnei]
gb|OYL40487.1| hypothetical protein CI771_02870 [Escherichia coli]
gb|OYL43590.1| hypothetical protein CI767_20775 [Shigella boydii]
gb|OYL56188.1| hypothetical protein CI766_15900 [Shigella sonnei]
gb|OYL67577.1| hypothetical protein CI765_00280 [Shigella sonnei]
gb|OYL78158.1| hypothetical protein CI764_08555 [Escherichia coli]
gb|OYL99845.1| hypothetical protein CI759_02515 [Shigella sonnei]
gb|OYN27720.1| hypothetical protein CI772_15275 [Shigella boydii]
gb|OYN41649.1| hypothetical protein B7D90_14315 [Escherichia coli]
gb|OYN47788.1| hypothetical protein BTN40_07000 [Escherichia coli]
gb|OYN71253.1| hypothetical protein CGZ73_06170 [Escherichia coli]
gb|AST62458.1| hypothetical protein RM34_03675 [Escherichia coli]
emb|SNW14735.1| putative alpha helical protein [Escherichia coli]
gb|OZC26176.1| hypothetical protein AYO35_15300 [Escherichia coli]
gb|OZG36515.1| hypothetical protein CHH35_21630 [Escherichia coli O157:H7]
gb|OZM86440.1| hypothetical protein CF005_14140 [Escherichia coli]
gb|OZM91706.1| hypothetical protein CF006_13240 [Escherichia coli]
gb|OZN00911.1| hypothetical protein CF018_19245 [Escherichia coli]
gb|OZN07108.1| hypothetical protein CFY88_11990 [Escherichia coli]
gb|OZO55387.1| hypothetical protein CG706_04550 [Escherichia coli]
gb|OZO58992.1| hypothetical protein CG693_10420 [Escherichia coli]
gb|OZO63787.1| hypothetical protein CG691_11020 [Escherichia coli]
gb|OZO69169.1| hypothetical protein CG705_09200 [Escherichia coli]
gb|OZO73683.1| hypothetical protein CG695_11480 [Escherichia coli]
gb|OZO78818.1| hypothetical protein CG704_10535 [Escherichia coli]
gb|OZO83997.1| hypothetical protein CG700_10305 [Escherichia coli]
gb|OZO88917.1| hypothetical protein CG698_09550 [Escherichia coli]
gb|OZO91602.1| hypothetical protein CG703_21265 [Escherichia coli]
gb|OZO98449.1| hypothetical protein CG696_09370 [Escherichia coli]
gb|OZP03024.1| hypothetical protein CG702_11085 [Escherichia coli]
gb|OZP07105.1| hypothetical protein CG692_16190 [Escherichia coli]
gb|OZP13187.1| hypothetical protein CG699_09760 [Escherichia coli]
gb|OZP18249.1| hypothetical protein CG690_09415 [Escherichia coli]
gb|OZP23213.1| hypothetical protein CG697_09435 [Escherichia coli]
gb|OZP29588.1| hypothetical protein CG701_01515 [Escherichia coli]
gb|OZP34321.1| hypothetical protein CG694_03465 [Escherichia coli]
gb|OZR92582.1| hypothetical protein CIG50_13165 [Escherichia coli]
gb|OZS02339.1| hypothetical protein CIG24_13880 [Escherichia coli]
gb|OZS07583.1| hypothetical protein CIG45_13075 [Escherichia coli]
gb|OZS12677.1| hypothetical protein CIG47_12765 [Escherichia coli]
gb|OZX62076.1| hypothetical protein CIJ97_20215 [Escherichia coli]
gb|OZX69723.1| hypothetical protein CIJ96_07305 [Escherichia coli]
gb|OZX75066.1| hypothetical protein CIJ93_06235 [Escherichia coli]
gb|OZX77019.1| hypothetical protein CIJ90_21805 [Escherichia coli]
gb|OZX84658.1| hypothetical protein CIJ88_06805 [Escherichia coli]
gb|OZX87133.1| hypothetical protein CIJ95_18370 [Escherichia coli]
gb|OZX93050.1| hypothetical protein CIJ94_18665 [Escherichia coli]
gb|OZX96824.1| hypothetical protein CIJ92_16960 [Escherichia coli]
gb|OZY01162.1| hypothetical protein CIJ91_26705 [Escherichia coli]
gb|OZY09419.1| hypothetical protein CIJ89_10430 [Escherichia coli]
gb|OZY12702.1| hypothetical protein CIJ87_18485 [Escherichia coli]
gb|OZY18264.1| hypothetical protein CIJ86_17100 [Escherichia coli]
gb|OZY25661.1| hypothetical protein CIG20_00410 [Escherichia coli]
gb|PAB63614.1| hypothetical protein CDH55_22610 [Escherichia coli]
gb|PAB81258.1| hypothetical protein CDH59_18960 [Escherichia coli]
gb|PAB85198.1| hypothetical protein CDH54_11700 [Escherichia coli]
gb|PAB93606.1| hypothetical protein CDH60_06430 [Escherichia coli]
gb|PAB98800.1| hypothetical protein CDH56_00700 [Escherichia coli]
gb|PAC01376.1| hypothetical protein CDH57_14280 [Escherichia coli]
gb|PAC22809.1| hypothetical protein CDH62_10665 [Escherichia coli]
gb|PAL29850.1| hypothetical protein CEJ54_21195 [Escherichia coli]
gb|PAL33380.1| hypothetical protein CEJ53_19315 [Escherichia coli]
gb|PAL40390.1| hypothetical protein CEJ52_04235 [Escherichia coli]
gb|PAL44270.1| hypothetical protein CEJ51_18845 [Escherichia coli]
gb|PAL48182.1| hypothetical protein CEJ50_19425 [Escherichia coli]
gb|PAQ17546.1| hypothetical protein B7979_21755 [Escherichia coli]
gb|PAQ27809.1| hypothetical protein B7952_07535 [Escherichia coli]
gb|PAQ30096.1| hypothetical protein B7958_00370 [Escherichia coli]
gb|PAQ35702.1| hypothetical protein B7956_07815 [Escherichia coli]
gb|PAQ37548.1| hypothetical protein B7950_09960 [Escherichia coli]
gb|PAQ41405.1| hypothetical protein B7962_21390 [Escherichia coli]
gb|PAQ43327.1| hypothetical protein B7973_13255 [Escherichia coli]
gb|PAQ53187.1| hypothetical protein B7968_05590 [Escherichia coli]
gb|PAQ53563.1| hypothetical protein B7961_22630 [Escherichia coli]
gb|PAQ60522.1| hypothetical protein BIZ41_17265 [Escherichia coli]
gb|PAQ72945.1| hypothetical protein BIU78_14055 [Escherichia coli]
gb|PAQ74078.1| hypothetical protein BIU77_13235 [Escherichia coli]
gb|PAQ82079.1| hypothetical protein BIU76_14900 [Escherichia coli]
gb|PAQ86174.1| hypothetical protein BIU75_13790 [Escherichia coli]
gb|PAQ91336.1| hypothetical protein BIU74_16115 [Escherichia coli]
gb|PAQ96054.1| hypothetical protein BIU73_09405 [Escherichia coli]
gb|PAR01866.1| hypothetical protein BIU72_17695 [Escherichia coli]
gb|PAS56093.1| hypothetical protein CDN95_04975 [Escherichia coli]
gb|PAS57338.1| hypothetical protein CDN93_05020 [Escherichia coli]
gb|PAS66337.1| hypothetical protein CDN91_04790 [Escherichia coli]
gb|PAS71853.1| hypothetical protein CDN87_03635 [Escherichia coli]
gb|PAS77509.1| hypothetical protein CDN94_05045 [Escherichia coli]
gb|PAS84691.1| hypothetical protein CDN88_03770 [Escherichia coli]
gb|PAS90571.1| hypothetical protein CDN89_03815 [Escherichia coli]
emb|CTP94544.1| FIG002095: hypothetical protein [Escherichia coli]
gb|ASW58682.1| hypothetical protein PA45B_0980 [Escherichia coli]
gb|ASX07081.1| hypothetical protein CA696_018660 [Escherichia coli]
gb|PAT79266.1| hypothetical protein BTP99_17515 [Escherichia coli]
gb|PAT84731.1| hypothetical protein BTP98_14060 [Escherichia coli]
gb|PAT90831.1| hypothetical protein BTQ00_00435 [Escherichia coli]
gb|PAT95507.1| hypothetical protein BTQ01_17015 [Escherichia coli]
gb|PAU03524.1| hypothetical protein BTQ02_06815 [Escherichia coli]
gb|PAU08542.1| hypothetical protein BTQ03_03090 [Escherichia coli]
gb|PAU14336.1| hypothetical protein BTQ05_19735 [Escherichia coli]
gb|PAU15059.1| hypothetical protein BTQ04_10860 [Escherichia coli]
gb|PAU27403.1| hypothetical protein BTQ06_00295 [Escherichia coli]
gb|PAU29558.1| hypothetical protein BTQ07_05445 [Escherichia coli]
gb|PAU31909.1| hypothetical protein BTQ08_18805 [Escherichia coli]
gb|PAX41634.1| hypothetical protein CI257_20980 [Escherichia coli]
gb|PAX47997.1| hypothetical protein A7H93_13820 [Escherichia coli]
gb|PAX56274.1| hypothetical protein A8106_12945 [Escherichia coli]
gb|ASZ40536.1| hypothetical protein CLD27_03435 [Escherichia coli]
gb|ASZ45179.1| hypothetical protein CLD29_03260 [Escherichia coli]
gb|PAY71387.1| hypothetical protein CEH00_16610 [Shigella boydii]
gb|PAY73166.1| hypothetical protein CEG98_13915 [Shigella flexneri]
gb|PAY79013.1| hypothetical protein CEG96_02255 [Shigella flexneri]
gb|PAY88471.1| hypothetical protein CEG95_10680 [Shigella flexneri]
gb|PAY90009.1| hypothetical protein CEG94_09980 [Shigella boydii]
gb|PAY90766.1| hypothetical protein CEG97_07155 [Shigella flexneri]
gb|PAY95578.1| hypothetical protein CEG99_22345 [Shigella boydii]
gb|PAZ27265.1| hypothetical protein APU33_01990 [Escherichia coli]
gb|PAZ31164.1| hypothetical protein APU34_08690 [Escherichia coli]
gb|PAZ35882.1| hypothetical protein APU35_15735 [Escherichia coli]
gb|PAZ41146.1| hypothetical protein APU36_07030 [Escherichia coli]
gb|PAZ46378.1| hypothetical protein APX81_10090 [Escherichia coli]
gb|PAZ50750.1| hypothetical protein APX82_14155 [Escherichia coli]
gb|PAZ56023.1| hypothetical protein APX83_18205 [Escherichia coli]
gb|PAZ60162.1| hypothetical protein APX84_05195 [Escherichia coli]
