BLASTX nr result

ID: Acanthopanax22_contig00000049 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Acanthopanax22_contig00000049
         (1029 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

emb|CDW55189.1| Chloroplast small heat shock protein [Trichuris ...   563   0.0  
gb|AKK14564.2| heat shock chaperone protein [Escherichia coli K-...   317   e-106
gb|EGI08929.1| small heat shock protein IbpB (16 kDa heat shock ...   284   2e-93
gb|EGI14153.1| small heat shock protein IbpB (16 kDa heat shock ...   281   2e-92
gb|AAN83042.1|AE016769_157 16 kDa heat shock protein A [Escheric...   278   2e-91
ref|WP_001243437.1| MULTISPECIES: heat-shock protein IbpA [Enter...   276   2e-90
ref|WP_001586460.1| heat-shock protein IbpA [Escherichia coli] >...   275   3e-90
ref|WP_096930299.1| heat shock protein IbpA [Escherichia coli]        275   5e-90
ref|WP_065222256.1| heat shock protein IbpA [Escherichia coli]        275   5e-90
ref|WP_032188966.1| heat-shock protein IbpA [Escherichia coli] >...   275   5e-90
gb|EGI90059.1| hsp20/alpha crystallin family protein [Shigella b...   275   5e-90
ref|WP_105274419.1| heat shock protein IbpA [Escherichia sp. MOD...   274   7e-90
ref|WP_097415674.1| heat shock protein IbpA [Escherichia coli]        274   7e-90
ref|WP_095764430.1| heat shock protein IbpA [Escherichia coli] >...   274   7e-90
ref|WP_089625119.1| heat shock protein IbpA [Escherichia coli]        274   7e-90
gb|EIQ16955.1| small heat shock protein ibpA [Shigella flexneri ...   274   7e-90
ref|WP_054628017.1| heat shock protein IbpA [Escherichia coli] >...   274   7e-90
ref|WP_053890241.1| heat-shock protein IbpA [Escherichia coli]        274   7e-90
ref|WP_024250412.1| MULTISPECIES: heat shock protein IbpA [Enter...   274   7e-90
ref|WP_032329610.1| heat-shock protein IbpA [Escherichia coli] >...   274   7e-90

>emb|CDW55189.1| Chloroplast small heat shock protein [Trichuris trichiura]
          Length = 299

 Score =  563 bits (1450), Expect = 0.0
 Identities = 284/302 (94%), Positives = 284/302 (94%)
 Frame = +3

Query: 123  MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
            MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
            LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61   LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483  LERVIPEAKKPRRIEIN*FPKAAWRGLTSPCSPSGSICESSDLQVLTRFLEGEMTMRNFD 662
            LER                  AAWRGLTSPCSPSGSICESSDLQVLTRFLEGEMTMRNFD
Sbjct: 121  LER------------------AAWRGLTSPCSPSGSICESSDLQVLTRFLEGEMTMRNFD 162

Query: 663  LSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEG 842
            LSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEG
Sbjct: 163  LSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEG 222

Query: 843  TRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPE 1022
            TRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPE
Sbjct: 223  TRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPE 282

Query: 1023 PI 1028
            PI
Sbjct: 283  PI 284



 Score =  130 bits (326), Expect = 1e-31
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 1/140 (0%)
 Frame = +3

Query: 117 LIMRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFA 293
           + MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF 
Sbjct: 156 MTMRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFR 212

Query: 294 ESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLL 473
           + +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL
Sbjct: 213 QEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLL 272

Query: 474 YIDLERVIPEAKKPRRIEIN 533
           +IDL R  PE    +RI I+
Sbjct: 273 HIDLIRNEPEPIAAQRIAIS 292


>gb|AKK14564.2| heat shock chaperone protein [Escherichia coli K-12]
 gb|AKK15829.2| heat shock chaperone protein [Escherichia coli K-12]
          Length = 171

 Score =  317 bits (812), Expect = e-106
 Identities = 155/156 (99%), Positives = 156/156 (100%)
 Frame = +3

Query: 561  LTSPCSPSGSICESSDLQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQS 740
            +TSPCSPSGSICESSDLQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQS
Sbjct: 1    MTSPCSPSGSICESSDLQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQS 60

Query: 741  FPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQ 920
            FPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQ
Sbjct: 61   FPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQ 120

Query: 921  PFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPI 1028
            PFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPI
Sbjct: 121  PFSLSFTLAENMEVSGATFVNGLLHIDLIRNEPEPI 156



 Score =  130 bits (326), Expect = 5e-33
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 1/140 (0%)
 Frame = +3

Query: 117 LIMRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFA 293
           + MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF 
Sbjct: 28  MTMRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFR 84

Query: 294 ESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLL 473
           + +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL
Sbjct: 85  QEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLL 144

Query: 474 YIDLERVIPEAKKPRRIEIN 533
           +IDL R  PE    +RI I+
Sbjct: 145 HIDLIRNEPEPIAAQRIAIS 164


>gb|EGI08929.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H736]
 gb|EGI19437.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli M718]
 gb|EGI44280.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H591]
 gb|AHA68281.1| Small heat shock protein [Shigella dysenteriae 1617]
 gb|ESU81434.1| Small heat shock protein [Shigella dysenteriae WRSd3]
 gb|ESU83009.1| Small heat shock protein [Shigella dysenteriae WRSd5]
 gb|ANK04228.1| ibpB [Escherichia coli O25b:H4]
 gb|OSK08997.1| hypothetical protein EAOG_03936 [Escherichia coli R527]
 gb|OSK19114.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli M056]
 gb|OSK48444.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H588]
 gb|OSK50918.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H413]
 gb|OSL02220.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H386]
 gb|OSL27496.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H617]
 gb|OSL34466.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli TA464]
 gb|OSL41978.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H461]
 gb|OSL44154.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H605]
 gb|OSL52182.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H454]
 gb|OSL58627.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli H420]
          Length = 155

 Score =  284 bits (726), Expect = 2e-93
 Identities = 139/140 (99%), Positives = 140/140 (100%)
 Frame = +3

Query: 609  LQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI 788
            +QVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI
Sbjct: 1    MQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI 60

Query: 789  TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG 968
            TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG
Sbjct: 61   TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG 120

Query: 969  ATFVNGLLHIDLIRNEPEPI 1028
            ATFVNGLLHIDLIRNEPEPI
Sbjct: 121  ATFVNGLLHIDLIRNEPEPI 140



 Score =  130 bits (326), Expect = 3e-33
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 1/140 (0%)
 Frame = +3

Query: 117 LIMRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFA 293
           + MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF 
Sbjct: 12  MTMRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFR 68

Query: 294 ESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLL 473
           + +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL
Sbjct: 69  QEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLL 128

Query: 474 YIDLERVIPEAKKPRRIEIN 533
           +IDL R  PE    +RI I+
Sbjct: 129 HIDLIRNEPEPIAAQRIAIS 148


>gb|EGI14153.1| small heat shock protein IbpB (16 kDa heat shock protein B)
            [Escherichia coli M605]
          Length = 155

 Score =  281 bits (720), Expect = 2e-92
 Identities = 138/140 (98%), Positives = 139/140 (99%)
 Frame = +3

Query: 609  LQVLTRFLEGEMTMRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI 788
            +QVLTRFLEGEM MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI
Sbjct: 1    MQVLTRFLEGEMIMRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRI 60

Query: 789  TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG 968
            TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG
Sbjct: 61   TLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSG 120

Query: 969  ATFVNGLLHIDLIRNEPEPI 1028
            ATFVNGLLHIDLIRNEPEPI
Sbjct: 121  ATFVNGLLHIDLIRNEPEPI 140



 Score =  132 bits (331), Expect = 6e-34
 Identities = 71/140 (50%), Positives = 94/140 (67%), Gaps = 1/140 (0%)
 Frame = +3

Query: 117 LIMRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFA 293
           +IMRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF 
Sbjct: 12  MIMRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFR 68

Query: 294 ESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLL 473
           + +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL
Sbjct: 69  QEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLL 128

Query: 474 YIDLERVIPEAKKPRRIEIN 533
           +IDL R  PE    +RI I+
Sbjct: 129 HIDLIRNEPEPIAAQRIAIS 148


>gb|AAN83042.1|AE016769_157 16 kDa heat shock protein A [Escherichia coli CFT073]
 gb|ABE09665.1| 16 kDa heat shock protein A [Escherichia coli UTI89]
 emb|CBG36868.1| small heat shock protein A [Escherichia coli 042]
 gb|EGJ08224.1| small heat shock protein IbpA [Escherichia coli D9]
 gb|AHA68282.1| Small heat shock protein [Shigella dysenteriae 1617]
 gb|ESU81435.1| Small heat shock protein [Shigella dysenteriae WRSd3]
 gb|ESU83010.1| Small heat shock protein [Shigella dysenteriae WRSd5]
 emb|CDN84520.1| 16 kDa heat shock protein A [Escherichia coli O25b:H4-ST131]
 gb|AKK14563.2| heat shock chaperone protein [Escherichia coli K-12]
 gb|AKK15830.2| heat shock chaperone protein [Escherichia coli K-12]
 gb|ANK04229.1| ibpA [Escherichia coli O25b:H4]
          Length = 139

 Score =  278 bits (711), Expect = 2e-91
 Identities = 138/139 (99%), Positives = 139/139 (100%)
 Frame = +3

Query: 117 LIMRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAE 296
           +IMRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAE
Sbjct: 1   MIMRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAE 60

Query: 297 SELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLY 476
           SELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLY
Sbjct: 61  SELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLY 120

Query: 477 IDLERVIPEAKKPRRIEIN 533
           IDLERVIPEAKKPRRIEIN
Sbjct: 121 IDLERVIPEAKKPRRIEIN 139



 Score =  128 bits (321), Expect = 1e-32
 Identities = 68/130 (52%), Positives = 88/130 (67%), Gaps = 3/130 (2%)
 Frame = +3

Query: 642  MTMRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFR 812
            M MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF 
Sbjct: 1    MIMRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFA 59

Query: 813  QEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLL 992
            + +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL
Sbjct: 60   ESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLL 119