gb|PAZ60669.1| hypothetical protein APX87_23490 [Escherichia coli]
gb|PAZ72655.1| hypothetical protein APX88_01230 [Escherichia coli]
gb|PAZ76245.1| hypothetical protein APU31_10290 [Escherichia coli]
gb|PAZ82368.1| hypothetical protein APU32_04660 [Escherichia coli]
gb|PAZ83513.1| hypothetical protein APX79_22705 [Escherichia coli]
gb|PAZ90920.1| hypothetical protein APX80_15140 [Escherichia coli]
gb|PAZ96698.1| hypothetical protein APX86_11470 [Escherichia coli]
gb|ATB07320.1| hypothetical protein CJU64_03390 [Escherichia coli]
gb|ATB12614.1| hypothetical protein CJU63_03805 [Escherichia coli]
gb|PBK10496.1| hypothetical protein CMR95_04925 [Escherichia coli]
gb|PBK15984.1| hypothetical protein CMR94_02330 [Escherichia coli]
gb|PBK20026.1| hypothetical protein CMR93_05765 [Escherichia coli]
gb|PBK25708.1| hypothetical protein CMR92_03985 [Escherichia coli]
gb|PBK28264.1| hypothetical protein CMR91_17235 [Escherichia coli]
gb|PBK36430.1| hypothetical protein CMR90_07290 [Escherichia coli]
gb|PBK36841.1| hypothetical protein CMR89_22490 [Escherichia coli]
gb|PBK42814.1| hypothetical protein CMR85_24900 [Escherichia coli]
gb|ATB74216.1| hypothetical protein CNQ56_18145 [Escherichia coli]
gb|ATB79346.1| hypothetical protein CNQ55_18480 [Escherichia coli]
gb|ATB84031.1| hypothetical protein CNQ54_17290 [Escherichia coli]
gb|ATB89100.1| hypothetical protein CNQ53_18970 [Escherichia coli]
gb|ATB93938.1| hypothetical protein CNQ52_17330 [Escherichia coli]
gb|ATB98854.1| hypothetical protein CNQ51_16495 [Escherichia coli]
gb|ATC06799.1| hypothetical protein CNQ49_06930 [Escherichia coli]
gb|ATC13496.1| hypothetical protein CNQ48_17495 [Escherichia coli]
gb|ATC18393.1| hypothetical protein CNQ47_18400 [Escherichia coli]
gb|PBN58106.1| hypothetical protein ABE94_001575 [Escherichia coli]
gb|PBN65513.1| hypothetical protein ABE95_002905 [Escherichia coli]
gb|PBN67416.1| hypothetical protein ABE92_023945 [Escherichia coli]
gb|PBN78088.1| hypothetical protein ABE91_006600 [Escherichia coli]
gb|PBN79418.1| hypothetical protein ABE90_021015 [Escherichia coli]
gb|PBN91204.1| hypothetical protein ABE89_004360 [Escherichia coli]
gb|PBN91636.1| hypothetical protein ABE88_016395 [Escherichia coli]
gb|PBO13169.1| hypothetical protein CI709_08275 [Shigella sonnei]
gb|PBO48297.1| hypothetical protein CKX40_15735 [Escherichia coli]
gb|PBO48357.1| hypothetical protein CKX41_14600 [Escherichia coli]
gb|PBO50166.1| hypothetical protein CKX42_09710 [Escherichia coli]
gb|PBO64269.1| hypothetical protein CKX39_07830 [Escherichia coli]
gb|PBO66973.1| hypothetical protein CKX38_06345 [Escherichia coli]
gb|PBO68308.1| hypothetical protein CKX37_14035 [Escherichia coli]
gb|PBO70940.1| hypothetical protein CKX36_21255 [Escherichia coli]
gb|PBO80169.1| hypothetical protein CKX35_05250 [Escherichia coli]
gb|PBO87083.1| hypothetical protein CI703_22465 [Shigella sonnei]
gb|PBO97542.1| hypothetical protein CI711_04100 [Shigella boydii]
gb|PBP01172.1| hypothetical protein CI708_18435 [Shigella sonnei]
gb|PBP02462.1| hypothetical protein CI702_03200 [Escherichia coli]
gb|PBP09676.1| hypothetical protein CI707_03250 [Shigella sonnei]
gb|PBQ36901.1| hypothetical protein COD27_16325 [Escherichia coli]
gb|PBQ41464.1| hypothetical protein COD56_17580 [Escherichia coli]
gb|PBQ46578.1| hypothetical protein COD55_17350 [Escherichia coli]
gb|PBQ53167.1| hypothetical protein COD52_09190 [Escherichia coli]
gb|PBQ56893.1| hypothetical protein COD51_15735 [Escherichia coli]
gb|PBQ63083.1| hypothetical protein COD50_11650 [Escherichia coli]
gb|PBQ68622.1| hypothetical protein COD48_08640 [Escherichia coli]
gb|PBQ71740.1| hypothetical protein COD43_18350 [Escherichia coli]
gb|PBQ77241.1| hypothetical protein COD42_17110 [Escherichia coli]
gb|PBQ82643.1| hypothetical protein COD41_15555 [Escherichia coli]
gb|PBQ87444.1| hypothetical protein COD40_17945 [Escherichia coli]
gb|PBQ93712.1| hypothetical protein COD37_11920 [Escherichia coli]
gb|PBQ99781.1| hypothetical protein COD34_10810 [Escherichia coli]
gb|PBR03738.1| hypothetical protein COD32_11295 [Escherichia coli]
gb|PBR10666.1| hypothetical protein COD30_11145 [Escherichia coli]
gb|PBR14272.1| hypothetical protein COD29_17985 [Escherichia coli]
gb|PBR16695.1| hypothetical protein COD28_13710 [Escherichia coli]
gb|PBR24589.1| hypothetical protein COD58_14220 [Escherichia coli]
gb|PBR30074.1| hypothetical protein COD57_14200 [Escherichia coli]
gb|PBR35338.1| hypothetical protein COD54_14695 [Escherichia coli]
gb|PBR40296.1| hypothetical protein COD53_18345 [Escherichia coli]
gb|PBR46890.1| hypothetical protein COD49_10685 [Escherichia coli]
gb|PBR52766.1| hypothetical protein COD46_08730 [Escherichia coli]
gb|PBR58402.1| hypothetical protein COD45_04900 [Escherichia coli]
gb|PBR62598.1| hypothetical protein COD44_08775 [Escherichia coli]
gb|PBR67897.1| hypothetical protein COD39_06480 [Escherichia coli]
gb|PBR71669.1| hypothetical protein COD38_14065 [Escherichia coli]
gb|PBR76470.1| hypothetical protein COD36_16230 [Escherichia coli]
gb|PBR82265.1| hypothetical protein COD26_15540 [Escherichia coli]
gb|PBR88046.1| hypothetical protein COD25_15175 [Escherichia coli]
gb|PBR94547.1| hypothetical protein COD47_07335 [Escherichia coli]
gb|PBR97929.1| hypothetical protein COD35_19015 [Escherichia coli]
gb|PBR99465.1| hypothetical protein COD33_19045 [Escherichia coli]
gb|PBS07879.1| hypothetical protein COD31_16990 [Escherichia coli]
gb|PBS24757.1| hypothetical protein A7H83_03930 [Escherichia coli]
gb|PBS29947.1| hypothetical protein A7H85_03675 [Escherichia coli]
gb|PBS34958.1| hypothetical protein A7H86_03675 [Escherichia coli]
gb|PBS36254.1| hypothetical protein A7H87_22155 [Escherichia coli]
gb|PBS45803.1| hypothetical protein A7H88_00920 [Escherichia coli]
gb|PBS47691.1| hypothetical protein A7H89_13960 [Escherichia coli]
gb|PBS55002.1| hypothetical protein A7H98_00570 [Escherichia coli]
gb|PBS59252.1| hypothetical protein A7H90_03535 [Escherichia coli]
gb|PBS64103.1| hypothetical protein A7H91_02750 [Escherichia coli]
gb|PBS66980.1| hypothetical protein A8104_11760 [Escherichia coli]
gb|PBS73081.1| hypothetical protein A7H92_04645 [Escherichia coli]
gb|PBS76901.1| hypothetical protein A8107_09525 [Escherichia coli]
gb|PBS80835.1| hypothetical protein A8108_14020 [Escherichia coli]
gb|PBS84990.1| hypothetical protein A8109_17690 [Escherichia coli]
gb|PBS92673.1| hypothetical protein A8112_03350 [Escherichia coli]
gb|PBS95477.1| hypothetical protein A8114_14695 [Escherichia coli]
gb|PBT02485.1| hypothetical protein A9821_03065 [Escherichia coli]
gb|PBT03110.1| hypothetical protein A9818_26060 [Escherichia coli]
gb|PBT12339.1| hypothetical protein A9816_02100 [Escherichia coli]
gb|PBT14010.1| hypothetical protein A9812_18850 [Escherichia coli]
gb|PBT22010.1| hypothetical protein A9810_05965 [Escherichia coli]
gb|PBT25048.1| hypothetical protein A9811_11670 [Escherichia coli]
gb|PBT31471.1| hypothetical protein A9815_03305 [Escherichia coli]
gb|PBT32201.1| hypothetical protein A9814_25170 [Escherichia coli]
gb|PBT44538.1| hypothetical protein A9819_03195 [Escherichia coli]
gb|PBT46157.1| hypothetical protein BBJ10_03395 [Escherichia coli]
gb|PBT49552.1| hypothetical protein BBJ11_09940 [Escherichia coli]
gb|PBT52708.1| hypothetical protein BBJ12_17960 [Escherichia coli]
gb|PBT60048.1| hypothetical protein BBJ13_03090 [Escherichia coli]
gb|PBT63963.1| hypothetical protein BBJ14_07035 [Escherichia coli]
gb|PBT67335.1| hypothetical protein BBJ15_13560 [Escherichia coli]
gb|PBT73712.1| hypothetical protein BBJ16_04190 [Escherichia coli]
gb|PBT76080.1| hypothetical protein BBJ17_16415 [Escherichia coli]
gb|PBT81496.1| hypothetical protein BBJ18_12100 [Escherichia coli]
gb|PBT85528.1| hypothetical protein BBJ19_15060 [Escherichia coli]
gb|PBT92437.1| hypothetical protein BBJ20_03225 [Escherichia coli]
gb|PBT95338.1| hypothetical protein BB538_12630 [Escherichia coli]
gb|PBU01677.1| hypothetical protein BBJ21_03475 [Escherichia coli]
gb|PBU06439.1| hypothetical protein BBJ22_03675 [Escherichia coli]
gb|PBU07976.1| hypothetical protein BBJ23_20965 [Escherichia coli]
gb|PBU16045.1| hypothetical protein BBJ24_03255 [Escherichia coli]
gb|PBU17252.1| hypothetical protein BBJ25_22755 [Escherichia coli]
gb|PBU25605.1| hypothetical protein BB539_03150 [Escherichia coli]
gb|PBU30584.1| hypothetical protein BB546_04040 [Escherichia coli]
gb|PBU35146.1| hypothetical protein BB544_03395 [Escherichia coli]
gb|PBU40786.1| hypothetical protein BB547_02245 [Escherichia coli]
gb|PBU44254.1| hypothetical protein BB545_12510 [Escherichia coli]
gb|PBU50676.1| hypothetical protein BB541_03155 [Escherichia coli]
gb|PBU54162.1| hypothetical protein BB542_08105 [Escherichia coli]
gb|PBU59725.1| hypothetical protein BB543_03360 [Escherichia coli]
gb|PBU74826.1| hypothetical protein BB552_10280 [Escherichia coli]
gb|PBU77403.1| hypothetical protein BB549_25620 [Escherichia coli]
gb|PBU85737.1| hypothetical protein BB551_10280 [Escherichia coli]
gb|PBU92918.1| hypothetical protein BB548_10355 [Escherichia coli]
gb|PBU96857.1| hypothetical protein BB550_03175 [Escherichia coli]
gb|PCD50146.1| hypothetical protein A6V22_09430 [Escherichia coli]
gb|PCD71939.1| hypothetical protein CNN69_18860 [Escherichia coli]
gb|PCG22794.1| hypothetical protein CO992_17075 [Escherichia coli]
gb|PCG29110.1| hypothetical protein CO989_12865 [Escherichia coli]
gb|PCG33617.1| hypothetical protein CO988_15050 [Escherichia coli]
gb|PCG40907.1| hypothetical protein CO987_23240 [Escherichia coli]
gb|PCG43331.1| hypothetical protein CO986_16570 [Escherichia coli]
gb|PCG49412.1| hypothetical protein CO991_13230 [Escherichia coli]
gb|PCG54764.1| hypothetical protein CO990_13215 [Escherichia coli]
gb|ATG06912.1| hypothetical protein CO703_15580 [Escherichia coli]
gb|ATG13964.1| hypothetical protein CO706_25635 [Escherichia coli]
gb|ATG61074.1| hypothetical protein AWA97_07425 [Escherichia coli O104:H21 str.
CFSAN002236]
gb|PCM11823.1| hypothetical protein BH692_01365 [Escherichia coli]
gb|PCM12306.1| hypothetical protein BH693_14780 [Escherichia coli]
gb|PCM14162.1| hypothetical protein BH691_16875 [Escherichia coli]
gb|PCM24979.1| hypothetical protein BH689_16305 [Escherichia coli]
gb|PCM26667.1| hypothetical protein BH694_01380 [Escherichia coli]
gb|PCM32020.1| hypothetical protein BH690_16575 [Escherichia coli]
gb|PCM39490.1| hypothetical protein B1028_02120 [Escherichia coli]
gb|PCO22492.1| hypothetical protein CQA14_19740 [Escherichia coli]
gb|PCO32500.1| hypothetical protein CP993_11375 [Escherichia coli]
gb|PCO56365.1| hypothetical protein CQA00_11700 [Escherichia coli]
gb|PCO60388.1| hypothetical protein CP992_17075 [Escherichia coli]
gb|PCO77963.1| hypothetical protein CQA04_06495 [Escherichia coli]
gb|PCO80810.1| hypothetical protein CP990_19955 [Escherichia coli]
gb|PCO86561.1| hypothetical protein CP991_19180 [Escherichia coli]
gb|PCO97487.1| hypothetical protein CP996_15825 [Escherichia coli]
gb|PCP04701.1| hypothetical protein CQA10_04860 [Escherichia coli]
gb|PCQ51579.1| hypothetical protein CQA50_17010 [Escherichia coli]
gb|PCQ85593.1| hypothetical protein CQA56_02760 [Escherichia coli]
gb|PCQ89243.1| hypothetical protein CQA52_11345 [Escherichia coli]
gb|PCQ93226.1| hypothetical protein CQA46_15715 [Escherichia coli]
gb|PCR53822.1| hypothetical protein CQA74_15700 [Escherichia coli]
gb|PCR59545.1| hypothetical protein CQA71_11420 [Escherichia coli]
gb|PCR63584.1| hypothetical protein CQA73_16885 [Escherichia coli]
gb|PCR67955.1| hypothetical protein CQA82_20550 [Escherichia coli]
gb|PCR78119.1| hypothetical protein CQA64_04880 [Escherichia coli]
gb|PCS29907.1| hypothetical protein BMR34_19140 [Escherichia coli]
gb|PCS36147.1| hypothetical protein BMR36_11190 [Escherichia coli]
gb|PCS42357.1| hypothetical protein BMR38_06320 [Escherichia coli]
gb|PCS47055.1| hypothetical protein BMR40_07090 [Escherichia coli]
gb|PCS49869.1| hypothetical protein BMR41_20825 [Escherichia coli]
gb|PCS55763.1| hypothetical protein BMR43_16970 [Escherichia coli]
gb|PCS59927.1| hypothetical protein BMR44_21050 [Escherichia coli]
gb|PCS66904.1| hypothetical protein BMR45_09735 [Escherichia coli]
gb|PCS71836.1| hypothetical protein BMR46_10975 [Escherichia coli]
gb|PCS79996.1| hypothetical protein BMR47_11395 [Escherichia coli]
gb|PCS81851.1| hypothetical protein BMR48_01640 [Escherichia coli]
gb|PCS88893.1| hypothetical protein BMR50_00750 [Escherichia coli]
gb|PCS93544.1| hypothetical protein BMR53_02220 [Escherichia coli]
gb|PCS94974.1| hypothetical protein BMR60_21090 [Escherichia coli]
gb|PCS99861.1| hypothetical protein BMR65_23000 [Escherichia coli]
gb|PCT10065.1| hypothetical protein BMR54_27375 [Escherichia coli]
gb|PCT17448.1| hypothetical protein BMR56_12285 [Escherichia coli]
gb|PCT22392.1| hypothetical protein BMR57_11950 [Escherichia coli]
gb|PCT26381.1| hypothetical protein BMR62_18675 [Escherichia coli]
gb|PCT31729.1| hypothetical protein BMR63_16240 [Escherichia coli]
gb|PCT38369.1| hypothetical protein BMR64_15795 [Escherichia coli]
gb|ATH89398.1| hypothetical protein AT852_17855 [Shigella sonnei]
gb|ATI05949.1| hypothetical protein CO715_09660 [Escherichia coli M12]
gb|PDM28828.1| hypothetical protein CQR81_18020 [Escherichia coli]
gb|PDM44686.1| hypothetical protein CPT07_11535 [Escherichia coli]
gb|PDM89328.1| hypothetical protein COO28_02245 [Escherichia coli]
gb|PDM93224.1| hypothetical protein COO29_07840 [Escherichia coli]
gb|PDM99747.1| hypothetical protein COO30_01565 [Escherichia coli]
gb|PDN03306.1| hypothetical protein AWE17_09350 [Escherichia coli]
gb|PDN97217.1| hypothetical protein CJU67_03730 [Escherichia coli]
gb|PDO01436.1| hypothetical protein CJU66_03300 [Escherichia coli]
gb|PDO03311.1| hypothetical protein CJU68_03270 [Escherichia coli]
gb|PDO08628.1| hypothetical protein CJU65_02950 [Escherichia coli]
gb|PDO11902.1| hypothetical protein AWE19_27435 [Escherichia coli]
gb|PDO17751.1| hypothetical protein AWE23_18640 [Escherichia coli]
gb|PDO22276.1| hypothetical protein AWE24_23650 [Escherichia coli]
gb|PDO32454.1| hypothetical protein AWE26_02290 [Escherichia coli]
gb|PDO35562.1| hypothetical protein AWE20_06205 [Escherichia coli]
gb|PDO36993.1| hypothetical protein AWE22_24500 [Escherichia coli]
gb|PDO43778.1| hypothetical protein AWE25_14580 [Escherichia coli]
gb|PDO50282.1| hypothetical protein AWE27_05400 [Escherichia coli]
gb|PDO53935.1| hypothetical protein AWE29_11515 [Escherichia coli]
gb|PDO57642.1| hypothetical protein AWE18_17530 [Escherichia coli]
gb|PDO61074.1| hypothetical protein AWE21_25615 [Escherichia coli]
gb|PDO68291.1| hypothetical protein AWE28_12495 [Escherichia coli]
gb|PDS10987.1| hypothetical protein CMR88_04425 [Escherichia coli]
gb|PDS16506.1| hypothetical protein CMR86_01755 [Escherichia coli]
gb|PDS19587.1| hypothetical protein CMR87_10830 [Escherichia coli]
gb|PDT95707.1| hypothetical protein A6V21_11610 [Escherichia coli]
gb|PDT99819.1| hypothetical protein A6V20_18205 [Escherichia coli]
gb|PDU06619.1| hypothetical protein A6V19_10950 [Escherichia coli]
gb|PDU11726.1| hypothetical protein A6V18_12530 [Escherichia coli]
gb|PDU17647.1| hypothetical protein A6V17_05620 [Escherichia coli]
gb|PDU22594.1| hypothetical protein A6V16_08780 [Escherichia coli]
gb|PDU27505.1| hypothetical protein A6V14_12105 [Escherichia coli]
gb|PDU33130.1| hypothetical protein A6V13_11940 [Escherichia coli]
gb|PDU38383.1| hypothetical protein A6V12_12915 [Escherichia coli]
gb|PDU46204.1| hypothetical protein A6V11_04400 [Escherichia coli]
gb|PDU51817.1| hypothetical protein A6V10_06865 [Escherichia coli]
gb|PDU57974.1| hypothetical protein A6V09_06255 [Escherichia coli]
gb|PDU61269.1| hypothetical protein A6V08_16765 [Escherichia coli]
gb|PDU67419.1| hypothetical protein A6V07_12360 [Escherichia coli]
gb|PDU73240.1| hypothetical protein A6V06_10160 [Escherichia coli]
gb|PDU78320.1| hypothetical protein A6V05_12905 [Escherichia coli]
gb|PDU84184.1| hypothetical protein A6V04_11770 [Escherichia coli]
gb|PDU89810.1| hypothetical protein A6V03_10310 [Escherichia coli]
gb|PDU96287.1| hypothetical protein A6V02_08895 [Escherichia coli]
gb|PDV00909.1| hypothetical protein A6V00_13165 [Escherichia coli]
gb|PDV05904.1| hypothetical protein BER16_15995 [Escherichia coli]
gb|PDV11420.1| hypothetical protein BER15_15640 [Escherichia coli]
gb|PDV17477.1| hypothetical protein BER11_11620 [Escherichia coli]