Query: 993  HIDLIRNEPE 1022
            +IDL R  PE
Sbjct: 120  YIDLERVIPE 129


>ref|WP_001243437.1| MULTISPECIES: heat-shock protein IbpA [Enterobacteriaceae]
 ref|NP_312654.1| heat shock protein IbpA [Escherichia coli O157:H7 str. Sakai]
 ref|NP_418142.1| heat shock chaperone [Escherichia coli str. K-12 substr. MG1655]
 ref|NP_709511.2| heat shock protein IbpA [Shigella flexneri 2a str. 301]
 ref|YP_405570.1| heat shock protein IbpA [Shigella dysenteriae Sd197]
 ref|YP_002410163.1| heat shock protein IbpA [Escherichia coli IAI39]
 ref|YP_002414852.1| heat shock chaperone [Escherichia coli UMN026]
 ref|YP_006122015.1| heat shock protein IbpA [Escherichia coli O83:H1 str. NRG 857C]
 ref|YP_006776753.1| heat shock protein IbpA [Escherichia coli O104:H4 str. 2011C-3493]
 sp|P0C054.1|IBPA_ECOLI RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|P0C055.1|IBPA_ECO57 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|P0C056.1|IBPA_ECOL6 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|P0C057.1|IBPA_SHIFL RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|Q0SYN0.1|IBPA_SHIF8 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|Q0TB20.1|IBPA_ECOL5 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|Q31UU6.1|IBPA_SHIBS RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|Q329C6.1|IBPA_SHIDS RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|Q3YWC5.1|IBPA_SHISS RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|A1AHM2.1|IBPA_ECOK1 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|A7ZTP1.1|IBPA_ECO24 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|A8A6E7.1|IBPA_ECOHS RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B1IYQ7.1|IBPA_ECOLC RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7UMF4.1|IBPA_ECO27 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7MGA8.1|IBPA_ECO45 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7L831.1|IBPA_ECO55 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B5YX93.1|IBPA_ECO5E RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7NQY7.1|IBPA_ECO7I RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7N1Z1.1|IBPA_ECO81 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7M4H6.1|IBPA_ECO8A RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B1X9B7.1|IBPA_ECODH RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7NF04.1|IBPA_ECOLU RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B6I3S0.1|IBPA_ECOSE RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B1LL12.1|IBPA_ECOSM RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B7LK29.1|IBPA_ESCF3 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|B2TUT5.1|IBPA_SHIB3 RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 sp|C4ZYW4.1|IBPA_ECOBW RecName: Full=Small heat shock protein IbpA; AltName: Full=16 kDa
           heat shock protein A
 gb|AAG58889.1|AE005600_7 heat shock protein [Escherichia coli O157:H7 str. EDL933]
 gb|AAA24424.1| putative [Escherichia coli str. K-12 substr. W3110]
 gb|AAA62039.1| heat shock inducible; alternate gene name ibpA [Escherichia coli]
 gb|AAC76710.1| heat shock chaperone [Escherichia coli str. K-12 substr. MG1655]
 dbj|BAB38050.1| heat shock protein IbpA [Escherichia coli O157:H7 str. Sakai]
 gb|AAP18979.1| heat shock protein [Shigella flexneri 2a str. 2457T]
 gb|AAN45218.2| heat shock protein [Shigella flexneri 2a str. 301]
 gb|AAZ90187.1| heat shock protein [Shigella sonnei Ss046]
 gb|ABB64079.1| heat shock protein [Shigella dysenteriae Sd197]
 gb|ABB68162.1| heat shock protein [Shigella boydii Sb227]
 dbj|BAE77607.1| heat shock chaperone [Escherichia coli str. K-12 substr. W3110]
 gb|ABG71859.1| heat shock protein [Escherichia coli 536]
 gb|ABF05835.1| heat shock protein [Shigella flexneri 5 str. 8401]
 gb|ABJ03162.1| heat shock protein [Escherichia coli APEC O1]
 gb|ABV08101.1| small heat shock protein IbpA [Escherichia coli HS]
 gb|ABV17722.1| small heat shock protein IbpA [Escherichia coli O139:H28 str.
           E24377A]
 gb|ACA75704.1| heat shock protein Hsp20 [Escherichia coli ATCC 8739]
 gb|ACB04733.1| heat shock chaperone [Escherichia coli str. K-12 substr. DH10B]
 gb|EDS93467.1| small heat shock protein IbpA [Escherichia albertii TW07627]
 gb|ACB16214.1| small heat shock protein IbpA [Escherichia coli SMS-3-5]
 gb|ACD07936.1| small heat shock protein IbpA [Shigella boydii CDC 3083-94]
 gb|EDU35510.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4196]
 gb|EDU55002.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4113]
 gb|EDU65270.1| small heat shock protein IbpA [Escherichia coli 53638]
 gb|EDU71370.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4076]
 gb|EDU77296.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4401]
 gb|EDU83227.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4486]
 gb|EDU88219.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4501]
 gb|EDU92802.1| small heat shock protein IbpA [Escherichia coli O157:H7 str. EC869]
 gb|EDU97202.1| small heat shock protein IbpA [Escherichia coli O157:H7 str. EC508]
 gb|EDV63816.1| small heat shock protein IbpA [Escherichia coli B7A]
 gb|EDV68776.1| small heat shock protein IbpA [Escherichia coli F11]
 gb|EDV83102.1| small heat shock protein IbpA [Escherichia coli E22]
 gb|EDV87985.1| small heat shock protein IbpA [Escherichia coli E110019]
 gb|EDX30153.1| small heat shock protein IbpA [Escherichia coli B171]
 gb|EDX36491.1| small heat shock protein IbpA [Shigella dysenteriae 1012]
 gb|EDX41207.1| small heat shock protein IbpA [Escherichia coli 101-1]
 gb|EDZ78001.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4206]
 gb|EDZ82916.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4045]
 gb|EDZ89265.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4042]
 gb|ACI38128.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           EC4115]
 gb|ACI75406.1| hypothetical protein ECs4627 [Escherichia coli]
 gb|ACI75407.1| hypothetical protein ECs4627 [Escherichia coli]
 gb|ACI75408.1| hypothetical protein ECs4627 [Escherichia coli]
 gb|ACI75409.1| hypothetical protein ECs4627 [Escherichia coli]
 gb|ACI75410.1| hypothetical protein ECs4627 [Escherichia coli]
 dbj|BAG79497.1| heat shock protein [Escherichia coli SE11]
 emb|CAS11545.1| heat shock chaperone [Escherichia coli O127:H6 str. E2348/69]
 gb|EEC30001.1| small heat shock protein IbpA [Escherichia coli O157:H7 str.
           TW14588]
 emb|CAV00733.1| heat shock chaperone [Escherichia coli 55989]
 emb|CAQ91416.1| heat shock chaperone [Escherichia fergusonii ATCC 35469]
 emb|CAR00660.1| heat shock chaperone [Escherichia coli IAI1]
 emb|CAR05316.1| heat shock chaperone [Escherichia coli S88]
 emb|CAR20395.1| heat shock chaperone [Escherichia coli IAI39]
 emb|CAR10362.1| heat shock chaperone [Escherichia coli ED1a]
 emb|CAR15358.1| heat shock chaperone [Escherichia coli UMN026]
 emb|CAP78146.1| Small heat shock protein ibpA [Escherichia coli LF82]
 gb|EEJ49651.1| small heat shock protein IbpA [Escherichia coli 83972]
 gb|ACR63400.1| heat shock chaperone [Escherichia coli BW2952]
 emb|CAQ34031.1| small heat shock protein IbpA [Escherichia coli BL21(DE3)]
 gb|ACT27097.1| heat shock protein Hsp20 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gb|ACT41210.1| heat shock chaperone [Escherichia coli B str. REL606]
 gb|ACT45365.1| heat shock chaperone [Escherichia coli BL21(DE3)]
 gb|ACT74456.1| heat shock chaperone [Escherichia coli O157:H7 str. TW14359]
 dbj|BAI28052.1| heat shock chaperone IbpA [Escherichia coli O26:H11 str. 11368]
 dbj|BAI33172.1| heat shock chaperone IbpA [Escherichia coli O103:H2 str. 12009]
 dbj|BAI38269.1| heat shock chaperone IbpA [Escherichia coli O111:H- str. 11128]
 gb|ACX37717.1| heat shock protein Hsp20 [Escherichia coli DH1]
 dbj|BAI57071.1| heat shock protein [Escherichia coli SE15]
 gb|ADA76068.1| Small heat shock protein ibpA [Shigella flexneri 2002017]
 gb|ADD58945.1| Small heat shock protein ibpA [Escherichia coli O55:H7 str. CB9615]
 gb|EFE61078.1| heat shock protein IbpA [Escherichia coli B088]
 gb|EFE98654.1| heat shock protein IbpA [Escherichia coli FVEC1412]
 gb|EFF04190.1| heat shock protein IbpA [Escherichia coli B185]
 gb|EFF10769.1| heat shock protein IbpA [Escherichia coli B354]
 gb|ADE88778.1| small heat shock protein IbpA [Escherichia coli IHE3034]
 gb|EFI18423.1| heat shock protein IbpA [Escherichia coli FVEC1302]
 gb|EFJ57003.1| small heat shock protein IbpA [Escherichia coli MS 185-1]
 gb|EFJ60339.1| small heat shock protein IbpA [Escherichia coli MS 200-1]
 gb|EFJ66655.1| small heat shock protein IbpA [Escherichia coli MS 175-1]
 gb|EFJ75946.1| small heat shock protein IbpA [Escherichia coli MS 198-1]
 gb|EFJ78929.1| small heat shock protein IbpA [Escherichia coli MS 69-1]
 gb|EFJ88482.1| small heat shock protein IbpA [Escherichia coli MS 84-1]
 gb|EFJ91896.1| small heat shock protein IbpA [Escherichia coli MS 45-1]
 gb|EFJ98598.1| small heat shock protein IbpA [Escherichia coli MS 115-1]
 gb|EFK01695.1| small heat shock protein IbpA [Escherichia coli MS 182-1]
 gb|EFK16474.1| small heat shock protein IbpA [Escherichia coli MS 116-1]
 gb|EFK17881.1| small heat shock protein IbpA [Escherichia coli MS 21-1]
 gb|EFK23423.1| small heat shock protein IbpA [Escherichia coli MS 187-1]
 gb|EFK46178.1| small heat shock protein IbpA [Escherichia coli MS 119-7]
 gb|EFK53021.1| small heat shock protein IbpA [Escherichia coli MS 107-1]
 gb|EFK66219.1| small heat shock protein IbpA [Escherichia coli MS 124-1]
 gb|EFK75545.1| small heat shock protein IbpA [Escherichia coli MS 78-1]
 gb|EFK92106.1| small heat shock protein IbpA [Escherichia coli MS 146-1]
 gb|EFM50813.1| heat shock protein IbpA [Escherichia coli NC101]
 gb|EFN37436.1| heat shock protein Hsp20 [Escherichia coli W]
 gb|ADN48602.1| small heat shock protein IbpA [Escherichia coli ABU 83972]
 gb|ADN73067.1| heat shock protein IbpA [Escherichia coli UM146]
 gb|EFO57906.1| small heat shock protein IbpA [Escherichia coli MS 145-7]
 gb|EFP73238.1| hsp20/alpha crystallin family protein [Shigella dysenteriae 1617]
 emb|CBJ03481.1| small heat shock protein A [Escherichia coli ETEC H10407]
 gb|EFQ00604.1| hsp20/alpha crystallin family protein [Escherichia coli 1827-70]
 gb|EFR15372.1| hsp20/alpha crystallin family protein [Escherichia coli 2362-75]
 gb|ADR29081.1| heat shock protein IbpA [Escherichia coli O83:H1 str. NRG 857C]
 gb|EFS12142.1| hsp20/alpha crystallin family protein [Shigella flexneri 2a str.
           2457T]
 gb|ADT77320.1| heat shock chaperone [Escherichia coli W]
 dbj|BAJ45430.1| heat shock protein IbpA [Escherichia coli DH1]
 gb|EFU34595.1| small heat shock protein IbpA [Escherichia coli MS 85-1]
 gb|EFU44912.1| small heat shock protein IbpA [Escherichia coli MS 110-3]
 gb|EFU52229.1| small heat shock protein IbpA [Escherichia coli MS 153-1]
 gb|EFU56215.1| small heat shock protein IbpA [Escherichia coli MS 16-3]
 gb|EFU99194.1| hsp20/alpha crystallin family protein [Escherichia coli 3431]
 gb|EFW48803.1| 16 kDa heat shock protein A [Shigella dysenteriae CDC 74-1112]
 gb|EFW54970.1| 16 kDa heat shock protein A [Shigella boydii ATCC 9905]
 gb|EFW60309.1| 16 kDa heat shock protein A [Shigella flexneri CDC 796-83]
 gb|EFW65859.1| 16 kDa heat shock protein A [Escherichia coli O157:H7 str. EC1212]
 gb|EFW68400.1| 16 kDa heat shock protein A [Escherichia coli WV_060327]
 gb|EFW75867.1| 16 kDa heat shock protein A [Escherichia coli EC4100B]
 gb|EFX09031.1| heat shock protein IbpA [Escherichia coli O157:H7 str. G5101]
 gb|EFX13895.1| heat shock protein IbpA [Escherichia coli O157:H- str. 493-89]
 gb|EFX18619.1| heat shock protein IbpA [Escherichia coli O157:H- str. H 2687]
 gb|EFX23406.1| heat shock protein IbpA [Escherichia coli O55:H7 str. 3256-97]
 gb|EFX28533.1| heat shock protein IbpA [Escherichia coli O55:H7 str. USDA 5905]
 gb|EFX33229.1| heat shock protein IbpA [Escherichia coli O157:H7 str. LSU-61]
 gb|EFZ41546.1| hsp20/alpha crystallin family protein [Escherichia coli EPECa14]
 gb|EFZ46890.1| hsp20/alpha crystallin family protein [Escherichia coli E128010]
 gb|EFZ50497.1| hsp20/alpha crystallin family protein [Shigella sonnei 53G]
 gb|EFZ58932.1| hsp20/alpha crystallin family protein [Escherichia coli LT-68]
 gb|EFZ63282.1| hsp20/alpha crystallin family protein [Escherichia coli OK1180]
 gb|EFZ67886.1| hsp20/alpha crystallin family protein [Escherichia coli OK1357]
 gb|EFZ74858.1| hsp20/alpha crystallin family protein [Escherichia coli RN587/1]
 gb|ADX48681.1| heat shock protein Hsp20 [Escherichia coli KO11FL]
 gb|EGB31340.1| hsp20-like protein [Escherichia coli E1520]
 gb|EGB35343.1| hsp20-like protein [Escherichia coli E482]
 gb|EGB40239.1| hsp20-like protein [Escherichia coli H120]
 gb|EGB45814.1| hsp20-like protein [Escherichia coli H252]
 gb|EGB50797.1| hsp20-like protein [Escherichia coli H263]
 gb|EGB55402.1| hsp20-like protein [Escherichia coli H489]
 gb|EGB61303.1| hsp20-like protein [Escherichia coli M863]
 gb|EGB66409.1| hsp20-like protein [Escherichia coli TA007]
 gb|EGB70350.1| hsp20-like protein [Escherichia coli TW10509]