gb|PDV22134.1| hypothetical protein BER05_17205 [Escherichia coli]
gb|PDV27883.1| hypothetical protein BER19_16155 [Escherichia coli]
gb|PDV33977.1| hypothetical protein BER18_12845 [Escherichia coli]
gb|PDV38599.1| hypothetical protein BER17_17095 [Escherichia coli]
gb|PDV45017.1| hypothetical protein BER14_10825 [Escherichia coli]
gb|PDV57735.1| hypothetical protein BER10_13480 [Escherichia coli]
gb|PDV58252.1| hypothetical protein BER12_13755 [Escherichia coli]
gb|PDV65446.1| hypothetical protein BER09_13925 [Escherichia coli]
gb|PDV70538.1| hypothetical protein BER08_15355 [Escherichia coli]
gb|PDV74778.1| hypothetical protein BER07_21205 [Escherichia coli]
gb|PDV82875.1| hypothetical protein BER06_08415 [Escherichia coli]
gb|PDV95873.1| hypothetical protein A6V01_02825 [Escherichia coli]
gb|PEG21091.1| hypothetical protein BSR05_24155 [Escherichia coli]
gb|PEH60322.1| hypothetical protein CRM85_07260 [Escherichia coli]
gb|PEH95735.1| hypothetical protein CRM80_24645 [Escherichia coli]
gb|PEH98795.1| hypothetical protein CRM83_12515 [Escherichia coli]
gb|PEI20521.1| hypothetical protein CRM84_24880 [Escherichia coli]
gb|PGF65043.1| hypothetical protein BMR20_19620 [Escherichia coli]
gb|PGF68207.1| hypothetical protein BMR19_04810 [Escherichia coli]
gb|PGF69631.1| hypothetical protein BMR18_05530 [Escherichia coli]
gb|PGF77408.1| hypothetical protein BMR22_06810 [Escherichia coli]
gb|PGF86066.1| hypothetical protein BMR23_07975 [Escherichia coli]
gb|PGF86234.1| hypothetical protein BMR21_02560 [Escherichia coli]
gb|PGF92604.1| hypothetical protein BMR24_04335 [Escherichia coli]
gb|PGF99252.1| hypothetical protein BMR25_11535 [Escherichia coli]
gb|PGG00051.1| hypothetical protein BMR32_15315 [Escherichia coli]
gb|PGG04203.1| hypothetical protein BMR26_00515 [Escherichia coli]
gb|PGG08299.1| hypothetical protein BMR30_19480 [Escherichia coli]
gb|PGG09739.1| hypothetical protein BMR29_21335 [Escherichia coli]
gb|PGG19271.1| hypothetical protein BMR28_21615 [Escherichia coli]
gb|PGG23368.1| hypothetical protein BMR27_19195 [Escherichia coli]
gb|PGG33867.1| hypothetical protein BMT48_13280 [Escherichia coli]
gb|PGG35831.1| hypothetical protein BMR31_03110 [Escherichia coli]
gb|PGG42172.1| hypothetical protein BMR12_00190 [Escherichia coli]
gb|PGG48623.1| hypothetical protein BMR16_11760 [Escherichia coli]
gb|PGG53345.1| hypothetical protein BMR13_17865 [Escherichia coli]
gb|PGG54857.1| hypothetical protein BMR14_00125 [Escherichia coli]
gb|PGG59193.1| hypothetical protein BMR15_22550 [Escherichia coli]
gb|PGG64832.1| hypothetical protein BMR33_04690 [Escherichia coli]
gb|PGG68150.1| hypothetical protein BMR17_13515 [Escherichia coli]
gb|PHG85213.1| hypothetical protein CRX50_02650 [Escherichia coli]
gb|PHG90738.1| hypothetical protein CRX52_04570 [Escherichia coli]
gb|PHH29415.1| hypothetical protein CRX49_08225 [Escherichia coli]
gb|ATM11950.1| hypothetical protein CRN02_19145 [Escherichia coli]
gb|ATM25128.1| hypothetical protein CRN16_01530 [Escherichia coli]
gb|ATM81403.1| hypothetical protein CRN68_11560 [Escherichia coli]
gb|PHK64460.1| hypothetical protein CQR96_00340 [Escherichia coli]
gb|PHK70683.1| hypothetical protein CQR97_17370 [Escherichia coli]
gb|PHL31849.1| hypothetical protein BMR39_06170 [Escherichia coli]
gb|PHL36680.1| hypothetical protein BMR35_07180 [Escherichia coli]
gb|PHL39967.1| hypothetical protein BMR42_14370 [Escherichia coli]
gb|PHL47528.1| hypothetical protein BMR49_01605 [Escherichia coli]
gb|PHL49230.1| hypothetical protein BMR51_18080 [Escherichia coli]
gb|PHL56625.1| hypothetical protein BMR55_04535 [Escherichia coli]
gb|PHL59085.1| hypothetical protein BMR58_16045 [Escherichia coli]
gb|PHL63459.1| hypothetical protein BMR52_19310 [Escherichia coli]
gb|PHL74241.1| hypothetical protein BMR61_03725 [Escherichia coli]
gb|PHL93713.1| hypothetical protein CQR85_21495 [Escherichia coli]
gb|PHL98817.1| hypothetical protein BMR59_20055 [Escherichia coli]
gb|PHN13020.1| hypothetical protein CR517_17990 [Escherichia coli]
gb|ATO75247.1| hypothetical protein I51_03425 [Escherichia coli O91 str. RM7190]
gb|PHU63190.1| hypothetical protein CSW73_05225 [Shigella sonnei]
gb|PHU67722.1| hypothetical protein CSW74_05880 [Shigella sonnei]
gb|PHU76394.1| hypothetical protein CSW71_05190 [Shigella sonnei]
gb|PHU80656.1| hypothetical protein CSW70_05710 [Shigella sonnei]
gb|PHU89251.1| hypothetical protein CSW69_06460 [Shigella sonnei]
gb|PHU98477.1| hypothetical protein CSW66_05320 [Shigella boydii]
emb|SLM05607.1| hypothetical protein BQ9544_0543 [Escherichia coli O127:H6]
emb|SNU22562.1| hypothetical protein BQ9550_0543 [Escherichia coli O127:H6]
gb|ATP22897.1| hypothetical protein CQ842_04445 [Escherichia coli]
gb|PHW94009.1| hypothetical protein CSB65_21750 [Escherichia coli]
gb|PHX01433.1| hypothetical protein CSB64_10325 [Escherichia coli]
gb|PIA85502.1| hypothetical protein A1J83_10410 [Escherichia coli]
gb|PIM09828.1| hypothetical protein CT145_03535 [Escherichia coli]
gb|PIM12941.1| hypothetical protein CT150_13975 [Escherichia coli]
gb|PIM16816.1| hypothetical protein CT149_19440 [Escherichia coli]
gb|PIM24602.1| hypothetical protein CT146_03935 [Escherichia coli]
gb|PIM30442.1| hypothetical protein CT143_01305 [Escherichia coli]
gb|PIM31729.1| hypothetical protein CT142_18685 [Escherichia coli]
gb|PIM37505.1| hypothetical protein CT147_14725 [Escherichia coli]
gb|PIM43877.1| hypothetical protein CT148_07250 [Escherichia coli]
gb|PIM49343.1| hypothetical protein CT144_03690 [Escherichia coli]
gb|PIM55814.1| hypothetical protein CTI76_23750 [Escherichia coli]
gb|PIM63062.1| hypothetical protein CTI77_13590 [Escherichia coli]
gb|ATU35860.1| hypothetical protein CSR56_16215 [Escherichia coli]
gb|ATV07873.1| hypothetical protein CDW44_03790 [Escherichia coli]
gb|ATV47358.1| hypothetical protein CUB99_05320 [Escherichia coli]
gb|ATV76597.1| hypothetical protein CUB98_16895 [Escherichia coli]
gb|PIS76457.1| hypothetical protein L241_06545 [Escherichia coli O55:H7 str. USDA
5905]
gb|ATW98785.1| hypothetical protein CU080_21225 [Escherichia coli]
gb|ATX08613.1| hypothetical protein CU078_07640 [Escherichia coli]
gb|ATX13955.1| hypothetical protein CU077_07655 [Escherichia coli]
gb|ATX19624.1| hypothetical protein CU076_12320 [Escherichia coli]
gb|ATX42447.1| hypothetical protein AM333_12400 [Escherichia coli]
gb|ATX45506.1| hypothetical protein AM338_00590 [Escherichia coli]
gb|ATX51316.1| hypothetical protein AM341_05685 [Escherichia coli]
gb|ATX58749.1| hypothetical protein AM342_20415 [Escherichia coli]
gb|PJF57894.1| hypothetical protein CVD17_09280 [Escherichia coli]
gb|PJF63911.1| hypothetical protein CVD20_02175 [Escherichia coli]
gb|PJF64806.1| hypothetical protein CVD22_23110 [Escherichia coli]
gb|PJF71202.1| hypothetical protein CVD24_13630 [Escherichia coli]
gb|PJF76162.1| hypothetical protein CVE12_11780 [Escherichia coli]
gb|PJF78654.1| hypothetical protein CVE13_23275 [Escherichia coli]
gb|PJF83117.1| hypothetical protein CVE14_24390 [Escherichia coli]
gb|PJG08657.1| hypothetical protein CVE10_10785 [Escherichia coli]
gb|PJG14851.1| hypothetical protein CVE11_02345 [Escherichia coli]
gb|PJG18143.1| hypothetical protein CVH04_13975 [Escherichia coli]
gb|PJG24797.1| hypothetical protein CVH06_03370 [Escherichia coli]
gb|PJG27646.1| hypothetical protein CVH07_12930 [Escherichia coli]
gb|PJG31571.1| hypothetical protein CVH05_21935 [Escherichia coli]
gb|PJG73441.1| hypothetical protein CVO79_16395 [Escherichia coli]
gb|ATY21935.1| hypothetical protein AM344_26030 [Escherichia coli]
gb|ATY24711.1| hypothetical protein AM346_13675 [Escherichia coli]
gb|PJH99050.1| hypothetical protein CSI02_07465 [Escherichia coli]
gb|PJI60249.1| hypothetical protein CTU84_04735 [Escherichia coli]
gb|PJI63893.1| hypothetical protein CTY41_08030 [Escherichia coli]
gb|PJN74744.1| hypothetical protein LCTEC_003735 [Escherichia coli]
gb|PJO19185.1| hypothetical protein CWB44_03085 [Escherichia coli]
gb|ATX36608.1| hypothetical protein CUC42_17205 [Escherichia coli]
gb|ATZ36942.1| hypothetical protein CWB37_05240 [Escherichia coli]
gb|PJR34596.1| hypothetical protein H260_03510 [Escherichia coli O157:H7 str.