 gb|EGB77273.1| small heat shock protein IbpA [Escherichia coli MS 57-2]
 gb|EGB81868.1| small heat shock protein IbpA [Escherichia coli MS 60-1]
 gb|EGB87628.1| small heat shock protein IbpA [Escherichia coli MS 117-3]
 gb|EGC05565.1| hsp20-like protein [Escherichia fergusonii B253]
 gb|EGC09887.1| hsp20-like protein [Escherichia coli E1167]
 gb|EGC97353.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia fergusonii ECD227]
 gb|EGD61095.1| 16 kDa heat shock protein A [Escherichia coli O157:H7 str. 1044]
 gb|EGD65420.1| 16 kDa heat shock protein A [Escherichia coli O157:H7 str. 1125]
 gb|EGE62529.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_7v]
 gb|EGH36525.1| heat shock protein A [Escherichia coli AA86]
 gb|EGI08930.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H736]
 gb|EGI19438.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli M718]
 gb|EGI25277.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA206]
 gb|EGI29832.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA143]
 gb|EGI34513.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA271]
 gb|EGI44281.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H591]
 gb|EGI48994.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H299]
 gb|EGI89242.1| hsp20/alpha crystallin family protein [Shigella dysenteriae 155-74]
 gb|EGI94669.1| hsp20/alpha crystallin family protein [Shigella boydii 3594-74]
 gb|AEE59012.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gb|EGJ80916.1| hsp20/alpha crystallin family protein [Shigella flexneri K-671]
 gb|EGJ81086.1| hsp20/alpha crystallin family protein [Shigella flexneri 4343-70]
 gb|EGJ82096.1| hsp20/alpha crystallin family protein [Shigella flexneri 2747-71]
 gb|EGJ94294.1| small heat shock protein IbpA [Shigella flexneri 2930-71]
 gb|EGK15683.1| hsp20/alpha crystallin family protein [Shigella flexneri VA-6]
 gb|EGK17149.1| hsp20/alpha crystallin family protein [Shigella flexneri K-218]
 gb|EGK32575.1| hsp20/alpha crystallin family protein [Shigella flexneri K-304]
 gb|EGR61479.1| heat shock protein IbpA [Escherichia coli O104:H4 str. 01-09591]
 gb|EGR72349.1| heat shock protein IbpA [Escherichia coli O104:H4 str. LB226692]
 gb|EGT69213.1| ibpA [Escherichia coli O104:H4 str. C227-11]
 gb|EGU26218.1| heat shock protein IbpA [Escherichia coli XH140A]
 gb|EGU99699.1| heat shock protein A [Escherichia coli MS 79-10]
 gb|EGV47975.1| heat shock protein IbpA [Escherichia coli XH001]
 gb|EGW63719.1| hsp20/alpha crystallin family protein [Escherichia coli 2534-86]
 gb|EGW64295.1| hsp20/alpha crystallin family protein [Escherichia coli
           STEC_C165-02]
 gb|EGW66820.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_B2F1]
 gb|EGW79430.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_94C]
 gb|EGW80916.1| hsp20/alpha crystallin family protein [Escherichia coli 3030-1]
 gb|EGW85852.1| hsp20/alpha crystallin family protein [Escherichia coli
           STEC_DG131-3]
 gb|EGW90066.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_EH250]
 gb|EGX02397.1| hsp20/alpha crystallin family protein [Escherichia coli
           STEC_MHI813]
 gb|EGX02737.1| hsp20/alpha crystallin family protein [Escherichia coli G58-1]
 gb|EGX05018.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_H.1.8]
 gb|EGX20397.1| hsp20/alpha crystallin family protein [Escherichia coli TX1999]
 gb|AEQ15029.1| heat shock chaperone [Escherichia coli O7:K1 str. CE10]
 gb|EHF17928.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           C236-11]
 gb|EHF21466.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           C227-11]
 gb|EHF23925.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           04-8351]
 gb|EHF31927.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           09-7901]
 gb|EHF36644.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-3677]
 gb|EHF45708.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4404]
 gb|EHF49480.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4522]
 gb|EHF52779.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4623]
 gb|EHF64738.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4632 C1]
 gb|EHF68491.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4632 C2]
 gb|EHF70364.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4632 C3]
 gb|EHF72426.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4632 C4]
 gb|EHF80530.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-4632 C5]
 gb|EHF98887.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia coli cloneA_i1]
 gb|AER86726.1| heat shock protein IbpA [Escherichia coli str. 'clone D i2']
 gb|AER91645.1| heat shock protein IbpA [Escherichia coli str. 'clone D i14']
 dbj|BAL40278.1| heat shock chaperone [Escherichia coli str. K-12 substr. MDS42]
 gb|EHN81514.1| small heat shock protein ibpA [Escherichia coli H494]
 gb|EHN82541.1| small heat shock protein ibpA [Escherichia coli TA124]
 gb|EHN92687.1| small heat shock protein ibpA [Escherichia coli H397]
 gb|EHN98690.1| small heat shock protein ibpA [Escherichia coli E101]
 gb|EHO04294.1| small heat shock protein ibpA [Escherichia coli B093]
 gb|EHP63401.1| small heat shock protein ibpA [Escherichia coli 4_1_47FAA]
 gb|AEZ42851.1| heat shock protein IbpA [Escherichia coli O55:H7 str. RM12579]
 gb|EHU04222.1| small heat shock protein IbpA [Escherichia coli DEC1C]
 gb|EHU04371.1| small heat shock protein IbpA [Escherichia coli DEC1A]
 gb|EHU06966.1| small heat shock protein IbpA [Escherichia coli DEC1B]
 gb|EHU17912.1| small heat shock protein ibpA [Escherichia coli DEC1D]
 gb|EHU21631.1| small heat shock protein IbpA [Escherichia coli DEC1E]
 gb|EHU23169.1| small heat shock protein ibpA [Escherichia coli DEC2A]
 gb|EHU35113.1| small heat shock protein IbpA [Escherichia coli DEC2B]
 gb|EHU36907.1| small heat shock protein IbpA [Escherichia coli DEC2C]
 gb|EHU39328.1| small heat shock protein IbpA [Escherichia coli DEC2D]
 gb|EHU50609.1| small heat shock protein IbpA [Escherichia coli DEC2E]
 gb|EHU53653.1| small heat shock protein IbpA [Escherichia coli DEC3A]
 gb|EHU54415.1| small heat shock protein IbpA [Escherichia coli DEC3B]
 gb|EHU67050.1| small heat shock protein IbpA [Escherichia coli DEC3C]
 gb|EHU69922.1| small heat shock protein IbpA [Escherichia coli DEC3D]
 gb|EHU71252.1| small heat shock protein IbpA [Escherichia coli DEC3E]
 gb|EHU81550.1| small heat shock protein IbpA [Escherichia coli DEC3F]
 gb|EHU87137.1| small heat shock protein IbpA [Escherichia coli DEC4A]
 gb|EHU91854.1| small heat shock protein IbpA [Escherichia coli DEC4B]
 gb|EHV01202.1| small heat shock protein IbpA [Escherichia coli DEC4D]
 gb|EHV01904.1| small heat shock protein IbpA [Escherichia coli DEC4C]
 gb|EHV07989.1| small heat shock protein IbpA [Escherichia coli DEC4E]
 gb|EHV18374.1| small heat shock protein IbpA [Escherichia coli DEC4F]
 gb|EHV21110.1| small heat shock protein IbpA [Escherichia coli DEC5A]
 gb|EHV25284.1| small heat shock protein IbpA [Escherichia coli DEC5B]
 gb|EHV33445.1| small heat shock protein IbpA [Escherichia coli DEC5C]
 gb|EHV33976.1| small heat shock protein IbpA [Escherichia coli DEC5D]
 gb|EHV44438.1| small heat shock protein ibpA [Escherichia coli DEC5E]
 gb|EHV52132.1| small heat shock protein IbpA [Escherichia coli DEC6B]
 gb|EHV52402.1| small heat shock protein ibpA [Escherichia coli DEC6A]
 gb|EHV56414.1| small heat shock protein ibpA [Escherichia coli DEC6C]
 gb|EHV67103.1| small heat shock protein ibpA [Escherichia coli DEC6D]
 gb|EHV69824.1| small heat shock protein IbpA [Escherichia coli DEC6E]
 gb|EHV74299.1| small heat shock protein ibpA [Escherichia coli DEC7A]
 gb|EHV83825.1| small heat shock protein IbpA [Escherichia coli DEC7C]
 gb|EHV87463.1| small heat shock protein IbpA [Escherichia coli DEC7D]
 gb|EHV92039.1| small heat shock protein IbpA [Escherichia coli DEC7B]
 gb|EHV97159.1| small heat shock protein ibpA [Escherichia coli DEC7E]
 gb|EHW05970.1| small heat shock protein ibpA [Escherichia coli DEC8A]
 gb|EHW06197.1| small heat shock protein IbpA [Escherichia coli DEC8B]
 gb|EHW11352.1| small heat shock protein IbpA [Escherichia coli DEC8C]
 gb|EHW23188.1| small heat shock protein IbpA [Escherichia coli DEC8D]
 gb|EHW23759.1| small heat shock protein IbpA [Escherichia coli DEC8E]
 gb|EHW30384.1| small heat shock protein IbpA [Escherichia coli DEC9A]
 gb|EHW35676.1| small heat shock protein IbpA [Escherichia coli DEC9B]
 gb|EHW41317.1| small heat shock protein IbpA [Escherichia coli DEC9C]
 gb|EHW48793.1| small heat shock protein IbpA [Escherichia coli DEC9D]
 gb|EHW51152.1| small heat shock protein IbpA [Escherichia coli DEC9E]
 gb|EHW58069.1| small heat shock protein IbpA [Escherichia coli DEC10A]
 gb|EHW63265.1| small heat shock protein IbpA [Escherichia coli DEC10B]
 gb|EHW68215.1| small heat shock protein IbpA [Escherichia coli DEC10C]
 gb|EHW74219.1| small heat shock protein IbpA [Escherichia coli DEC10D]
 gb|EHW85085.1| small heat shock protein IbpA [Escherichia coli DEC10E]
 gb|EHW86162.1| small heat shock protein IbpA [Escherichia coli DEC10F]
 gb|EHW86754.1| small heat shock protein IbpA [Escherichia coli DEC11A]
 gb|EHW99771.1| small heat shock protein IbpA [Escherichia coli DEC11B]
 gb|EHX05669.1| small heat shock protein ibpA [Escherichia coli DEC11D]
 gb|EHX07775.1| small heat shock protein ibpA [Escherichia coli DEC11C]
 gb|EHX16726.1| small heat shock protein ibpA [Escherichia coli DEC11E]
 gb|EHX21936.1| small heat shock protein IbpA [Escherichia coli DEC12B]
 gb|EHX26262.1| small heat shock protein ibpA [Escherichia coli DEC12A]
 gb|EHX26609.1| small heat shock protein ibpA [Escherichia coli DEC12C]
 gb|EHX39972.1| small heat shock protein IbpA [Escherichia coli DEC12D]
 gb|EHX43265.1| small heat shock protein IbpA [Escherichia coli DEC13A]
 gb|EHX43839.1| small heat shock protein IbpA [Escherichia coli DEC12E]
 gb|EHX56324.1| small heat shock protein IbpA [Escherichia coli DEC13B]
 gb|EHX56601.1| small heat shock protein IbpA [Escherichia coli DEC13C]
 gb|EHX59418.1| small heat shock protein IbpA [Escherichia coli DEC13D]
 gb|EHX70446.1| small heat shock protein IbpA [Escherichia coli DEC13E]
 gb|EHX72221.1| small heat shock protein ibpA [Escherichia coli DEC14A]
 gb|EHX75213.1| small heat shock protein IbpA [Escherichia coli DEC14B]
 gb|EHX85346.1| small heat shock protein IbpA [Escherichia coli DEC14C]
 gb|EHX88393.1| small heat shock protein IbpA [Escherichia coli DEC14D]
 gb|EHX93723.1| small heat shock protein IbpA [Escherichia coli DEC15A]
 gb|EHY00146.1| small heat shock protein IbpA [Escherichia coli DEC15B]
 gb|EHY03100.1| small heat shock protein IbpA [Escherichia coli DEC15C]
 gb|EHY11367.1| small heat shock protein IbpA [Escherichia coli DEC15D]
 gb|EHY15943.1| small heat shock protein IbpA [Escherichia coli DEC15E]
 gb|EIA34656.1| heat shock protein IbpA [Escherichia coli SCI-07]
 gb|AFG42639.1| Small heat shock protein ibpA [Escherichia coli P12b]
 gb|AFH15680.1| heat shock protein IbpA [Escherichia coli KO11FL]
 gb|AFH13538.1| heat shock protein IbpA [Escherichia coli W]
 gb|EID64068.1| heat shock protein IbpA [Shigella flexneri 5a str. M90T]
 gb|EIE39153.1| heat shock protein IbpA [Escherichia coli J53]
 gb|EIE56866.1| heat shock protein IbpA [Escherichia coli AI27]
 gb|EIF18398.1| heat shock protein IbpA [Escherichia coli O32:H37 str. P4]
 gb|EIF84527.1| small heat shock protein ibpA [Escherichia coli M919]
 gb|EIG45587.1| small heat shock protein ibpA [Escherichia coli H730]
 gb|EIG45917.1| small heat shock protein ibpA [Escherichia coli B799]
 gb|EIG68889.1| small heat shock protein ibpA [Escherichia sp. 4_1_40B]
 gb|EIG80986.1| Hsp20/alpha crystallin family protein [Escherichia coli 1.2741]
 gb|EIG92211.1| Hsp20/alpha crystallin family protein [Escherichia coli 97.0246]
 gb|EIH01684.1| Hsp20/alpha crystallin family protein [Escherichia coli 5.0588]
 gb|EIH11638.1| Hsp20/alpha crystallin family protein [Escherichia coli 97.0259]
 gb|EIH23302.1| Hsp20/alpha crystallin family protein [Escherichia coli 1.2264]
 gb|EIH31898.1| Hsp20/alpha crystallin family protein [Escherichia coli 96.0497]
 gb|EIH42308.1| Hsp20/alpha crystallin family protein [Escherichia coli 99.0741]
 gb|EIH56807.1| Hsp20/alpha crystallin family protein [Escherichia coli 3.2608]
 gb|EIH65509.1| Hsp20/alpha crystallin family protein [Escherichia coli 93.0624]
 gb|EIH75477.1| Hsp20/alpha crystallin family protein [Escherichia coli 4.0522]
 gb|EIH90264.1| Hsp20/alpha crystallin family protein [Escherichia coli JB1-95]
 gb|EII00461.1| Hsp20/alpha crystallin family protein [Escherichia coli 96.154]
 gb|EII12339.1| Hsp20/alpha crystallin family protein [Escherichia coli 5.0959]
 gb|EII36917.1| Hsp20/alpha crystallin family protein [Escherichia coli 4.0967]
 gb|EII54945.1| Hsp20/alpha crystallin family protein [Escherichia coli 3.3884]
 gb|EII66359.1| Hsp20/alpha crystallin family protein [Escherichia coli 2.4168]
 gb|EII74999.1| Hsp20/alpha crystallin family protein [Escherichia coli 3.2303]
 gb|EII88084.1| Hsp20/alpha crystallin family protein [Escherichia coli 3003]