TW14313]
gb|PJR40973.1| hypothetical protein H474_04160 [Escherichia coli O55:H7 str.
TB182A]
gb|PJR45964.1| hypothetical protein H644_03525 [Escherichia coli O157:H7 str.
EC1825]
gb|PJW26016.1| hypothetical protein CWM40_10855 [Escherichia coli]
gb|PJW28737.1| hypothetical protein CWM41_24935 [Escherichia coli]
gb|PJW34922.1| hypothetical protein CWM42_18020 [Escherichia coli]
gb|PJW39429.1| hypothetical protein CWM43_21095 [Escherichia coli]
gb|PJW52454.1| hypothetical protein CWD54_01310 [Escherichia coli]
gb|PJW57034.1| hypothetical protein CWD55_01315 [Escherichia coli]
gb|PJW62211.1| hypothetical protein CWD56_01310 [Escherichia coli]
gb|PJW65045.1| hypothetical protein CWD57_12250 [Escherichia coli]
gb|PJW71840.1| hypothetical protein CWD61_02825 [Escherichia coli]
gb|PJW74112.1| hypothetical protein CWD58_17170 [Escherichia coli]
gb|PJW82038.1| hypothetical protein CWD60_01390 [Escherichia coli]
gb|PJW86707.1| hypothetical protein CWD59_01325 [Escherichia coli]
gb|PJW90329.1| hypothetical protein CWD62_08680 [Escherichia coli]
gb|PJX01484.1| hypothetical protein CWI54_00475 [Escherichia coli]
gb|ATZ31297.1| hypothetical protein CV83915_00941 [Escherichia coli]
gb|PJX81757.1| hypothetical protein CWM23_06470 [Escherichia coli]
gb|PJX83695.1| hypothetical protein CWM27_25940 [Escherichia coli]
gb|PJX92190.1| hypothetical protein CWM26_10015 [Escherichia coli]
gb|PJX98835.1| hypothetical protein CWM24_04105 [Escherichia coli]
gb|PJY01371.1| hypothetical protein CWM30_20065 [Escherichia coli]
gb|PJY05586.1| hypothetical protein CWM29_27015 [Escherichia coli]
gb|PJY10829.1| hypothetical protein CWM25_28870 [Escherichia coli]
gb|PJY18032.1| hypothetical protein CWM28_17395 [Escherichia coli]
gb|PJY23228.1| hypothetical protein CWM32_17130 [Escherichia coli]
gb|PJY29774.1| hypothetical protein CWM31_11525 [Escherichia coli]
gb|PJY34640.1| hypothetical protein CWM33_11335 [Escherichia coli]
gb|PJY40213.1| hypothetical protein CWM34_10875 [Escherichia coli]
gb|PJY46381.1| hypothetical protein CWM35_07670 [Escherichia coli]
gb|PJY49762.1| hypothetical protein CWM36_14950 [Escherichia coli]
gb|PJY52776.1| hypothetical protein CWM38_29265 [Escherichia coli]
gb|PJY61637.1| hypothetical protein CWM37_11720 [Escherichia coli]
gb|PJY92799.1| hypothetical protein CK493_03355 [Shigella sonnei]
emb|SMZ46325.1| FIG002095: hypothetical protein [Escherichia coli]
gb|AUA42792.1| hypothetical protein CWI33_20785 [Escherichia coli]
gb|AUA45745.1| hypothetical protein CWO47_11725 [Escherichia coli]
gb|PKD53150.1| hypothetical protein CWS19_14545 [Escherichia coli]
gb|PKD57492.1| hypothetical protein CW275_30130 [Escherichia coli]
gb|PKD59095.1| hypothetical protein CW272_15150 [Escherichia coli]
gb|PKD70928.1| hypothetical protein CW277_08730 [Escherichia coli]
gb|PKD74586.1| hypothetical protein CW281_19505 [Escherichia coli]
gb|PKD78900.1| hypothetical protein CW283_29080 [Escherichia coli]
gb|PKD88260.1| hypothetical protein CWS33_17380 [Escherichia coli]
gb|PKD92761.1| hypothetical protein CW276_28225 [Escherichia coli]
gb|PKE04224.1| hypothetical protein CW285_07925 [Escherichia coli]
gb|PKE12409.1| hypothetical protein CW282_14855 [Escherichia coli]
gb|PKE81618.1| hypothetical protein CW278_01495 [Escherichia coli]
gb|PKE81892.1| hypothetical protein CW274_25780 [Escherichia coli]
gb|PKE87177.1| hypothetical protein CW273_22165 [Escherichia coli]
gb|PKE93319.1| hypothetical protein CW279_19570 [Escherichia coli]
gb|PKF01126.1| hypothetical protein CW280_09390 [Escherichia coli]
gb|PKF04849.1| hypothetical protein CW284_17340 [Escherichia coli]
gb|PKF16534.1| hypothetical protein CW286_07925 [Escherichia coli]
gb|PKF60011.1| hypothetical protein CW658_00485 [Escherichia coli]
gb|PKG06659.1| hypothetical protein CVS36_08110 [Escherichia coli]
gb|PKI90932.1| hypothetical protein CXF22_06410 [Escherichia coli]
gb|PKI95448.1| hypothetical protein CXF25_27750 [Escherichia coli]
gb|PKI97851.1| hypothetical protein CXF23_12260 [Escherichia coli]
gb|PKJ06853.1| hypothetical protein CXF19_16510 [Escherichia coli]
gb|PKJ13908.1| hypothetical protein CXF20_08555 [Escherichia coli]
gb|PKJ19079.1| hypothetical protein CXF17_12360 [Escherichia coli]
gb|PKJ19278.1| hypothetical protein CXF16_16120 [Escherichia coli]
gb|PKJ28808.1| hypothetical protein CXF13_11570 [Escherichia coli]
gb|PKJ33666.1| hypothetical protein CXF11_09770 [Escherichia coli]
gb|PKJ38150.1| hypothetical protein CXF12_14975 [Escherichia coli]
gb|PKJ41356.1| hypothetical protein CXF09_27925 [Escherichia coli]
gb|PKJ51297.1| hypothetical protein CXF14_03825 [Escherichia coli]
gb|AUF76575.1| hypothetical protein CGC46_12135 [Escherichia coli O121:H19]
gb|AUG15441.1| hypothetical protein CXP41_03560 [Escherichia coli str. K-12
substr. MG1655]
gb|PKQ94934.1| hypothetical protein CVV74_17300 [Escherichia coli]
gb|PKR62739.1| hypothetical protein CGZ52_14760 [Escherichia coli]
gb|PKR70553.1| hypothetical protein CW271_04635 [Escherichia coli]
gb|PKR73062.1| hypothetical protein CW270_18700 [Escherichia coli]
gb|AUG63569.1| hypothetical protein CXG97_03545 [Escherichia coli]
gb|AUG92258.1| hypothetical protein MS8345_00617 [Escherichia coli]
gb|PKZ13318.1| hypothetical protein CYJ52_04765 [Escherichia coli]
gb|PKZ35272.1| hypothetical protein CYJ55_01650 [Escherichia coli]
gb|PKZ51257.1| hypothetical protein CYJ54_01390 [Escherichia coli]
gb|PKZ78074.1| hypothetical protein CYJ53_08975 [Escherichia coli]
gb|PLA90569.1| hypothetical protein CYR80_08650 [Escherichia coli]
gb|PLB02956.1| hypothetical protein CYR82_00290 [Escherichia coli]
gb|PLB57838.1| hypothetical protein APX94_14840 [Escherichia coli]
gb|PLB62089.1| hypothetical protein APX95_16665 [Escherichia coli]
gb|PLB69947.1| hypothetical protein APY01_00405 [Escherichia coli]
gb|PLB74421.1| hypothetical protein AZE08_03985 [Escherichia coli]
gb|PLB77359.1| hypothetical protein APX96_12930 [Escherichia coli]
gb|AUJ92328.1| hypothetical protein CR540_19645 [Escherichia coli]
gb|AUJ95285.1| hypothetical protein CR539_07600 [Escherichia coli]
gb|AUK02182.1| hypothetical protein CR538_18250 [Escherichia coli]
gb|AUK07513.1| hypothetical protein CR537_17735 [Escherichia coli]
gb|AUK12789.1| hypothetical protein CR536_19940 [Escherichia coli]
gb|AUK17902.1| hypothetical protein CR535_19180 [Escherichia coli]
gb|AUK23033.1| hypothetical protein CR534_19330 [Escherichia coli]
gb|PLJ86987.1| hypothetical protein B7L61_10045 [Escherichia coli]
gb|PLJ91965.1| hypothetical protein B7L64_03980 [Escherichia coli]
gb|PLJ93810.1| hypothetical protein B7L57_03060 [Escherichia coli]
gb|PLJ95154.1| hypothetical protein B7L59_23645 [Escherichia coli]
gb|PLK08815.1| hypothetical protein B7L60_06755 [Escherichia coli]
gb|PLK13958.1| hypothetical protein B7L63_04455 [Escherichia coli]
gb|PLR11605.1| hypothetical protein CHQ87_013670 [Escherichia coli]
gb|AUF89752.1| hypothetical protein BH100B_00713 [Escherichia coli]
gb|AUL64546.1| hypothetical protein BVL38_17385 [Escherichia coli]
gb|AUL71183.1| hypothetical protein BVL39_25345 [Escherichia coli]
gb|AUL86315.1| hypothetical protein CRT55_21675 [Escherichia coli]
gb|AUL89018.1| hypothetical protein CR916_06835 [Escherichia coli]
gb|AUM09131.1| hypothetical protein CFI09_18005 [Escherichia coli]
gb|AUM23636.1| hypothetical protein CP957_19630 [Escherichia coli]
gb|AUN48578.1| hypothetical protein C0634_18615 [Escherichia coli]
gb|PMB59576.1| hypothetical protein C1A36_19440 [Escherichia coli]
gb|PMD81482.1| hypothetical protein A8A11_08010 [Escherichia coli]
gb|PMD88746.1| hypothetical protein A8A05_09095 [Escherichia coli]
gb|PMD92876.1| hypothetical protein A8A04_19720 [Escherichia coli]
gb|PME06555.1| hypothetical protein A8A06_23080 [Escherichia coli]
emb|SOQ96518.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ92771.1| conserved hypothetical protein [Escherichia coli]
emb|SOR02389.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ91088.1| conserved hypothetical protein [Escherichia coli]
emb|SOR06641.1| conserved hypothetical protein [Escherichia coli]
gb|AUO36044.1| hypothetical protein YDC107_3905 [Escherichia coli]
gb|AUO41823.1| hypothetical protein C0R78_15155 [Escherichia coli]
gb|AUO56504.1| hypothetical protein C1I23_07050 [Escherichia coli]
gb|PNB94405.1| hypothetical protein C1I39_16610 [Escherichia coli]