 gb|EII97312.1| Hsp20/alpha crystallin family protein [Escherichia coli TW07793]
 gb|EIJ01205.1| Hsp20/alpha crystallin family protein [Escherichia coli B41]
 gb|EIJ16310.1| Hsp20/alpha crystallin family protein [Escherichia coli 900105
           (10e)]
 gb|AFJ31415.1| heat shock protein IbpA [Escherichia coli Xuzhou21]
 gb|EIK99952.1| heat shock protein IbpA [Escherichia coli O103:H25 str. CVM9340]
 gb|EIL01364.1| heat shock protein IbpA [Escherichia coli O103:H2 str. CVM9450]
 gb|EIL10056.1| heat shock protein IbpA [Escherichia coli O111:H11 str. CVM9534]
 gb|EIL18906.1| heat shock protein IbpA [Escherichia coli O111:H8 str. CVM9574]
 gb|EIL20482.1| heat shock protein IbpA [Escherichia coli O111:H8 str. CVM9570]
 gb|EIL26823.1| heat shock protein IbpA [Escherichia coli O111:H11 str. CVM9545]
 gb|EIL33994.1| hypothetical protein ECO10026_26148 [Escherichia coli O26:H11 str.
           CVM10026]
 gb|EIL42671.1| heat shock protein IbpA [Escherichia coli O26:H11 str. CVM9942]
 gb|EIL44747.1| heat shock protein IbpA [Escherichia coli 541-15]
 gb|EIL55055.1| heat shock protein IbpA [Escherichia coli KD1]
 gb|EIL55166.1| heat shock protein IbpA [Escherichia coli KD2]
 gb|EIL64242.1| heat shock protein IbpA [Escherichia coli 541-1]
 gb|EIL65259.1| heat shock protein IbpA [Escherichia coli 75]
 gb|EIL69713.1| heat shock protein IbpA [Escherichia coli 576-1]
 gb|EIL78594.1| heat shock protein IbpA [Escherichia coli CUMT8]
 gb|EIL79673.1| heat shock protein IbpA [Escherichia coli HM605]
 gb|EIN17329.1| small heat shock protein ibpA [Escherichia coli FRIK1996]
 gb|EIN17765.1| small heat shock protein ibpA [Escherichia coli FDA505]
 gb|EIN18416.1| small heat shock protein ibpA [Escherichia coli FDA517]
 gb|EIN34225.1| small heat shock protein ibpA [Escherichia coli FRIK1985]
 gb|EIN34726.1| small heat shock protein ibpA [Escherichia coli 93-001]
 gb|EIN37592.1| small heat shock protein ibpA [Escherichia coli FRIK1990]
 gb|EIN50609.1| small heat shock protein ibpA [Escherichia coli PA3]
 gb|EIN53551.1| small heat shock protein ibpA [Escherichia coli PA5]
 gb|EIN56870.1| small heat shock protein ibpA [Escherichia coli PA9]
 gb|EIN66962.1| small heat shock protein ibpA [Escherichia coli PA10]
 gb|EIN70884.1| small heat shock protein ibpA [Escherichia coli PA14]
 gb|EIN72214.1| small heat shock protein ibpA [Escherichia coli PA15]
 gb|EIN84441.1| small heat shock protein ibpA [Escherichia coli PA22]
 gb|EIN91033.1| small heat shock protein ibpA [Escherichia coli PA24]
 gb|EIN91328.1| small heat shock protein ibpA [Escherichia coli PA25]
 gb|EIN97028.1| small heat shock protein ibpA [Escherichia coli PA28]
 gb|EIO08938.1| small heat shock protein ibpA [Escherichia coli PA31]
 gb|EIO09110.1| small heat shock protein ibpA [Escherichia coli PA32]
 gb|EIO12603.1| small heat shock protein ibpA [Escherichia coli PA33]
 gb|EIO25542.1| small heat shock protein ibpA [Escherichia coli PA40]
 gb|EIO28405.1| small heat shock protein ibpA [Escherichia coli PA39]
 gb|EIO32284.1| small heat shock protein ibpA [Escherichia coli PA41]
 gb|EIO34372.1| small heat shock protein ibpA [Escherichia coli PA42]
 gb|EIO47039.1| small heat shock protein ibpA [Escherichia coli TW06591]
 gb|EIO53762.1| small heat shock protein ibpA [Escherichia coli TW07945]
 gb|EIO54618.1| small heat shock protein ibpA [Escherichia coli TW10246]
 gb|EIO60517.1| small heat shock protein ibpA [Escherichia coli TW11039]
 gb|EIO67469.1| small heat shock protein ibpA [Escherichia coli TW09098]
 gb|EIO72112.1| small heat shock protein ibpA [Escherichia coli TW09109]
 gb|EIO80369.1| small heat shock protein ibpA [Escherichia coli TW10119]
 gb|EIO88657.1| small heat shock protein ibpA [Escherichia coli TW09195]
 gb|EIO88772.1| small heat shock protein ibpA [Escherichia coli EC4203]
 gb|EIO93533.1| small heat shock protein ibpA [Escherichia coli EC4196]
 gb|EIP05163.1| small heat shock protein ibpA [Escherichia coli O157:H7 str.
           TW14313]
 gb|EIP06872.1| small heat shock protein ibpA [Escherichia coli TW14301]
 gb|EIP11426.1| small heat shock protein ibpA [Escherichia coli EC4421]
 gb|EIP20805.1| small heat shock protein ibpA [Escherichia coli EC4422]
 gb|EIP24956.1| small heat shock protein ibpA [Escherichia coli EC4013]
 gb|EIP28732.1| small heat shock protein ibpA [Escherichia coli EC4402]
 gb|EIP36297.1| small heat shock protein ibpA [Escherichia coli EC4439]
 gb|EIP41326.1| small heat shock protein ibpA [Escherichia coli EC4436]
 gb|EIP50197.1| small heat shock protein ibpA [Escherichia coli EC4437]
 gb|EIP51585.1| small heat shock protein ibpA [Escherichia coli EC4448]
 gb|EIP57275.1| small heat shock protein ibpA [Escherichia coli EC1738]
 gb|EIP64819.1| small heat shock protein ibpA [Escherichia coli EC1734]
 gb|EIP74548.1| small heat shock protein ibpA [Escherichia coli EC1863]
 gb|EIP74616.1| small heat shock protein ibpA [Escherichia coli EC1845]
 gb|EIQ04108.1| small heat shock protein ibpA [Shigella flexneri K-1770]
 gb|EIQ04935.1| small heat shock protein ibpA [Shigella flexneri CCH060]
 gb|EIQ20486.1| small heat shock protein ibpA [Shigella flexneri K-404]
 gb|EIQ31538.1| small heat shock protein ibpA [Shigella boydii 4444-74]
 gb|EIQ34525.1| small heat shock protein ibpA [Shigella boydii 965-58]
 gb|EIQ36955.1| small heat shock protein ibpA [Shigella sonnei 3226-85]
 gb|EIQ40012.1| small heat shock protein ibpA [Shigella sonnei 3233-85]
 gb|EIQ50455.1| small heat shock protein IbpA [Shigella sonnei 4822-66]
 gb|EIQ58359.1| small heat shock protein ibpA [Shigella flexneri 1235-66]
 gb|EIQ59596.1| small heat shock protein ibpA [Escherichia coli EPECa12]
 gb|EIQ67573.1| small heat shock protein IbpA [Escherichia coli EPEC C342-62]
 gb|EJE62330.1| heat shock protein IbpA [Escherichia coli O111:H8 str. CVM9634]
 gb|EJE69530.1| heat shock protein IbpA [Escherichia coli O111:H8 str. CVM9602]
 gb|EJE72003.1| small heat shock protein A [Escherichia coli O26:H11 str. CVM10224]
 gb|EJE82979.1| heat shock protein IbpA [Escherichia coli O111:H11 str. CVM9553]
 gb|EJE88168.1| heat shock protein IbpA [Escherichia coli O111:H11 str. CVM9455]
 gb|EJE88316.1| heat shock protein IbpA [Escherichia coli O26:H11 str. CVM10021]
 gb|EJE89067.1| heat shock protein IbpA [Escherichia coli O26:H11 str. CVM10030]
 gb|EJE93453.1| heat shock protein IbpA [Escherichia coli O26:H11 str. CVM9952]
 gb|EJK93968.1| hsp20/alpha crystallin family protein [Escherichia coli STEC_O31]
 gb|EJL10623.1| small heat shock protein IbpA [Shigella flexneri 6603-63]
 gb|EJL12487.1| small heat shock protein IbpA [Shigella sonnei str. Moseley]
 gb|EEH70896.2| small heat shock protein ibpA [Escherichia sp. 1_1_43]
 gb|EJZ61411.1| small heat shock protein IbpA [Shigella flexneri 1485-80]
 gb|AFS54742.1| heat shock protein IbpA [Escherichia coli O104:H4 str. 2009EL-2050]
 gb|AFS71952.1| heat shock protein IbpA [Escherichia coli O104:H4 str. 2011C-3493]
 gb|AFS88816.1| heat shock protein IbpA [Escherichia coli O104:H4 str. 2009EL-2071]
 gb|EKG96073.1| small heat shock protein ibpA [Escherichia coli PA7]
 gb|EKG96553.1| small heat shock protein ibpA [Escherichia coli FRIK920]
 gb|EKH00426.1| small heat shock protein ibpA [Escherichia coli PA34]
 gb|EKH10154.1| small heat shock protein ibpA [Escherichia coli FDA506]
 gb|EKH14475.1| small heat shock protein ibpA [Escherichia coli FDA507]
 gb|EKH21898.1| small heat shock protein ibpA [Escherichia coli FDA504]
 gb|EKH27722.1| small heat shock protein ibpA [Escherichia coli FRIK1999]
 gb|EKH33415.1| small heat shock protein ibpA [Escherichia coli FRIK1997]
 gb|EKH38058.1| small heat shock protein ibpA [Escherichia coli NE1487]
 gb|EKH44210.1| small heat shock protein ibpA [Escherichia coli NE037]
 gb|EKH50048.1| small heat shock protein ibpA [Escherichia coli FRIK2001]
 gb|EKH55758.1| small heat shock protein ibpA [Escherichia coli PA4]
 gb|EKH64717.1| small heat shock protein ibpA [Escherichia coli PA23]
 gb|EKH66782.1| small heat shock protein ibpA [Escherichia coli PA49]
 gb|EKH73154.1| small heat shock protein ibpA [Escherichia coli PA45]
 gb|EKH80766.1| small heat shock protein ibpA [Escherichia coli TT12B]
 gb|EKH85488.1| small heat shock protein ibpA [Escherichia coli MA6]
 gb|EKH89385.1| small heat shock protein ibpA [Escherichia coli 5905]
 gb|EKH97725.1| small heat shock protein ibpA [Escherichia coli CB7326]
 gb|EKI04254.1| small heat shock protein ibpA [Escherichia coli EC96038]
 gb|EKI07082.1| small heat shock protein ibpA [Escherichia coli 5412]
 gb|EKI15429.1| small heat shock protein ibpA [Escherichia coli TW15901]
 gb|EKI22834.1| small heat shock protein ibpA [Escherichia coli ARS4.2123]
 gb|EKI23216.1| small heat shock protein ibpA [Escherichia coli TW00353]
 gb|EKI33749.1| small heat shock protein ibpA [Escherichia coli 3006]
 gb|EKI35153.1| small heat shock protein ibpA [Escherichia coli 07798]
 gb|EKI37117.1| small heat shock protein ibpA [Escherichia coli PA38]
 gb|EKI47564.1| small heat shock protein ibpA [Escherichia coli EC1735]
 gb|EKI58206.1| small heat shock protein ibpA [Escherichia coli EC1736]
 gb|EKI61160.1| small heat shock protein ibpA [Escherichia coli EC1737]
 gb|EKI65931.1| small heat shock protein ibpA [Escherichia coli EC1846]
 gb|EKI73921.1| small heat shock protein ibpA [Escherichia coli EC1847]
 gb|EKI77709.1| small heat shock protein ibpA [Escherichia coli EC1848]
 gb|EKI83877.1| small heat shock protein ibpA [Escherichia coli EC1849]
 gb|EKI91347.1| small heat shock protein ibpA [Escherichia coli EC1850]
 gb|EKI94366.1| small heat shock protein ibpA [Escherichia coli EC1856]
 gb|EKJ01755.1| small heat shock protein ibpA [Escherichia coli EC1862]
 gb|EKJ07502.1| small heat shock protein ibpA [Escherichia coli EC1864]
 gb|EKJ11658.1| small heat shock protein ibpA [Escherichia coli EC1865]
 gb|EKJ21355.1| small heat shock protein ibpA [Escherichia coli EC1868]
 gb|EKJ22132.1| small heat shock protein ibpA [Escherichia coli EC1866]
 gb|EKJ32473.1| small heat shock protein ibpA [Escherichia coli EC1869]
 gb|EKJ37474.1| small heat shock protein ibpA [Escherichia coli EC1870]
 gb|EKJ39212.1| small heat shock protein ibpA [Escherichia coli NE098]
 gb|EKJ49033.1| small heat shock protein ibpA [Escherichia coli FRIK523]
 gb|EKJ55306.1| small heat shock protein ibpA [Escherichia coli 0.1288]
 gb|EKJ56733.1| small heat shock protein ibpA [Escherichia coli 0.1304]
 gb|EKJ81621.1| heat shock protein IbpA [Escherichia coli AD30]
 gb|EKK22738.1| small heat shock protein ibpA [Escherichia coli 5.2239]
 gb|EKK23233.1| small heat shock protein ibpA [Escherichia coli 3.4870]
 gb|EKK23800.1| small heat shock protein ibpA [Escherichia coli 6.0172]
 gb|EKK39816.1| small heat shock protein ibpA [Escherichia coli 8.0566]
 gb|EKK40174.1| small heat shock protein ibpA [Escherichia coli 8.0586]
 gb|EKK40881.1| small heat shock protein ibpA [Escherichia coli 8.0569]
 gb|EKK51483.1| small heat shock protein ibpA [Escherichia coli 10.0833]
 gb|EKK54320.1| small heat shock protein ibpA [Escherichia coli 8.2524]
 gb|EKK63038.1| small heat shock protein ibpA [Escherichia coli 10.0869]
 gb|EKK67788.1| small heat shock protein ibpA [Escherichia coli 88.0221]
 gb|EKK73027.1| small heat shock protein ibpA [Escherichia coli 8.0416]
 gb|EKK82804.1| small heat shock protein ibpA [Escherichia coli 10.0821]
 emb|CCK49001.1| heat shock protein [Escherichia coli chi7122]
 emb|CCJ46318.1| heat shock protein [Escherichia coli]
 gb|EKT93891.1| small heat shock protein A [Escherichia coli O111:H8 str.
           CFSAN001632]
 gb|EKT94148.1| small heat shock protein A [Escherichia coli O26:H11 str.
           CFSAN001629]
 gb|EKT96995.1| small heat shock protein A [Escherichia coli O111:H11 str.
           CFSAN001630]
 gb|EKV71894.1| small heat shock protein ibpA [Escherichia coli 88.1042]
 gb|EKV72096.1| small heat shock protein ibpA [Escherichia coli 89.0511]
 gb|EKV75170.1| small heat shock protein ibpA [Escherichia coli 88.1467]
 gb|EKV87068.1| small heat shock protein ibpA [Escherichia coli 90.0091]
 gb|EKV90276.1| small heat shock protein ibpA [Escherichia coli 90.2281]
 gb|EKV93244.1| small heat shock protein ibpA [Escherichia coli 90.0039]
 gb|EKW05975.1| small heat shock protein ibpA [Escherichia coli 93.0056]
 gb|EKW06165.1| small heat shock protein ibpA [Escherichia coli 93.0055]
 gb|EKW10345.1| small heat shock protein ibpA [Escherichia coli 94.0618]
 gb|EKW22230.1| small heat shock protein ibpA [Escherichia coli 95.0183]
 gb|EKW23754.1| small heat shock protein ibpA [Escherichia coli 95.0943]
 gb|EKW25192.1| small heat shock protein ibpA [Escherichia coli 95.1288]
 gb|EKW37998.1| small heat shock protein ibpA [Escherichia coli 96.0428]
 gb|EKW40258.1| small heat shock protein ibpA [Escherichia coli 96.0427]
 gb|EKW45032.1| small heat shock protein ibpA [Escherichia coli 96.0939]
 gb|EKW52831.1| small heat shock protein ibpA [Escherichia coli 96.0932]
 gb|EKW59059.1| small heat shock protein ibpA [Escherichia coli 96.0107]
 gb|EKW61119.1| small heat shock protein ibpA [Escherichia coli 97.0003]
 gb|EKW70758.1| small heat shock protein ibpA [Escherichia coli 97.1742]
 gb|EKW73642.1| small heat shock protein ibpA [Escherichia coli 97.0007]
 gb|EKW77891.1| small heat shock protein ibpA [Escherichia coli 99.0672]
 gb|EKW86709.1| small heat shock protein ibpA [Escherichia coli 99.0678]
 gb|EKW87983.1| small heat shock protein ibpA [Escherichia coli 99.0713]
 gb|EKY35636.1| small heat shock protein ibpA [Escherichia coli 96.0109]
 gb|EKY36221.1| small heat shock protein ibpA [Escherichia coli 97.0010]
 gb|EKY92541.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02030]
 gb|EKY92891.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02033-1]
 gb|EKY94574.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02092]
 gb|EKZ07829.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02093]
 gb|EKZ09821.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02281]
 gb|EKZ12557.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02318]
 gb|EKZ24040.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-02913]
 gb|EKZ26778.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-03439]
 gb|EKZ27223.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-03943]
 gb|EKZ37529.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           11-04080]
 gb|EKZ38743.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-9990]
 gb|EKZ41054.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-9450]
 gb|EKZ49865.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-4984]
 gb|EKZ51878.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-4986]
 gb|EKZ60151.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-4987]
 gb|EKZ63657.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-4988]
 gb|EKZ68569.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-5603]
 gb|EKZ75808.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-5604]
 gb|EKZ79941.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec12-0465]
 gb|EKZ84395.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-6006]
 gb|EKZ90094.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec12-0466]
 gb|EKZ94433.1| small heat shock protein ibpA [Escherichia coli O104:H4 str.
           Ec11-9941]
 gb|ELB95765.1| small heat shock protein ibpA [Escherichia coli KTE2]
 gb|ELB96863.1| small heat shock protein ibpA [Escherichia coli KTE4]
 gb|ELC06248.1| small heat shock protein ibpA [Escherichia coli KTE5]
 gb|ELC13536.1| small heat shock protein ibpA [Escherichia coli KTE10]
 gb|ELC16094.1| small heat shock protein ibpA [Escherichia sp. KTE11]
 gb|ELC18127.1| small heat shock protein ibpA [Escherichia coli KTE12]
 gb|ELC25232.1| small heat shock protein ibpA [Escherichia coli KTE16]
 gb|ELC25718.1| small heat shock protein ibpA [Escherichia coli KTE15]
 gb|ELC33980.1| small heat shock protein ibpA [Escherichia coli KTE25]
 gb|ELC35190.1| small heat shock protein ibpA [Escherichia coli KTE21]
 gb|ELC43354.1| small heat shock protein ibpA [Escherichia coli KTE26]
 gb|ELC46732.1| small heat shock protein ibpA [Escherichia coli KTE28]
 gb|ELC53409.1| small heat shock protein ibpA [Escherichia coli KTE39]
 gb|ELC56560.1| small heat shock protein ibpA [Escherichia coli KTE44]
 gb|ELC61874.1| small heat shock protein ibpA [Escherichia coli KTE178]
 gb|ELC69583.1| small heat shock protein ibpA [Escherichia coli KTE187]
 gb|ELC69827.1| small heat shock protein ibpA [Escherichia coli KTE181]
 gb|ELC78050.1| small heat shock protein ibpA [Escherichia coli KTE188]
 gb|ELC80706.1| small heat shock protein ibpA [Escherichia coli KTE189]
 gb|ELC87807.1| small heat shock protein ibpA [Escherichia coli KTE191]
 gb|ELC93966.1| small heat shock protein ibpA [Escherichia coli KTE193]
 gb|ELC96153.1| small heat shock protein ibpA [Escherichia coli KTE201]
 gb|ELD02053.1| small heat shock protein ibpA [Escherichia coli KTE204]
 gb|ELD07380.1| small heat shock protein ibpA [Escherichia coli KTE205]
 gb|ELD11793.1| small heat shock protein ibpA [Escherichia coli KTE206]
 gb|ELD17490.1| small heat shock protein ibpA [Escherichia coli KTE208]
 gb|ELD18898.1| small heat shock protein ibpA [Escherichia coli KTE210]
 gb|ELD27020.1| small heat shock protein ibpA [Escherichia coli KTE212]
 gb|ELD30750.1| small heat shock protein ibpA [Escherichia coli KTE213]
 gb|ELD34180.1| small heat shock protein ibpA [Escherichia coli KTE214]
 gb|ELD39009.1| small heat shock protein ibpA [Escherichia coli KTE216]
 gb|ELD46803.1| small heat shock protein ibpA [Escherichia coli KTE220]
 gb|ELD49680.1| small heat shock protein ibpA [Escherichia coli KTE224]
 gb|ELD57517.1| small heat shock protein ibpA [Escherichia coli KTE230]
 gb|ELD58154.1| small heat shock protein ibpA [Escherichia coli KTE228]
 gb|ELD66916.1| small heat shock protein ibpA [Escherichia coli KTE234]
 gb|ELD69326.1| small heat shock protein ibpA [Escherichia coli KTE233]
 gb|ELD75199.1| small heat shock protein ibpA [Escherichia coli KTE235]
 gb|ELD78974.1| small heat shock protein ibpA [Escherichia coli KTE236]
 gb|ELD83639.1| small heat shock protein ibpA [Escherichia coli KTE237]
 gb|ELD87689.1| small heat shock protein ibpA [Escherichia coli KTE47]
 gb|ELD94339.1| small heat shock protein ibpA [Escherichia coli KTE49]
 gb|ELD95453.1| small heat shock protein ibpA [Escherichia coli KTE51]
 gb|ELE02590.1| small heat shock protein ibpA [Escherichia coli KTE53]
 gb|ELE09088.1| small heat shock protein ibpA [Escherichia coli KTE55]
 gb|ELE15824.1| small heat shock protein ibpA [Escherichia coli KTE56]
 gb|ELE18655.1| small heat shock protein ibpA [Escherichia coli KTE57]
 gb|ELE20893.1| small heat shock protein ibpA [Escherichia coli KTE58]
 gb|ELE28212.1| small heat shock protein ibpA [Escherichia coli KTE60]
 gb|ELE30126.1| small heat shock protein ibpA [Escherichia coli KTE62]
 gb|ELE38855.1| small heat shock protein ibpA [Escherichia coli KTE66]
 gb|ELE45868.1| small heat shock protein ibpA [Escherichia coli KTE67]
 gb|ELE48161.1| small heat shock protein ibpA [Escherichia coli KTE72]
 gb|ELE51576.1| small heat shock protein ibpA [Escherichia coli KTE75]
 gb|ELE56351.1| small heat shock protein ibpA [Escherichia coli KTE76]
 gb|ELE60773.1| small heat shock protein ibpA [Escherichia coli KTE77]
 gb|ELE67333.1| small heat shock protein ibpA [Escherichia coli KTE80]
 gb|ELE68640.1| small heat shock protein ibpA [Escherichia coli KTE81]
 gb|ELE77086.1| small heat shock protein ibpA [Escherichia coli KTE83]
 gb|ELE78257.1| small heat shock protein ibpA [Escherichia coli KTE86]
 gb|ELE86013.1| small heat shock protein ibpA [Escherichia coli KTE87]
 gb|ELE87546.1| small heat shock protein ibpA [Escherichia coli KTE93]
 gb|ELE95558.1| small heat shock protein ibpA [Escherichia coli KTE111]
 gb|ELE96191.1| small heat shock protein ibpA [Escherichia coli KTE116]
 gb|ELF05748.1| small heat shock protein ibpA [Escherichia coli KTE119]
 gb|ELF08220.1| small heat shock protein ibpA [Escherichia coli KTE142]
 gb|ELF14940.1| small heat shock protein ibpA [Escherichia coli KTE143]
 gb|ELF16599.1| small heat shock protein ibpA [Escherichia coli KTE156]
 gb|ELF26977.1| small heat shock protein ibpA [Escherichia coli KTE162]
 gb|ELF29895.1| small heat shock protein ibpA [Escherichia coli KTE161]
 gb|ELF34788.1| small heat shock protein ibpA [Escherichia coli KTE169]
 gb|ELF35072.1| small heat shock protein ibpA [Escherichia coli KTE171]
 gb|ELF45822.1| small heat shock protein ibpA [Escherichia coli KTE8]
 gb|ELF47807.1| small heat shock protein ibpA [Escherichia coli KTE6]
 gb|ELF51237.1| small heat shock protein ibpA [Escherichia coli KTE9]
 gb|ELF54373.1| small heat shock protein ibpA [Escherichia coli KTE17]
 gb|ELF62056.1| small heat shock protein ibpA [Escherichia coli KTE18]
 gb|ELF62210.1| small heat shock protein ibpA [Escherichia coli KTE45]
 gb|ELF70263.1| small heat shock protein ibpA [Escherichia coli KTE42]
 gb|ELF72521.1| small heat shock protein ibpA [Escherichia coli KTE23]
 gb|ELF80316.1| small heat shock protein ibpA [Escherichia coli KTE43]
 gb|ELF83458.1| small heat shock protein ibpA [Escherichia coli KTE29]
 gb|ELF89116.1| small heat shock protein ibpA [Escherichia coli KTE22]
 gb|ELF93799.1| small heat shock protein ibpA [Escherichia coli KTE46]
 gb|ELF95424.1| small heat shock protein ibpA [Escherichia coli KTE48]
 gb|ELG10861.1| small heat shock protein ibpA [Escherichia coli KTE54]
 gb|ELG12027.1| small heat shock protein ibpA [Escherichia coli KTE59]
 gb|ELG13372.1| small heat shock protein ibpA [Escherichia coli KTE63]
 gb|ELG22039.1| small heat shock protein ibpA [Escherichia coli KTE65]
 gb|ELG22684.1| small heat shock protein ibpA [Escherichia coli KTE78]
 gb|ELG32336.1| small heat shock protein ibpA [Escherichia coli KTE84]
 gb|ELG34885.1| small heat shock protein ibpA [Escherichia coli KTE79]
 gb|ELG39562.1| small heat shock protein ibpA [Escherichia coli KTE91]
 gb|ELG46520.1| small heat shock protein ibpA [Escherichia coli KTE101]
 gb|ELG46710.1| small heat shock protein ibpA [Escherichia coli KTE115]
 gb|ELG51885.1| small heat shock protein ibpA [Escherichia coli KTE118]
 gb|ELG62690.1| small heat shock protein ibpA [Escherichia coli KTE123]
 gb|ELG66060.1| small heat shock protein ibpA [Escherichia coli KTE136]
 gb|ELG66595.1| small heat shock protein ibpA [Escherichia coli KTE135]
 gb|ELG69772.1| small heat shock protein ibpA [Escherichia coli KTE140]
 gb|ELG75962.1| small heat shock protein ibpA [Escherichia coli KTE141]
 gb|ELG80456.1| small heat shock protein ibpA [Escherichia coli KTE144]
 gb|ELG84355.1| small heat shock protein ibpA [Escherichia coli KTE146]
 gb|ELG90997.1| small heat shock protein ibpA [Escherichia coli KTE147]
 gb|ELG96108.1| small heat shock protein ibpA [Escherichia coli KTE158]
 gb|ELG99771.1| small heat shock protein ibpA [Escherichia coli KTE154]
 gb|ELH04493.1| small heat shock protein ibpA [Escherichia coli KTE192]
 gb|ELH09344.1| small heat shock protein ibpA [Escherichia coli KTE194]
 gb|ELH12205.1| small heat shock protein ibpA [Escherichia coli KTE165]
 gb|ELH16488.1| small heat shock protein ibpA [Escherichia coli KTE173]
 gb|ELH16586.1| small heat shock protein ibpA [Escherichia coli KTE190]
 gb|ELH22299.1| small heat shock protein ibpA [Escherichia coli KTE175]
 gb|ELH32936.1| small heat shock protein ibpA [Escherichia coli KTE196]
 gb|ELH39856.1| small heat shock protein ibpA [Escherichia coli KTE184]
 gb|ELH40690.1| small heat shock protein ibpA [Escherichia coli KTE183]
 gb|ELH43722.1| small heat shock protein ibpA [Escherichia coli KTE197]
 gb|ELH56732.1| small heat shock protein ibpA [Escherichia coli KTE203]
 gb|ELH59063.1| small heat shock protein ibpA [Escherichia coli KTE207]
 gb|ELH65250.1| small heat shock protein ibpA [Escherichia coli KTE209]
 gb|ELH67702.1| small heat shock protein ibpA [Escherichia coli KTE211]
 gb|ELH70210.1| small heat shock protein ibpA [Escherichia coli KTE217]
 gb|ELH73893.1| small heat shock protein ibpA [Escherichia coli KTE215]
 gb|ELH81068.1| small heat shock protein ibpA [Escherichia coli KTE218]
 gb|ELH82978.1| small heat shock protein ibpA [Escherichia coli KTE223]
 gb|ELH98532.1| small heat shock protein ibpA [Escherichia coli KTE229]
 gb|ELH99132.1| small heat shock protein ibpA [Escherichia coli KTE227]
 gb|ELI03078.1| small heat shock protein ibpA [Escherichia coli KTE104]
 gb|ELI03399.1| small heat shock protein ibpA [Escherichia coli KTE105]
 gb|ELI07380.1| small heat shock protein ibpA [Escherichia coli KTE106]
 gb|ELI15902.1| small heat shock protein ibpA [Escherichia coli KTE109]
 gb|ELI20744.1| small heat shock protein ibpA [Escherichia coli KTE112]
 gb|ELI22331.1| small heat shock protein ibpA [Escherichia coli KTE113]
 gb|ELI26400.1| small heat shock protein ibpA [Escherichia coli KTE117]
 gb|ELI35344.1| small heat shock protein ibpA [Escherichia coli KTE120]
 gb|ELI38584.1| small heat shock protein ibpA [Escherichia coli KTE122]
 gb|ELI38905.1| small heat shock protein ibpA [Escherichia coli KTE124]
 gb|ELI51025.1| small heat shock protein ibpA [Escherichia coli KTE128]
 gb|ELI55483.1| small heat shock protein ibpA [Escherichia coli KTE129]
 gb|ELI64238.1| small heat shock protein ibpA [Escherichia coli KTE131]
 gb|ELI67932.1| small heat shock protein ibpA [Escherichia coli KTE133]
 gb|ELI70383.1| small heat shock protein ibpA [Escherichia coli KTE137]
 gb|ELI76186.1| small heat shock protein ibpA [Escherichia coli KTE138]
 gb|ELI81386.1| small heat shock protein ibpA [Escherichia coli KTE139]
 gb|ELI85129.1| small heat shock protein ibpA [Escherichia coli KTE145]
 gb|ELI92482.1| small heat shock protein ibpA [Escherichia coli KTE148]
 gb|ELI93331.1| small heat shock protein ibpA [Escherichia coli KTE150]
 gb|ELI98921.1| small heat shock protein ibpA [Escherichia coli KTE153]
 gb|ELJ06713.1| small heat shock protein ibpA [Escherichia coli KTE157]
 gb|ELJ07971.1| small heat shock protein ibpA [Escherichia coli KTE160]
 gb|ELJ10352.1| small heat shock protein ibpA [Escherichia coli KTE163]
 gb|ELJ20258.1| small heat shock protein ibpA [Escherichia coli KTE166]