gb|PNB99890.1| hypothetical protein C1I42_17005 [Escherichia coli]
gb|PNC09986.1| hypothetical protein CK476_16370 [Escherichia coli]
gb|AUQ36327.1| hypothetical protein BH100L_00696 [Escherichia coli]
gb|PND68909.1| hypothetical protein C1X10_13165 [Escherichia coli]
gb|PND75621.1| hypothetical protein C1T14_23545 [Escherichia coli]
gb|PND76339.1| hypothetical protein C1T15_06695 [Escherichia coli]
gb|PND88056.1| hypothetical protein C1X11_04895 [Escherichia coli]
gb|PND99797.1| hypothetical protein C1I57_06585 [Escherichia coli]
gb|PNL72419.1| hypothetical protein CEP71_023660 [Escherichia coli O157]
gb|PNM74256.1| hypothetical protein AL488_017135 [Shigella sonnei]
gb|PNN28770.1| hypothetical protein AL500_024950 [Escherichia coli]
gb|PNO49612.1| hypothetical protein MC59_017010 [Shigella sonnei]
gb|PNO88293.1| hypothetical protein RK56_025420 [Escherichia coli]
gb|PNP04282.1| hypothetical protein RK59_020405 [Shigella flexneri]
gb|PNP65403.1| hypothetical protein AL530_020890 [Escherichia coli]
gb|AUP43189.1| hypothetical protein CV83906_0546 [Escherichia coli]
gb|AUS39205.1| hypothetical protein C1A20_18425 [Escherichia coli]
gb|PNR02525.1| hypothetical protein C1629_17995 [Escherichia coli]
gb|PNR07650.1| hypothetical protein C1630_16765 [Escherichia coli]
gb|PNR14655.1| hypothetical protein C1628_09035 [Escherichia coli]
gb|PNR18457.1| hypothetical protein BA882_15850 [Escherichia coli]
gb|PNS26443.1| hypothetical protein C1H52_13400 [Escherichia coli]
gb|AUT10157.1| hypothetical protein C1467_17530 [Escherichia coli]
gb|AUN89151.1| hypothetical protein BH100N_00689 [Escherichia coli]
gb|AUT27320.1| hypothetical protein C1192_09490 [Escherichia marmotae]
gb|PNY46176.1| hypothetical protein C2M26_28375 [Escherichia coli]
gb|PNY54236.1| hypothetical protein C2M27_14450 [Escherichia coli]
gb|PNY66134.1| hypothetical protein C2M16_19400 [Escherichia coli]
gb|AUV20455.1| hypothetical protein C2U45_06455 [Escherichia coli]
gb|AUV30514.1| hypothetical protein C2U48_06895 [Escherichia coli]
gb|POF67821.1| hypothetical protein C2W55_07990 [Escherichia coli]
gb|POF72558.1| hypothetical protein C2W44_09265 [Escherichia coli]
gb|POF75209.1| hypothetical protein C2W48_22685 [Escherichia coli]
gb|POF83656.1| hypothetical protein C2W54_05605 [Escherichia coli]
gb|POH47530.1| hypothetical protein C2U36_03730 [Escherichia coli]
gb|POH79714.1| hypothetical protein C2858_04535 [Escherichia coli]
gb|POH92885.1| hypothetical protein C3B65_11125 [Escherichia coli]
gb|POI02865.1| hypothetical protein C3B69_05445 [Escherichia coli]
gb|POI03299.1| hypothetical protein C3B66_05080 [Escherichia coli]
gb|POI07346.1| hypothetical protein C3B70_12570 [Escherichia coli]
gb|POI11921.1| hypothetical protein C3B68_13930 [Escherichia coli]
gb|POL48797.1| hypothetical protein C3F33_03250 [Escherichia coli]
gb|POL52290.1| hypothetical protein C3F30_10175 [Escherichia coli]
gb|POL59291.1| hypothetical protein C3F25_12775 [Escherichia coli]
gb|POL64267.1| hypothetical protein C3F29_00245 [Escherichia coli]
gb|POL70666.1| hypothetical protein C3F24_15430 [Escherichia coli]
gb|POL72317.1| hypothetical protein C3F32_01320 [Escherichia coli]
gb|POL77595.1| hypothetical protein C3F31_13130 [Escherichia coli]
gb|POL86356.1| hypothetical protein C3F23_10330 [Escherichia coli]
gb|POL89597.1| hypothetical protein C3F28_04805 [Escherichia coli]
gb|POL95317.1| hypothetical protein C3F26_20895 [Escherichia coli]
gb|POM01559.1| hypothetical protein C3F27_03065 [Escherichia coli]
gb|POM04831.1| hypothetical protein C3F21_02540 [Escherichia coli]
gb|AUX03801.1| hypothetical protein FORC42_3527 [Escherichia coli]
gb|POO35784.1| hypothetical protein CTZ35_13935 [Escherichia coli]
gb|POO40366.1| hypothetical protein CTZ36_16180 [Escherichia coli]
gb|AUY01986.1| hypothetical protein C3F40_09390 [Escherichia coli]
gb|AUY46317.1| hypothetical protein C3K24_22720 [Escherichia coli]
gb|AUY30252.1| hypothetical protein YKEC1_3229 [Escherichia coli]
gb|POS17392.1| hypothetical protein BJN40_05055 [Escherichia coli]
gb|POS21437.1| hypothetical protein BJN38_08600 [Escherichia coli]
gb|POS24317.1| hypothetical protein BJN43_07820 [Escherichia coli]
gb|POS28229.1| hypothetical protein BJN46_15010 [Escherichia coli]
gb|POS32779.1| hypothetical protein BJP21_16650 [Escherichia coli]
gb|POS37803.1| hypothetical protein BJP16_14240 [Escherichia coli]
gb|POS43723.1| hypothetical protein BJP17_16210 [Escherichia coli]
gb|POS46869.1| hypothetical protein BJP18_13010 [Escherichia coli]
gb|POS55340.1| hypothetical protein BJP19_12370 [Escherichia coli]
gb|POS56806.1| hypothetical protein BJP20_14030 [Escherichia coli]
gb|POS97743.1| hypothetical protein C3735_22320 [Escherichia coli]
gb|POS97990.1| hypothetical protein C3740_22080 [Escherichia coli]
gb|POS98175.1| hypothetical protein C3739_22000 [Escherichia coli]
gb|POT10840.1| hypothetical protein C3738_22165 [Escherichia coli]
gb|POT11908.1| hypothetical protein C3742_22030 [Escherichia coli]
gb|POT11941.1| hypothetical protein C3736_22240 [Escherichia coli]
gb|POU31058.1| hypothetical protein C3385_02370 [Escherichia coli]
gb|POV23596.1| hypothetical protein C3383_19225 [Escherichia coli]
gb|AUZ92559.1| hypothetical protein BXO92_16650 [Escherichia coli]
gb|POZ05610.1| hypothetical protein C3419_23125 [Escherichia coli]
gb|AVB46506.1| hypothetical protein C4E05_19055 [Escherichia coli]
gb|PPA51140.1| hypothetical protein C3727_27130 [Escherichia coli]
gb|AVD32146.1| hypothetical protein C4J63_11570 [Escherichia coli]
gb|PPE10415.1| hypothetical protein C4Y11_09515 [Escherichia coli]
gb|PPE18708.1| hypothetical protein C3R75_03430 [Escherichia coli]
gb|PPE21200.1| hypothetical protein C4Y12_06605 [Escherichia coli]
gb|PPE25512.1| hypothetical protein C4Y10_14685 [Escherichia coli]
gb|PPE29916.1| hypothetical protein C4K41_14450 [Escherichia coli]
gb|PPE35124.1| hypothetical protein C4K42_15800 [Escherichia coli]
gb|PPE41356.1| hypothetical protein C4M75_08960 [Escherichia coli]
gb|PPE45065.1| hypothetical protein C4M76_17595 [Escherichia coli]
gb|PPE49012.1| hypothetical protein C4M77_25565 [Escherichia coli]
gb|PPE89482.1| hypothetical protein C4M78_22590 [Escherichia coli]
gb|AVE92816.1| hypothetical protein AM456_03370 [Escherichia coli]
gb|PPI94889.1| hypothetical protein C4J69_08180 [Escherichia coli]
gb|PPO29372.1| hypothetical protein C4Z16_03230 [Escherichia coli]
gb|PPO98663.1| hypothetical protein C4Y65_11215 [Escherichia coli]
gb|PPV46127.1| hypothetical protein C5O83_20030 [Escherichia coli]
gb|PPV46244.1| hypothetical protein C5O87_12270 [Escherichia coli]
gb|PPV55007.1| hypothetical protein C5O86_14670 [Escherichia coli]
gb|PPV64048.1| hypothetical protein C5P22_11530 [Escherichia coli]
gb|PPV64582.1| hypothetical protein C5O91_01960 [Escherichia coli]
gb|PPV68877.1| hypothetical protein C5O92_17280 [Escherichia coli]
gb|PPV74626.1| hypothetical protein C5O85_16105 [Escherichia coli]
gb|PPV84014.1| hypothetical protein C5O94_20170 [Escherichia coli]
gb|PPV93118.1| hypothetical protein C5O84_00300 [Escherichia coli]
gb|PPV94151.1| hypothetical protein C5P25_16115 [Escherichia coli]
gb|PPW03115.1| hypothetical protein C5P27_14285 [Escherichia coli]
gb|PPW08069.1| hypothetical protein C5P08_20025 [Escherichia coli]
gb|PPW15294.1| hypothetical protein C5P21_15265 [Escherichia coli]
gb|PPW15608.1| hypothetical protein C5P42_16400 [Escherichia coli]
gb|PPW23637.1| hypothetical protein C5P10_16900 [Escherichia coli]
gb|PPW28599.1| hypothetical protein C5P33_17095 [Escherichia coli]
gb|PPW34648.1| hypothetical protein C5O95_09460 [Escherichia coli]
gb|PPW41663.1| hypothetical protein C5O97_13095 [Escherichia coli]
gb|PPW44262.1| hypothetical protein C5P17_19775 [Escherichia coli]
gb|PPW46335.1| hypothetical protein C5O99_00300 [Escherichia coli]
gb|PPW61288.1| hypothetical protein C5P01_19785 [Escherichia coli]
gb|PPW63076.1| hypothetical protein C5P18_03390 [Escherichia coli]
gb|PPW66267.1| hypothetical protein C5O93_21455 [Escherichia coli]
gb|PPW74900.1| hypothetical protein C5P00_04745 [Escherichia coli]
gb|PPW80151.1| hypothetical protein C5P12_22865 [Escherichia coli]
gb|PPW80499.1| hypothetical protein C5P14_12470 [Escherichia coli]
gb|PPW89210.1| hypothetical protein C5P09_10325 [Escherichia coli]
gb|PPW99624.1| hypothetical protein C5P15_17440 [Escherichia coli]
gb|PPX05017.1| hypothetical protein C5O98_02270 [Escherichia coli]
gb|PPX08076.1| hypothetical protein C5P24_17705 [Escherichia coli]
gb|PPX15301.1| hypothetical protein C5O81_14300 [Escherichia coli]
gb|PPX16205.1| hypothetical protein C5O90_12390 [Escherichia coli]
gb|PPX22551.1| hypothetical protein C5P23_19375 [Escherichia coli]
gb|PPX23362.1| hypothetical protein C5O96_19205 [Escherichia coli]
gb|PPX32596.1| hypothetical protein C5P20_15470 [Escherichia coli]
gb|PPX36227.1| hypothetical protein C5P02_20320 [Escherichia coli]
gb|PPX43199.1| hypothetical protein C5P06_14255 [Escherichia coli]
gb|PPX46040.1| hypothetical protein C5P13_19670 [Escherichia coli]
gb|PPX51693.1| hypothetical protein C5P16_17755 [Escherichia coli]
gb|PPX58780.1| hypothetical protein C5P07_13665 [Escherichia coli]
gb|PPX63130.1| hypothetical protein C5P11_10165 [Escherichia coli]
gb|PPY61936.1| hypothetical protein C5P28_10895 [Escherichia coli]
gb|PPY68911.1| hypothetical protein C5P38_07860 [Escherichia coli]
gb|PPY69244.1| hypothetical protein C5P30_12875 [Escherichia coli]
gb|PPY75033.1| hypothetical protein C5P37_15285 [Escherichia coli]
gb|PPY80678.1| hypothetical protein C5P48_18835 [Escherichia coli]
gb|PPY85432.1| hypothetical protein C5P32_12495 [Escherichia coli]
gb|PPY87363.1| hypothetical protein C5P45_17395 [Escherichia coli]
gb|PPY96983.1| hypothetical protein C5P46_14985 [Escherichia coli]
gb|PPY97917.1| hypothetical protein C5P31_15845 [Escherichia coli]
gb|PPZ08440.1| hypothetical protein C5P44_03005 [Escherichia coli]
gb|PPZ09672.1| hypothetical protein C5P41_18320 [Escherichia coli]
gb|PPZ15612.1| hypothetical protein C5P29_10470 [Escherichia coli]
gb|PPZ19282.1| hypothetical protein C5P34_18680 [Escherichia coli]
gb|PPZ25499.1| hypothetical protein C5P35_13325 [Escherichia coli]
gb|PPZ28955.1| hypothetical protein C5P40_17520 [Escherichia coli]
gb|PPZ34611.1| hypothetical protein C5P36_17330 [Escherichia coli]
gb|PPZ41128.1| hypothetical protein C5P26_15740 [Escherichia coli]
gb|PPZ55965.1| hypothetical protein C5P43_08745 [Escherichia coli]
gb|PPZ97410.1| hypothetical protein C5F43_18655 [Escherichia coli]
gb|PQA04921.1| hypothetical protein C5F33_15165 [Escherichia coli]
gb|PQA06172.1| hypothetical protein C5F30_15430 [Escherichia coli]
gb|PQA07760.1| hypothetical protein C5F42_19725 [Escherichia coli]
gb|PQA19317.1| hypothetical protein C5F37_15535 [Escherichia coli]
gb|PQA20318.1| hypothetical protein C5F40_16690 [Escherichia coli]
gb|PQA26199.1| hypothetical protein C5F39_15500 [Escherichia coli]
gb|PQA32269.1| hypothetical protein C5F29_15655 [Escherichia coli]
gb|PQA37759.1| hypothetical protein C5F34_15300 [Escherichia coli]
gb|PQA46096.1| hypothetical protein C5F41_19625 [Escherichia coli]
gb|PQA47027.1| hypothetical protein C5F36_00290 [Escherichia coli]
gb|PQA53283.1| hypothetical protein C5F38_17445 [Escherichia coli]
gb|PQA64070.1| hypothetical protein C5F31_14575 [Escherichia coli]
gb|PQA66803.1| hypothetical protein C5F32_18540 [Escherichia coli]
gb|PQH09327.1| hypothetical protein C5F35_10265 [Escherichia coli]
gb|PQI94229.1| hypothetical protein C5U38_22110 [Escherichia fergusonii]
gb|PQJ02990.1| hypothetical protein C5U37_00995 [Escherichia fergusonii]
gb|PQK20008.1| hypothetical protein C5Y88_15825 [Escherichia coli]
gb|PQK26492.1| hypothetical protein C5Y90_12010 [Escherichia coli]
gb|PQK30876.1| hypothetical protein C5Y85_15505 [Escherichia coli]
gb|PQK41789.1| hypothetical protein C5Y84_06130 [Escherichia coli]
gb|PQK47363.1| hypothetical protein C5Y86_17370 [Escherichia coli]
gb|PQK49930.1| hypothetical protein C5Y92_03605 [Escherichia coli]
gb|PQK55920.1| hypothetical protein C5Y87_18315 [Escherichia coli]
gb|PQK63653.1| hypothetical protein C5Y94_14015 [Escherichia coli]
gb|PQK67861.1| hypothetical protein C5Y89_04955 [Escherichia coli]
gb|AVI55187.1| hypothetical protein C5Y66_15125 [Escherichia coli str. K-12
substr. MG1655]
gb|AVJ12446.1| hypothetical protein B1T56_06850 [Escherichia coli]
gb|PQM95202.1| hypothetical protein C5K18_28905 [Shigella dysenteriae]
gb|PQN21956.1| hypothetical protein C5K22_01835 [Shigella dysenteriae]
gb|PQN45992.1| hypothetical protein C5K17_21520 [Shigella dysenteriae]
gb|PQN54657.1| hypothetical protein C5K25_02330 [Shigella dysenteriae]
gb|PQN65797.1| hypothetical protein C5K21_12065 [Shigella flexneri]
gb|PQN90416.1| hypothetical protein C5K15_30780 [Shigella dysenteriae]
gb|PQO66634.1| hypothetical protein C5N11_15080 [Escherichia coli]
gb|PQO72203.1| hypothetical protein C5N08_12910 [Escherichia coli]
gb|PQO74102.1| hypothetical protein C5N10_15630 [Escherichia coli]
gb|PQO81148.1| hypothetical protein C5N09_14675 [Escherichia coli]
gb|PQO87550.1| hypothetical protein C5N06_14410 [Escherichia coli]
gb|PQO88893.1| hypothetical protein C5N12_17995 [Escherichia coli]
gb|PQP09569.1| hypothetical protein C5N07_14390 [Escherichia coli]
gb|PQP28608.1| hypothetical protein C5715_21465 [Escherichia coli]
gb|AVJ71748.1| hypothetical protein CSC09_1461 [Escherichia coli]
gb|AVJ75853.1| hypothetical protein CSC06_0733 [Escherichia coli]
gb|PQV19003.1| hypothetical protein CX383_018115 [Escherichia coli]
gb|PQV30746.1| hypothetical protein C1N95_007380 [Escherichia coli]
gb|PQV38708.1| hypothetical protein CYD32_015895 [Escherichia coli]
gb|PRB31040.1| hypothetical protein CQ036_21170 [Escherichia coli]
gb|PRC14705.1| hypothetical protein CQ003_21195 [Escherichia coli]
gb|AVL33129.1| hypothetical protein CEQ27_24560 [Escherichia coli O104:H4]
gb|AVM03139.1| hypothetical protein C6P57_04495 [Escherichia coli]
gb|PRO99773.1| hypothetical protein C6X67_18415 [Escherichia coli]
gb|PRP04025.1| hypothetical protein C6X66_15480 [Escherichia coli]
gb|PRP07804.1| hypothetical protein C6X64_07380 [Escherichia coli]
gb|PRP17375.1| hypothetical protein C6X63_04760 [Escherichia coli]
gb|PRP19547.1| hypothetical protein C6X65_03820 [Escherichia coli]
gb|PRP26855.1| hypothetical protein C6T25_13905 [Escherichia coli]
gb|PRP30260.1| hypothetical protein C6T22_14045 [Escherichia coli]
gb|PRP30376.1| hypothetical protein C6T23_01880 [Escherichia coli]
gb|PRP40155.1| hypothetical protein C6P05_08055 [Escherichia coli]
gb|PRP44413.1| hypothetical protein C6T24_03930 [Escherichia coli]
gb|AVN02228.1| hypothetical protein CXB56_20785 [Escherichia coli]
gb|AVN09507.1| hypothetical protein CSC11_1523 [Escherichia coli]
gb|AVL10066.1| hypothetical protein C6C13_16440 [Escherichia coli]
gb|AVN40826.1| hypothetical protein AM460_23145 [Escherichia coli]
gb|PRT57407.1| hypothetical protein C6086_29850 [Escherichia coli]
gb|PRW35154.1| hypothetical protein CSC05_1076 [Escherichia coli]
gb|PRW50455.1| hypothetical protein CSC07_4807 [Escherichia coli]
gb|PRW51804.1| hypothetical protein CSC08_4019 [Escherichia coli]
gb|PSB96827.1| hypothetical protein C6954_03485 [Escherichia coli]
gb|PSF33259.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF35910.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF45697.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF51858.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF54208.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF65662.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF66004.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF69556.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF79878.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF82900.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF84303.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF91741.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSF98512.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG00292.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG05380.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG10181.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG15164.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG19297.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG25266.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG29418.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG34460.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG39778.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG43657.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG49372.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG51978.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG59287.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG63057.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG72959.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG78324.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSG84395.1| zinc ribbon-containing protein [Escherichia coli]