 gb|ELJ22861.1| small heat shock protein ibpA [Escherichia coli KTE167]
 gb|ELJ24486.1| small heat shock protein ibpA [Escherichia coli KTE168]
 gb|ELJ33743.1| small heat shock protein ibpA [Escherichia coli KTE174]
 gb|ELJ36399.1| small heat shock protein ibpA [Escherichia coli KTE176]
 gb|ELJ39480.1| small heat shock protein ibpA [Escherichia coli KTE177]
 gb|ELJ49243.1| small heat shock protein ibpA [Escherichia coli KTE179]
 gb|ELJ49659.1| small heat shock protein ibpA [Escherichia coli KTE180]
 gb|ELJ53272.1| small heat shock protein ibpA [Escherichia coli KTE232]
 gb|ELJ62772.1| small heat shock protein ibpA [Escherichia coli KTE82]
 gb|ELJ66947.1| small heat shock protein ibpA [Escherichia coli KTE88]
 gb|ELJ67195.1| small heat shock protein ibpA [Escherichia coli KTE85]
 gb|ELJ77280.1| small heat shock protein ibpA [Escherichia coli KTE90]
 gb|ELJ80051.1| small heat shock protein ibpA [Escherichia coli KTE95]
 gb|ELJ81101.1| small heat shock protein ibpA [Escherichia coli KTE94]
 gb|ELJ91851.1| small heat shock protein ibpA [Escherichia coli KTE97]
 gb|ELJ94905.1| small heat shock protein ibpA [Escherichia coli KTE99]
 gb|ELL43922.1| small heat shock protein A [Escherichia coli J96]
 emb|CCP98515.1| 16 kDa heat shock protein A [Escherichia coli O10:K5(L):H4 str.
           ATCC 23506]
 emb|CCP99941.1| 16 kDa heat shock protein A [Escherichia coli O5:K4(L):H4 str. ATCC
           23502]
 emb|CCQ06531.1| 16 kDa heat shock protein A [Escherichia coli Nissle 1917]
 gb|AGC89176.1| small heat shock protein A [Escherichia coli APEC O78]
 gb|ELV15225.1| small heat shock protein ibpA [Escherichia coli 99.0814]
 gb|ELV16666.1| small heat shock protein ibpA [Escherichia coli 09BKT078844]
 gb|ELV24295.1| small heat shock protein ibpA [Escherichia coli 99.0815]
 gb|ELV32257.1| small heat shock protein ibpA [Escherichia coli 99.0816]
 gb|ELV32338.1| small heat shock protein ibpA [Escherichia coli 99.0839]
 gb|ELV36846.1| small heat shock protein ibpA [Escherichia coli 99.0848]
 gb|ELV45751.1| small heat shock protein ibpA [Escherichia coli 99.1753]
 gb|ELV49171.1| small heat shock protein ibpA [Escherichia coli 99.1775]
 gb|ELV52476.1| small heat shock protein ibpA [Escherichia coli 99.1793]
 gb|ELV63799.1| small heat shock protein ibpA [Escherichia coli 99.1805]
 gb|ELV64953.1| small heat shock protein ibpA [Escherichia coli ATCC 700728]
 gb|ELV65036.1| small heat shock protein ibpA [Escherichia coli PA11]
 gb|ELV78294.1| small heat shock protein ibpA [Escherichia coli PA13]
 gb|ELV78473.1| small heat shock protein ibpA [Escherichia coli PA19]
 gb|ELV86935.1| small heat shock protein ibpA [Escherichia coli PA2]
 gb|ELV93743.1| small heat shock protein ibpA [Escherichia coli PA47]
 gb|ELV94695.1| small heat shock protein ibpA [Escherichia coli PA48]
 gb|ELW00943.1| small heat shock protein ibpA [Escherichia coli PA8]
 gb|ELW08898.1| small heat shock protein ibpA [Escherichia coli 7.1982]
 gb|ELW11009.1| small heat shock protein ibpA [Escherichia coli 99.1781]
 gb|ELW15505.1| small heat shock protein ibpA [Escherichia coli 99.1762]
 gb|ELW24680.1| small heat shock protein ibpA [Escherichia coli PA35]
 gb|ELW29649.1| small heat shock protein ibpA [Escherichia coli 3.4880]
 gb|ELW32331.1| small heat shock protein ibpA [Escherichia coli 95.0083]
 gb|ELW39080.1| small heat shock protein ibpA [Escherichia coli 99.0670]
 gb|EMD03948.1| small heat shock protein A [Escherichia coli O08]
 gb|EMD04820.1| small heat shock protein A [Escherichia coli S17]
 gb|EMD06665.1| small heat shock protein A [Escherichia coli SEPT362]
 gb|EMR92764.1| heat shock chaperone [Escherichia coli ONT:H33 str. C48/93]
 gb|EMR96162.1| heat shock chaperone [Escherichia coli O104:H4 str. E92/11]
 gb|EMR98331.1| heat shock chaperone [Escherichia coli O104:H4 str. E112/10]
 gb|EMS05077.1| heat shock chaperone [Escherichia coli O127:H27 str. C43/90]
 gb|EMU57788.1| small heat shock protein ibpA [Escherichia coli MP021552.7]
 gb|EMU57891.1| small heat shock protein ibpA [Escherichia coli MP021552.11]
 gb|EMU66819.1| small heat shock protein ibpA [Escherichia coli MP021552.12]
 gb|EMU73871.1| small heat shock protein ibpA [Escherichia coli MP021017.9]
 gb|EMU75501.1| small heat shock protein ibpA [Escherichia coli MP021017.6]
 gb|EMU77972.1| small heat shock protein ibpA [Escherichia coli MP021017.5]
 gb|EMU88973.1| small heat shock protein ibpA [Escherichia coli MP021017.4]
 gb|EMU89897.1| small heat shock protein ibpA [Escherichia coli MP021017.3]
 gb|EMU92362.1| small heat shock protein ibpA [Escherichia coli MP021017.2]
 gb|EMV04002.1| small heat shock protein ibpA [Escherichia coli MP021017.10]
 gb|EMV07587.1| small heat shock protein ibpA [Escherichia coli MP021017.11]
 gb|EMV13815.1| small heat shock protein ibpA [Escherichia coli MP021017.12]
 gb|EMV16167.1| small heat shock protein ibpA [Escherichia coli C-34666]
 gb|EMV17564.1| small heat shock protein ibpA [Escherichia coli BCE034_MS-14]
 gb|EMV30298.1| small heat shock protein ibpA [Escherichia coli BCE002_MS12]
 gb|EMV34985.1| small heat shock protein ibpA [Escherichia coli 2875000]
 gb|EMV36346.1| small heat shock protein ibpA [Escherichia coli BCE019_MS-13]
 gb|EMV43316.1| small heat shock protein ibpA [Escherichia coli 2872800]
 gb|EMV54736.1| small heat shock protein ibpA [Escherichia coli 2867750]
 gb|EMV68331.1| small heat shock protein ibpA [Escherichia coli 2866450]
 gb|EMV70784.1| small heat shock protein ibpA [Escherichia coli 2866750]
 gb|EMV82399.1| small heat shock protein ibpA [Escherichia coli 2861200]
 gb|EMV86658.1| small heat shock protein ibpA [Escherichia coli 2865200]
 gb|EMV89360.1| small heat shock protein ibpA [Escherichia coli 2860050]
 gb|EMV98316.1| small heat shock protein ibpA [Escherichia coli 2851500]
 gb|EMV98488.1| small heat shock protein ibpA [Escherichia coli 2853500]
 gb|EMW03332.1| small heat shock protein ibpA [Escherichia coli 2850750]
 gb|EMW14724.1| small heat shock protein ibpA [Escherichia coli 2850400]
 gb|EMW15678.1| small heat shock protein ibpA [Escherichia coli 2845650]
 gb|EMW18085.1| small heat shock protein ibpA [Escherichia coli 2848050]
 gb|EMW28121.1| small heat shock protein ibpA [Escherichia coli 2845350]
 gb|EMW32335.1| small heat shock protein ibpA [Escherichia coli 2785200]
 gb|EMW39539.1| small heat shock protein ibpA [Escherichia coli 2788150]
 gb|EMW45944.1| small heat shock protein ibpA [Escherichia coli 2780750]
 gb|EMW47842.1| small heat shock protein ibpA [Escherichia coli 2770900]
 gb|EMW53006.1| small heat shock protein ibpA [Escherichia coli 2762100]
 gb|EMW56959.1| small heat shock protein ibpA [Escherichia coli 2756500]
 gb|EMW65755.1| small heat shock protein ibpA [Escherichia coli 2749250]
 gb|EMW71137.1| small heat shock protein ibpA [Escherichia coli 2747800]
 gb|EMW73141.1| small heat shock protein ibpA [Escherichia coli 2731150]
 gb|EMW76326.1| small heat shock protein ibpA [Escherichia coli 180600]
 gb|EMW84039.1| small heat shock protein ibpA [Escherichia coli 180050]
 gb|EMW92003.1| small heat shock protein ibpA [Escherichia coli 174750]
 gb|EMW93319.1| small heat shock protein ibpA [Escherichia coli ThroopD]
 gb|EMW97310.1| small heat shock protein ibpA [Escherichia coli P0304777.1]
 gb|EMX10468.1| small heat shock protein ibpA [Escherichia coli P0302308.1]
 gb|EMX12010.1| small heat shock protein ibpA [Escherichia coli P0302293.2]
 gb|EMX17032.1| small heat shock protein ibpA [Escherichia coli P0301867.1]
 gb|EMX20743.1| small heat shock protein ibpA [Escherichia coli MP021566.1]
 gb|EMX28658.1| small heat shock protein ibpA [Escherichia coli MP021561.2]
 gb|EMX35108.1| small heat shock protein ibpA [Escherichia coli MP021552.8]
 gb|EMX36260.1| small heat shock protein ibpA [Escherichia coli MP021017.1]
 gb|EMX46055.1| small heat shock protein ibpA [Escherichia coli MP020980.2]
 gb|EMX46639.1| small heat shock protein ibpA [Escherichia coli Jurua 20/10]
 gb|EMX50267.1| small heat shock protein ibpA [Escherichia coli MP020940.1]
 gb|EMX60236.1| small heat shock protein ibpA [Escherichia coli Jurua 18/11]
 gb|EMX65017.1| small heat shock protein ibpA [Escherichia coli Envira 10/1]
 gb|EMX65138.1| small heat shock protein ibpA [Escherichia coli Envira 8/11]
 gb|EMX72828.1| small heat shock protein ibpA [Escherichia coli 2726800]
 gb|EMX82671.1| small heat shock protein ibpA [Escherichia coli 2719100]
 gb|EMX85491.1| small heat shock protein ibpA [Escherichia coli BCE001_MS16]
 gb|EMX89296.1| small heat shock protein ibpA [Escherichia coli 2720900]
 gb|EMZ40916.1| small heat shock protein ibpA [Escherichia coli SWW33]
 gb|EMZ60914.1| small heat shock protein ibpA [Escherichia coli 174900]
 gb|EMZ63704.1| small heat shock protein ibpA [Escherichia coli 2735000]
 gb|EMZ75240.1| small heat shock protein ibpA [Escherichia coli 199900.1]
 gb|EMZ76164.1| small heat shock protein ibpA [Escherichia coli 2722950]
 gb|EMZ80700.1| small heat shock protein ibpA [Escherichia coli p0305293.1]
 gb|EMZ90517.1| small heat shock protein ibpA [Escherichia coli P0305260.1]
 gb|EMZ94168.1| small heat shock protein ibpA [Escherichia coli P0304816.1]
 gb|ENA01347.1| small heat shock protein ibpA [Escherichia coli P0299438.2]
 gb|ENA02572.1| small heat shock protein ibpA [Escherichia coli P0299917.1]
 gb|ENA11223.1| small heat shock protein ibpA [Escherichia coli P0298942.1]
 gb|ENA13560.1| small heat shock protein ibpA [Escherichia coli BCE008_MS-13]
 gb|ENA17049.1| small heat shock protein ibpA [Escherichia coli 201600.1]
 gb|ENA27728.1| small heat shock protein ibpA [Escherichia coli BCE007_MS-11]
 gb|ENA35340.1| small heat shock protein ibpA [Escherichia coli P0301867.4]
 gb|ENA42324.1| small heat shock protein ibpA [Escherichia coli P0301867.2]
 gb|ENA48535.1| small heat shock protein ibpA [Escherichia coli 2726950]
 gb|ENA48809.1| small heat shock protein ibpA [Escherichia coli 2729250]
 gb|ENA57974.1| small heat shock protein ibpA [Escherichia coli 178900]
 gb|ENA59693.1| small heat shock protein ibpA [Escherichia coli 179550]
 gb|ENA63049.1| small heat shock protein ibpA [Escherichia coli 180200]
 gb|ENA74289.1| small heat shock protein ibpA [Escherichia coli 2730450]
 gb|ENA75778.1| small heat shock protein ibpA [Escherichia coli 2741950]
 gb|ENA76686.1| small heat shock protein ibpA [Escherichia coli 2730350]
 gb|ENA89413.1| small heat shock protein ibpA [Escherichia coli 2860650]
 gb|ENA90736.1| small heat shock protein ibpA [Escherichia coli 2862600]
 gb|ENA91653.1| small heat shock protein ibpA [Escherichia coli 2864350]
 gb|ENB04612.1| small heat shock protein ibpA [Escherichia coli 2866350]
 gb|ENB08318.1| small heat shock protein ibpA [Escherichia coli 2875150]
 gb|ENB09514.1| small heat shock protein ibpA [Escherichia coli BCE008_MS-01]
 gb|ENB18823.1| small heat shock protein ibpA [Escherichia coli BCE011_MS-01]
 gb|ENB24874.1| small heat shock protein ibpA [Escherichia coli BCE030_MS-09]
 gb|ENB30366.1| small heat shock protein ibpA [Escherichia coli BCE032_MS-12]
 gb|ENB32799.1| small heat shock protein ibpA [Escherichia coli MP021561.3]
 gb|ENB35762.1| small heat shock protein ibpA [Escherichia coli P0298942.10]
 gb|ENB45079.1| small heat shock protein ibpA [Escherichia coli P0298942.11]
 gb|ENB51233.1| small heat shock protein ibpA [Escherichia coli P0298942.14]
 gb|ENB53981.1| small heat shock protein ibpA [Escherichia coli P0298942.12]
 gb|ENB57551.1| small heat shock protein ibpA [Escherichia coli P0298942.15]
 gb|ENB57727.1| small heat shock protein ibpA [Escherichia coli P0298942.6]
 gb|ENB58396.1| small heat shock protein ibpA [Escherichia coli P0298942.2]
 gb|ENB72341.1| small heat shock protein ibpA [Escherichia coli P0298942.8]
 gb|ENB73861.1| small heat shock protein ibpA [Escherichia coli P0298942.9]
 gb|ENB74727.1| small heat shock protein ibpA [Escherichia coli P0298942.7]
 gb|ENB85453.1| small heat shock protein ibpA [Escherichia coli P0299438.10]
 gb|ENB92470.1| small heat shock protein ibpA [Escherichia coli P0299438.11]
 gb|ENC00216.1| small heat shock protein ibpA [Escherichia coli P0299438.4]
 gb|ENC07109.1| small heat shock protein ibpA [Escherichia coli P0299438.5]
 gb|ENC11406.1| small heat shock protein ibpA [Escherichia coli P0299438.6]
 gb|ENC12626.1| small heat shock protein ibpA [Escherichia coli P0299438.7]
 gb|ENC21242.1| small heat shock protein ibpA [Escherichia coli P0299438.8]
 gb|ENC28200.1| small heat shock protein ibpA [Escherichia coli P0299438.9]
 gb|ENC29555.1| small heat shock protein ibpA [Escherichia coli P02997067.6]
 gb|ENC37201.1| small heat shock protein ibpA [Escherichia coli P0299917.10]
 gb|ENC44278.1| small heat shock protein ibpA [Escherichia coli P0299917.2]
 gb|ENC50793.1| small heat shock protein ibpA [Escherichia coli P0299917.3]
 gb|ENC52668.1| small heat shock protein ibpA [Escherichia coli P0299917.4]
 gb|ENC57942.1| small heat shock protein ibpA [Escherichia coli P0299917.5]
 gb|ENC67540.1| small heat shock protein ibpA [Escherichia coli P0299917.6]
 gb|ENC67754.1| small heat shock protein ibpA [Escherichia coli P0299917.8]