gb|AVP28958.1| hypothetical protein C5097_07150 [Escherichia coli]
gb|PSK13833.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSK25470.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSL61508.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSL62006.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSL65942.1| zinc ribbon-containing protein [Escherichia coli]
gb|PSL77267.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_039022162.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_032223989.1| zinc ribbon-containing protein [Escherichia coli]
gb|KEM33957.1| hypothetical protein AC38_0747 [Escherichia coli 6-319-05_S3_C2]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_003919508.1| zinc ribbon-containing protein [Escherichia coli]
gb|ENF56277.1| hypothetical protein ECP03048166_0675 [Escherichia coli P0304816.6]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_001044867.1| zinc ribbon-containing protein [Escherichia coli]
gb|EGH38913.1| uncharacterized protein YbeL / hypothetical protein [Escherichia
coli AA86]
gb|EGI16680.1| putative alpha helical protein [Escherichia coli M605]
gb|ELH06463.1| hypothetical protein A31K_02525 [Escherichia coli KTE165]
emb|CDC78041.1| putative uncharacterized protein [Escherichia coli CAG:4]
gb|EQS85837.1| hypothetical protein G820_00562 [Escherichia coli HVH 162
(4-5627982)]
gb|EQT69242.1| hypothetical protein G842_02579 [Escherichia coli HVH 190
(4-3255514)]
gb|EQW68259.1| hypothetical protein G908_00652 [Escherichia coli UMEA 3108-1]
gb|EQX10146.1| hypothetical protein G921_00929 [Escherichia coli UMEA 3155-1]
gb|EQZ97604.1| hypothetical protein G991_00629 [Escherichia coli UMEA 3703-1]
gb|KUT81142.1| hypothetical protein AWF06_06235 [Escherichia coli]
gb|KUU29108.1| hypothetical protein AWF19_11910 [Escherichia coli]
gb|KUW80081.1| hypothetical protein AWF70_01855 [Escherichia coli]
gb|KYU11683.1| hypothetical protein AML56_09385 [Escherichia coli]
gb|OOI82252.1| hypothetical protein BMT81_09820 [Escherichia coli]
gb|OWF11044.1| hypothetical protein A8M74_18180 [Escherichia coli]
gb|PLK03654.1| hypothetical protein B7L58_07395 [Escherichia coli]
gb|PNR25178.1| hypothetical protein BA884_00630 [Escherichia coli]
gb|AVG02728.1| hypothetical protein AL502_25955 [Escherichia coli]
Length = 160
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>gb|ELF89669.1| hypothetical protein WEQ_00502 [Escherichia coli KTE29]
Length = 161
Score = 292 bits (747), Expect = e-100
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 10 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 69
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 70 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 129
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 130 KCHFHLPIYTPEVLTLCPKCGHD 152
>ref|WP_053903911.1| zinc ribbon-containing protein [Escherichia coli]
emb|CTS71546.1| putative alpha helical protein [Escherichia coli]
Length = 167
Score = 292 bits (747), Expect = 1e-99
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_105076175.1| zinc ribbon-containing protein [Escherichia coli]
gb|PQK34859.1| hypothetical protein C5Y91_13125 [Escherichia coli]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARER+IKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERIIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_096973933.1| zinc ribbon-containing protein [Escherichia coli]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNL+CE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLICE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_078045924.1| zinc ribbon-containing protein [Escherichia coli]
gb|AQT98255.1| hypothetical protein B0915_03945 [Escherichia coli]
emb|SOQ61314.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ67521.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ79010.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ83385.1| conserved hypothetical protein [Escherichia coli]
emb|SOQ72793.1| conserved hypothetical protein [Escherichia coli]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELAD+TDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADVTDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_024164991.1| MULTISPECIES: zinc ribbon-containing protein [Escherichia]
dbj|BAT34279.1| predicted protein [Escherichia albertii]
dbj|BAT38457.1| predicted protein [Escherichia albertii]
dbj|BAT42746.1| predicted protein [Escherichia albertii]
gb|PFF97269.1| hypothetical protein CRH02_05885 [Escherichia albertii]
gb|AUS68395.1| hypothetical protein CXP54_03180 [Escherichia albertii]
gb|PPQ55234.1| hypothetical protein C4623_09365 [Escherichia albertii]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTE+DELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEIDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_001044874.1| zinc ribbon-containing protein [Escherichia coli]
gb|EFF06970.1| ybeL protein [Escherichia coli B185]
gb|KFD76724.1| hypothetical protein JD73_10595 [Escherichia coli]
gb|KYU51978.1| hypothetical protein AML71_11465 [Escherichia coli]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDS+FMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSIFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_001044873.1| MULTISPECIES: zinc ribbon-containing protein [Escherichia]
gb|EGB71464.1| hypothetical protein ERFG_02810 [Escherichia coli TW10509]
gb|KDA59391.1| hypothetical protein AA98_0686 [Escherichia coli 2-011-08_S1_C1]
gb|OKU96903.1| hypothetical protein AWP53_22020 [Escherichia coli]
gb|OKV05257.1| hypothetical protein AWP47_25740 [Escherichia coli]
gb|OKV22323.1| hypothetical protein AWP54_14620 [Escherichia coli]
gb|OKV49978.1| hypothetical protein AWP62_24145 [Escherichia coli]
gb|OKW01422.1| hypothetical protein AWP69_19150 [Escherichia coli]
gb|OKW19520.1| hypothetical protein AWP75_10590 [Escherichia coli]
gb|OKX32036.1| hypothetical protein AWQ00_25995 [Escherichia coli]
gb|OKX60427.1| hypothetical protein AWP99_01205 [Escherichia coli]
Length = 160
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRA+RRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAIRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>gb|AHE58715.1| hypothetical protein EAKF1_ch0809c [Escherichia albertii KF1]
emb|CTV54362.1| putative alpha helical protein [Escherichia coli]
gb|OSL31832.1| methyl-accepting chemotaxis protein [Escherichia albertii B156]
Length = 161
Score = 291 bits (746), Expect = 1e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTE+DELTRAVRRDLEEFAMSYEE
Sbjct: 10 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEIDELTRAVRRDLEEFAMSYEE 69
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE
Sbjct: 70 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 129
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 130 KCHFHLPIYTPEVLTLCPKCGHD 152
>ref|WP_060703588.1| zinc ribbon-containing protein [Escherichia coli]
gb|ALD36122.1| hypothetical protein AN204_16555 [Escherichia coli]
Length = 160
Score = 291 bits (745), Expect = 2e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQD+NHHGVYHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDINHHGVYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151
>ref|WP_104691520.1| zinc ribbon-containing protein [Escherichia coli]
gb|PPV99861.1| hypothetical protein C5O88_16035 [Escherichia coli]
gb|PPW93645.1| hypothetical protein C5P04_16485 [Escherichia coli]
Length = 160
Score = 291 bits (744), Expect = 2e-99
Identities = 142/143 (99%), Positives = 143/143 (100%)
Frame = -2
Query: 429 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 250
RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE
Sbjct: 9 RELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEE 68
Query: 249 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCE 70
SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHG+YHSGEVVGLGNLVCE
Sbjct: 69 SLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGLYHSGEVVGLGNLVCE 128
Query: 69 KCHFHLPIYTPEVLTLCPKCGHD 1
KCHFHLPIYTPEVLTLCPKCGHD
Sbjct: 129 KCHFHLPIYTPEVLTLCPKCGHD 151