 gb|ENC75282.1| small heat shock protein ibpA [Escherichia coli P0299917.7]
 gb|ENC80323.1| small heat shock protein ibpA [Escherichia coli P0299917.9]
 gb|ENC88735.1| small heat shock protein ibpA [Escherichia coli P0301867.11]
 gb|ENC88936.1| small heat shock protein ibpA [Escherichia coli P0301867.8]
 gb|ENC96267.1| small heat shock protein ibpA [Escherichia coli P0302308.10]
 gb|ENC99585.1| small heat shock protein ibpA [Escherichia coli P0302308.11]
 gb|END08181.1| small heat shock protein ibpA [Escherichia coli P0302308.3]
 gb|END11047.1| small heat shock protein ibpA [Escherichia coli P0302308.2]
 gb|END19812.1| small heat shock protein ibpA [Escherichia coli P0302308.5]
 gb|END20138.1| small heat shock protein ibpA [Escherichia coli P0302308.4]
 gb|END30316.1| small heat shock protein ibpA [Escherichia coli 179100]
 gb|END35063.1| small heat shock protein ibpA [Escherichia coli p0305293.13]
 gb|END37881.1| small heat shock protein ibpA [Escherichia coli 2733950]
 gb|END38101.1| small heat shock protein ibpA [Escherichia coli 2854350]
 gb|END49780.1| small heat shock protein ibpA [Escherichia coli MP020980.1]
 gb|END53778.1| small heat shock protein ibpA [Escherichia coli BCE006_MS-23]
 gb|END62522.1| small heat shock protein ibpA [Escherichia coli P0298942.4]
 gb|END62956.1| small heat shock protein ibpA [Escherichia coli P0298942.3]
 gb|END65229.1| small heat shock protein ibpA [Escherichia coli P0299483.1]
 gb|END76654.1| small heat shock protein ibpA [Escherichia coli P0299483.2]
 gb|END78985.1| small heat shock protein ibpA [Escherichia coli P0299483.3]
 gb|END87617.1| small heat shock protein ibpA [Escherichia coli P0301867.13]
 gb|END88784.1| small heat shock protein ibpA [Escherichia coli P0301904.3]
 gb|END95348.1| small heat shock protein ibpA [Escherichia coli P0302293.7]
 gb|ENE02022.1| small heat shock protein ibpA [Escherichia coli P0304799.3]
 gb|ENE04671.1| small heat shock protein ibpA [Escherichia coli P0305260.2]
 gb|ENE06483.1| small heat shock protein ibpA [Escherichia coli p0305293.14]
 gb|ENE17960.1| small heat shock protein ibpA [Escherichia coli P0302293.10]
 gb|ENE20079.1| small heat shock protein ibpA [Escherichia coli P0302293.3]
 gb|ENE27471.1| small heat shock protein ibpA [Escherichia coli P0302293.4]
 gb|ENE33878.1| small heat shock protein ibpA [Escherichia coli P0302293.6]
 gb|ENE38574.1| small heat shock protein ibpA [Escherichia coli P0302293.8]
 gb|ENE43055.1| small heat shock protein ibpA [Escherichia coli P0304777.10]
 gb|ENE47921.1| small heat shock protein ibpA [Escherichia coli P0302293.9]
 gb|ENE53998.1| small heat shock protein ibpA [Escherichia coli P0304777.11]
 gb|ENE60887.1| small heat shock protein ibpA [Escherichia coli P0304777.12]
 gb|ENE62552.1| small heat shock protein ibpA [Escherichia coli P0304777.13]
 gb|ENE67730.1| small heat shock protein ibpA [Escherichia coli P0304777.14]
 gb|ENE74033.1| small heat shock protein ibpA [Escherichia coli P0304777.15]
 gb|ENE77850.1| small heat shock protein ibpA [Escherichia coli P0304777.2]
 gb|ENE84157.1| small heat shock protein ibpA [Escherichia coli P0304777.3]
 gb|ENE91451.1| small heat shock protein ibpA [Escherichia coli P0304777.4]
 gb|ENE94982.1| small heat shock protein ibpA [Escherichia coli P0304777.5]
 gb|ENE98113.1| small heat shock protein ibpA [Escherichia coli P0304777.7]
 gb|ENF05969.1| small heat shock protein ibpA [Escherichia coli P0304777.8]
 gb|ENF09274.1| small heat shock protein ibpA [Escherichia coli P0304777.9]
 gb|ENF17251.1| small heat shock protein ibpA [Escherichia coli P0304816.11]
 gb|ENF21199.1| small heat shock protein ibpA [Escherichia coli P0304816.10]
 gb|ENF28185.1| small heat shock protein ibpA [Escherichia coli P0304816.12]
 gb|ENF31598.1| small heat shock protein ibpA [Escherichia coli P0304816.14]
 gb|ENF37533.1| small heat shock protein ibpA [Escherichia coli P0304816.13]
 gb|ENF43876.1| small heat shock protein ibpA [Escherichia coli P0304816.15]
 gb|ENF47517.1| small heat shock protein ibpA [Escherichia coli P0304816.2]
 gb|ENF47844.1| small heat shock protein ibpA [Escherichia coli P0304816.6]
 gb|ENF59927.1| small heat shock protein ibpA [Escherichia coli P0304816.7]
 gb|ENF65674.1| small heat shock protein ibpA [Escherichia coli P0304816.8]
 gb|ENF68132.1| small heat shock protein ibpA [Escherichia coli P0304816.9]
 gb|ENF71855.1| small heat shock protein ibpA [Escherichia coli P0305260.10]
 gb|ENF80130.1| small heat shock protein ibpA [Escherichia coli P0305260.11]
 gb|ENF82276.1| small heat shock protein ibpA [Escherichia coli P0305260.12]
 gb|ENF86855.1| small heat shock protein ibpA [Escherichia coli P0305260.13]
 gb|ENF94311.1| small heat shock protein ibpA [Escherichia coli P0305260.15]
 gb|ENF99097.1| small heat shock protein ibpA [Escherichia coli P0305260.3]
 gb|ENG00800.1| small heat shock protein ibpA [Escherichia coli P0305260.4]
 gb|ENG09638.1| small heat shock protein ibpA [Escherichia coli P0305260.5]
 gb|ENG12192.1| small heat shock protein ibpA [Escherichia coli P0305260.6]
 gb|ENG13133.1| small heat shock protein ibpA [Escherichia coli P0305260.7]
 gb|ENG22698.1| small heat shock protein ibpA [Escherichia coli P0305260.8]
 gb|ENG26907.1| small heat shock protein ibpA [Escherichia coli p0305293.10]
 gb|ENG30172.1| small heat shock protein ibpA [Escherichia coli P0305260.9]
 gb|ENG38358.1| small heat shock protein ibpA [Escherichia coli p0305293.11]
 gb|ENG40147.1| small heat shock protein ibpA [Escherichia coli p0305293.12]
 gb|ENG48929.1| small heat shock protein ibpA [Escherichia coli p0305293.15]
 gb|ENG52668.1| small heat shock protein ibpA [Escherichia coli p0305293.2]
 gb|ENG58270.1| small heat shock protein ibpA [Escherichia coli p0305293.3]
 gb|ENG60676.1| small heat shock protein ibpA [Escherichia coli p0305293.4]
 gb|ENG68628.1| small heat shock protein ibpA [Escherichia coli p0305293.8]
 gb|ENG75237.1| small heat shock protein ibpA [Escherichia coli p0305293.9]
 gb|ENG80684.1| small heat shock protein ibpA [Escherichia coli 178200]
 gb|ENG87605.1| small heat shock protein ibpA [Escherichia coli 178850]
 gb|ENG94234.1| small heat shock protein ibpA [Escherichia coli P0301867.3]
 gb|ENG98946.1| small heat shock protein ibpA [Escherichia coli P0301867.5]
 gb|ENH12617.1| small heat shock protein ibpA [Escherichia coli P0302308.13]
 gb|ENH14604.1| small heat shock protein ibpA [Escherichia coli P0302308.12]
 gb|ENH16762.1| small heat shock protein ibpA [Escherichia coli P0302308.14]
 gb|ENH29177.1| small heat shock protein ibpA [Escherichia coli P0304816.3]
 gb|ENH29351.1| small heat shock protein ibpA [Escherichia coli P0304816.4]
 gb|ENH36354.1| small heat shock protein ibpA [Escherichia coli P0304816.5]
 gb|ENH42466.1| small heat shock protein ibpA [Escherichia coli p0305293.5]
 gb|ENH49295.1| small heat shock protein ibpA [Escherichia coli p0305293.7]
 gb|ENH53430.1| small heat shock protein ibpA [Escherichia coli p0305293.6]
 gb|ENO08433.1| small heat shock protein A [Escherichia coli O157:H43 str. T22]
 gb|EOQ47480.1| small heat shock protein ibpA [Escherichia coli KTE33]
 gb|EOR54448.1| small heat shock protein A [Escherichia coli ATCC 25922]
 gb|EOU28299.1| small heat shock protein ibpA [Escherichia coli KTE7]
 gb|EOU29300.1| small heat shock protein ibpA [Escherichia coli KTE13]
 gb|EOU29522.1| small heat shock protein ibpA [Escherichia coli KTE3]
 gb|EOU41627.1| small heat shock protein ibpA [Escherichia coli KTE35]
 gb|EOU46714.1| small heat shock protein ibpA [Escherichia sp. KTE114]
 gb|EOU47592.1| small heat shock protein ibpA [Escherichia coli KTE231]
 gb|EOU55829.1| small heat shock protein ibpA [Escherichia coli KTE14]
 gb|EOU60343.1| small heat shock protein ibpA [Escherichia coli KTE19]
 gb|EOU62279.1| small heat shock protein ibpA [Escherichia coli KTE20]
 gb|EOU67623.1| small heat shock protein ibpA [Escherichia coli KTE24]
 gb|EOU73754.1| small heat shock protein ibpA [Escherichia coli KTE27]
 gb|EOU76504.1| small heat shock protein ibpA [Escherichia sp. KTE31]
 gb|EOU86588.1| small heat shock protein ibpA [Escherichia coli KTE36]
 gb|EOU86713.1| small heat shock protein ibpA [Escherichia coli KTE34]
 gb|EOU87183.1| small heat shock protein ibpA [Escherichia coli KTE37]
 gb|EOV01311.1| small heat shock protein ibpA [Escherichia coli KTE38]
 gb|EOV03804.1| small heat shock protein ibpA [Escherichia coli KTE195]
 gb|EOV03932.1| small heat shock protein ibpA [Escherichia coli KTE40]
 gb|EOV15242.1| small heat shock protein ibpA [Escherichia coli KTE198]
 gb|EOV19353.1| small heat shock protein ibpA [Escherichia coli KTE200]
 gb|EOV20851.1| small heat shock protein ibpA [Escherichia coli KTE199]
 gb|EOV31205.1| small heat shock protein ibpA [Escherichia coli KTE219]
 gb|EOV33433.1| small heat shock protein ibpA [Escherichia coli KTE221]
 gb|EOV41527.1| small heat shock protein ibpA [Escherichia coli KTE222]
 gb|EOV46408.1| small heat shock protein ibpA [Escherichia sp. KTE52]
 gb|EOV47520.1| small heat shock protein ibpA [Escherichia coli KTE61]
 gb|EOV53097.1| small heat shock protein ibpA [Escherichia coli KTE64]
 gb|EOV56988.1| small heat shock protein ibpA [Escherichia coli KTE68]
 gb|EOV60382.1| small heat shock protein ibpA [Escherichia coli KTE69]
 gb|EOV69285.1| small heat shock protein ibpA [Escherichia coli KTE70]
 gb|EOV71138.1| small heat shock protein ibpA [Escherichia coli KTE71]
 gb|EOV74698.1| small heat shock protein ibpA [Escherichia coli KTE73]
 gb|EOV84896.1| small heat shock protein ibpA [Escherichia coli KTE74]
 gb|EOV87092.1| small heat shock protein ibpA [Escherichia coli KTE89]
 gb|EOV92559.1| small heat shock protein ibpA [Escherichia sp. KTE96]
 gb|EOW02013.1| small heat shock protein ibpA [Escherichia coli KTE100]
 gb|EOW02228.1| small heat shock protein ibpA [Escherichia coli KTE98]
 gb|EOW09756.1| small heat shock protein ibpA [Escherichia coli KTE103]
 gb|EOW13919.1| small heat shock protein ibpA [Escherichia coli KTE102]
 gb|EOW26619.1| small heat shock protein ibpA [Escherichia coli KTE121]
 gb|EOW27910.1| small heat shock protein ibpA [Escherichia coli KTE108]
 gb|EOW31545.1| small heat shock protein ibpA [Escherichia coli KTE127]
 gb|EOW33508.1| small heat shock protein ibpA [Escherichia coli KTE126]
 gb|EOW56318.1| small heat shock protein ibpA [Escherichia coli KTE155]
 gb|EOW58900.1| small heat shock protein ibpA [Escherichia coli KTE134]
 gb|EOW59200.1| small heat shock protein ibpA [Escherichia sp. KTE159]
 gb|EOW63507.1| small heat shock protein ibpA [Escherichia coli KTE170]
 gb|EOW72526.1| small heat shock protein ibpA [Escherichia sp. KTE172]
 gb|EOW88359.1| small heat shock protein ibpA [Escherichia coli KTE1]
 gb|EOW88636.1| small heat shock protein ibpA [Escherichia coli KTE41]
 gb|EOW93645.1| small heat shock protein ibpA [Escherichia coli KTE182]
 gb|EOX05427.1| small heat shock protein ibpA [Escherichia coli KTE226]
 gb|EOX07856.1| small heat shock protein ibpA [Escherichia coli KTE240]
 gb|EOX15166.1| small heat shock protein ibpA [Escherichia coli KTE225]
 gb|EOX19859.1| small heat shock protein ibpA [Escherichia coli KTE185]
 gb|EOX28023.1| small heat shock protein ibpA [Escherichia coli KTE186]
 gb|EPH48850.1| 16 kDa heat shock protein A [Escherichia coli E2265]
 emb|CDC75582.1| small heat shock protein IbpA [Escherichia coli CAG:4]
 gb|EQM99552.1| small heat shock protein ibpA [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN02554.1| small heat shock protein ibpA [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN04820.1| small heat shock protein ibpA [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN14656.1| small heat shock protein ibpA [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN15657.1| small heat shock protein ibpA [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN22456.1| small heat shock protein ibpA [Escherichia coli HVH 6 (3-8296502)]
 gb|EQN29161.1| small heat shock protein ibpA [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN29477.1| small heat shock protein ibpA [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN37470.1| small heat shock protein ibpA [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN43361.1| small heat shock protein ibpA [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN45298.1| small heat shock protein ibpA [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN50530.1| small heat shock protein ibpA [Escherichia coli HVH 17 (4-7473087)]
 gb|EQN59152.1| small heat shock protein ibpA [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN61587.1| small heat shock protein ibpA [Escherichia coli HVH 18 (4-8589585)]
 gb|EQN66439.1| small heat shock protein ibpA [Escherichia coli HVH 19 (4-7154984)]
 gb|EQN72501.1| small heat shock protein ibpA [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN78699.1| small heat shock protein ibpA [Escherichia coli HVH 22 (4-2258986)]
 gb|EQN81894.1| small heat shock protein ibpA [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN89042.1| small heat shock protein ibpA [Escherichia coli HVH 25 (4-5851939)]
 gb|EQN89889.1| small heat shock protein ibpA [Escherichia coli HVH 26 (4-5703913)]
 gb|EQN92789.1| small heat shock protein ibpA [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO04765.1| small heat shock protein ibpA [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO05329.1| small heat shock protein ibpA [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO12892.1| small heat shock protein ibpA [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO13798.1| small heat shock protein ibpA [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO19688.1| small heat shock protein ibpA [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO25570.1| small heat shock protein ibpA [Escherichia coli HVH 33 (4-2174936)]
 gb|EQO28553.1| small heat shock protein ibpA [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO34903.1| small heat shock protein ibpA [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO39042.1| small heat shock protein ibpA [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO43517.1| small heat shock protein ibpA [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO49649.1| small heat shock protein ibpA [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO55752.1| small heat shock protein ibpA [Escherichia coli HVH 41 (4-2677849)]
 gb|EQO57713.1| small heat shock protein ibpA [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO75883.1| small heat shock protein ibpA [Escherichia coli HVH 45 (4-3129918)]
 gb|EQO81146.1| small heat shock protein ibpA [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO82415.1| small heat shock protein ibpA [Escherichia coli HVH 46 (4-2758776)]
 gb|EQO88806.1| small heat shock protein ibpA [Escherichia coli HVH 51 (4-2172526)]
 gb|EQO95551.1| small heat shock protein ibpA [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP04317.1| small heat shock protein ibpA [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP05041.1| small heat shock protein ibpA [Escherichia coli HVH 53 (4-0631051)]
 gb|EQP07040.1| small heat shock protein ibpA [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP14174.1| small heat shock protein ibpA [Escherichia coli HVH 59 (4-1119338)]
 gb|EQP17220.1| small heat shock protein ibpA [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP22267.1| small heat shock protein ibpA [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP30298.1| small heat shock protein ibpA [Escherichia coli HVH 65 (4-2262045)]
 gb|EQP31081.1| small heat shock protein ibpA [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP32183.1| small heat shock protein ibpA [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP44945.1| small heat shock protein ibpA [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP46894.1| small heat shock protein ibpA [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP47330.1| small heat shock protein ibpA [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP58992.1| small heat shock protein ibpA [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP65339.1| small heat shock protein ibpA [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP65807.1| small heat shock protein ibpA [Escherichia coli HVH 77 (4-2605759)]
 gb|EQP67906.1| small heat shock protein ibpA [Escherichia coli HVH 79 (4-2512823)]
 gb|EQP76043.1| small heat shock protein ibpA [Escherichia coli HVH 80 (4-2428830)]
 gb|EQP86636.1| small heat shock protein ibpA [Escherichia coli HVH 84 (4-1021478)]
 gb|EQP89602.1| small heat shock protein ibpA [Escherichia coli HVH 85 (4-0792144)]
 gb|EQP90785.1| small heat shock protein ibpA [Escherichia coli HVH 82 (4-2209276)]
 gb|EQP99658.1| small heat shock protein ibpA [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ00002.1| small heat shock protein ibpA [Escherichia coli HVH 87 (4-5977630)]
 gb|EQQ01827.1| small heat shock protein ibpA [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ11414.1| small heat shock protein ibpA [Escherichia coli HVH 90 (4-3191362)]
 gb|EQQ16582.1| small heat shock protein ibpA [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ20911.1| small heat shock protein ibpA [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ23535.1| small heat shock protein ibpA [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ35164.1| small heat shock protein ibpA [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ37143.1| small heat shock protein ibpA [Escherichia coli HVH 102
           (4-6906788)]
 gb|EQQ44594.1| small heat shock protein ibpA [Escherichia coli HVH 100
           (4-2850729)]
 gb|EQQ46439.1| small heat shock protein ibpA [Escherichia coli HVH 103
           (4-5904188)]
 gb|EQQ46802.1| small heat shock protein ibpA [Escherichia coli HVH 104
           (4-6977960)]
 gb|EQQ56761.1| small heat shock protein ibpA [Escherichia coli HVH 106
           (4-6881831)]
 gb|EQQ63791.1| small heat shock protein ibpA [Escherichia coli HVH 110
           (4-6978754)]
 gb|EQQ65389.1| small heat shock protein ibpA [Escherichia coli HVH 109
           (4-6977162)]
 gb|EQQ66261.1| small heat shock protein ibpA [Escherichia coli HVH 107
           (4-5860571)]
 gb|EQQ71130.1| small heat shock protein ibpA [Escherichia coli HVH 111
           (4-7039018)]
 gb|EQQ83808.1| small heat shock protein ibpA [Escherichia coli HVH 112
           (4-5987253)]
 gb|EQQ83906.1| small heat shock protein ibpA [Escherichia coli HVH 113
           (4-7535473)]
 gb|EQQ84614.1| small heat shock protein ibpA [Escherichia coli HVH 114
           (4-7037740)]
 gb|EQQ94316.1| small heat shock protein ibpA [Escherichia coli HVH 115
           (4-4465997)]
 gb|EQQ95541.1| small heat shock protein ibpA [Escherichia coli HVH 115
           (4-4465989)]
 gb|EQR04113.1| small heat shock protein ibpA [Escherichia coli HVH 116
           (4-6879942)]
 gb|EQR11918.1| small heat shock protein ibpA [Escherichia coli HVH 117
           (4-6857191)]
 gb|EQR14175.1| small heat shock protein ibpA [Escherichia coli HVH 118
           (4-7345399)]
 gb|EQR17642.1| small heat shock protein ibpA [Escherichia coli HVH 119
           (4-6879578)]
 gb|EQR30968.1| small heat shock protein ibpA [Escherichia coli HVH 122
           (4-6851606)]
 gb|EQR33041.1| small heat shock protein ibpA [Escherichia coli HVH 121
           (4-6877826)]
 gb|EQR39655.1| small heat shock protein ibpA [Escherichia coli HVH 125
           (4-2634716)]
 gb|EQR45047.1| small heat shock protein ibpA [Escherichia coli HVH 126
           (4-6034225)]
 gb|EQR50732.1| small heat shock protein ibpA [Escherichia coli HVH 127
           (4-7303629)]
 gb|EQR55872.1| small heat shock protein ibpA [Escherichia coli HVH 128
           (4-7030436)]
 gb|EQR58714.1| small heat shock protein ibpA [Escherichia coli HVH 130
           (4-7036876)]
 gb|EQR62046.1| small heat shock protein ibpA [Escherichia coli HVH 132
           (4-6876862)]
 gb|EQR72727.1| small heat shock protein ibpA [Escherichia coli HVH 135
           (4-4449320)]
 gb|EQR81396.1| small heat shock protein ibpA [Escherichia coli HVH 134
           (4-6073441)]
 gb|EQR83486.1| small heat shock protein ibpA [Escherichia coli HVH 133
           (4-4466519)]
 gb|EQR86105.1| small heat shock protein ibpA [Escherichia coli HVH 137
           (4-2124971)]
 gb|EQR91308.1| small heat shock protein ibpA [Escherichia coli HVH 138
           (4-6066704)]
 gb|EQR92518.1| small heat shock protein ibpA [Escherichia coli HVH 139
           (4-3192644)]
 gb|EQR99628.1| small heat shock protein ibpA [Escherichia coli HVH 140
           (4-5894387)]
 gb|EQS00650.1| small heat shock protein ibpA [Escherichia coli HVH 141
           (4-5995973)]
 gb|EQS10194.1| small heat shock protein ibpA [Escherichia coli HVH 143
           (4-5674999)]
 gb|EQS13867.1| small heat shock protein ibpA [Escherichia coli HVH 142
           (4-5627451)]
 gb|EQS14493.1| small heat shock protein ibpA [Escherichia coli HVH 144
           (4-4451937)]
 gb|EQS27243.1| small heat shock protein ibpA [Escherichia coli HVH 145
           (4-5672112)]
 gb|EQS29856.1| small heat shock protein ibpA [Escherichia coli HVH 147
           (4-5893887)]
 gb|EQS31010.1| small heat shock protein ibpA [Escherichia coli HVH 146
           (4-3189767)]
 gb|EQS35709.1| small heat shock protein ibpA [Escherichia coli HVH 149
           (4-4451880)]
 gb|EQS43984.1| small heat shock protein ibpA [Escherichia coli HVH 151
           (4-5755573)]
 gb|EQS46430.1| small heat shock protein ibpA [Escherichia coli HVH 153
           (3-9344314)]
 gb|EQS50909.1| small heat shock protein ibpA [Escherichia coli HVH 150
           (4-3258106)]
 gb|EQS58792.1| small heat shock protein ibpA [Escherichia coli HVH 158
           (4-3224287)]
 gb|EQS62423.1| small heat shock protein ibpA [Escherichia coli HVH 154
           (4-5636698)]
 gb|EQS71050.1| small heat shock protein ibpA [Escherichia coli HVH 161
           (4-3119890)]
 gb|EQS76655.1| small heat shock protein ibpA [Escherichia coli HVH 162
           (4-5627982)]
 gb|EQS79985.1| small heat shock protein ibpA [Escherichia coli HVH 163
           (4-4697553)]
 gb|EQS82122.1| small heat shock protein ibpA [Escherichia coli HVH 164
           (4-5953081)]
 gb|EQS84708.1| small heat shock protein ibpA [Escherichia coli HVH 167
           (4-6073565)]
 gb|EQS92982.1| small heat shock protein ibpA [Escherichia coli HVH 169
           (4-1075578)]
 gb|EQS95100.1| small heat shock protein ibpA [Escherichia coli HVH 171
           (4-3191958)]
 gb|EQS99535.1| small heat shock protein ibpA [Escherichia coli HVH 170
           (4-3026949)]
 gb|EQT07323.1| small heat shock protein ibpA [Escherichia coli HVH 172
           (4-3248542)]
 gb|EQT09930.1| small heat shock protein ibpA [Escherichia coli HVH 173
           (3-9175482)]
 gb|EQT19025.1| small heat shock protein ibpA [Escherichia coli HVH 176
           (4-3428664)]
 gb|EQT20223.1| small heat shock protein ibpA [Escherichia coli HVH 175
           (4-3405184)]
 gb|EQT24152.1| small heat shock protein ibpA [Escherichia coli HVH 180
           (4-3051617)]
 gb|EQT34372.1| small heat shock protein ibpA [Escherichia coli HVH 183
           (4-3205932)]
 gb|EQT41445.1| small heat shock protein ibpA [Escherichia coli HVH 184
           (4-3343286)]
 gb|EQT46294.1| small heat shock protein ibpA [Escherichia coli HVH 185
           (4-2876639)]
 gb|EQT51795.1| small heat shock protein ibpA [Escherichia coli HVH 187
           (4-4471660)]
 gb|EQT53151.1| small heat shock protein ibpA [Escherichia coli HVH 186
           (4-3405044)]
 gb|EQT57889.1| small heat shock protein ibpA [Escherichia coli HVH 188
           (4-2356988)]
 gb|EQT66222.1| small heat shock protein ibpA [Escherichia coli HVH 190
           (4-3255514)]
 gb|EQT73294.1| small heat shock protein ibpA [Escherichia coli HVH 189
           (4-3220125)]
 gb|EQT74046.1| small heat shock protein ibpA [Escherichia coli HVH 191
           (3-9341900)]
 gb|EQT79954.1| small heat shock protein ibpA [Escherichia coli HVH 192
           (4-3054470)]
 gb|EQT86177.1| small heat shock protein ibpA [Escherichia coli HVH 193
           (4-3331423)]
 gb|EQT90517.1| small heat shock protein ibpA [Escherichia coli HVH 195
           (3-7155360)]
 gb|EQT97699.1| small heat shock protein ibpA [Escherichia coli HVH 196
           (4-4530470)]
 gb|EQU00142.1| small heat shock protein ibpA [Escherichia coli HVH 194
           (4-2356805)]
 gb|EQU06905.1| small heat shock protein ibpA [Escherichia coli HVH 198
           (4-3206106)]
 gb|EQU07778.1| small heat shock protein ibpA [Escherichia coli HVH 199
           (4-5670322)]
 gb|EQU09554.1| small heat shock protein ibpA [Escherichia coli HVH 197
           (4-4466217)]
 gb|EQU18734.1| small heat shock protein ibpA [Escherichia coli HVH 200
           (4-4449924)]
 gb|EQU19571.1| small heat shock protein ibpA [Escherichia coli HVH 201
           (4-4459431)]
 gb|EQU29927.1| small heat shock protein ibpA [Escherichia coli HVH 202
           (4-3163997)]
 gb|EQU31267.1| small heat shock protein ibpA [Escherichia coli HVH 203
           (4-3126218)]
 gb|EQU37998.1| small heat shock protein ibpA [Escherichia coli HVH 204
           (4-3112802)]
 gb|EQU43737.1| small heat shock protein ibpA [Escherichia coli HVH 205
           (4-3094677)]
 gb|EQU46701.1| small heat shock protein ibpA [Escherichia coli HVH 206
           (4-3128229)]
 gb|EQU52272.1| small heat shock protein ibpA [Escherichia coli HVH 207
           (4-3113221)]
 gb|EQU57817.1| small heat shock protein ibpA [Escherichia coli HVH 208
           (4-3112292)]
 gb|EQU67255.1| small heat shock protein ibpA [Escherichia coli HVH 211
           (4-3041891)]
 gb|EQU69807.1| small heat shock protein ibpA [Escherichia coli HVH 212
           (3-9305343)]
 gb|EQU74351.1| small heat shock protein ibpA [Escherichia coli HVH 209
           (4-3062651)]
 gb|EQU76410.1| small heat shock protein ibpA [Escherichia coli HVH 213
           (4-3042928)]
 gb|EQU85724.1| small heat shock protein ibpA [Escherichia coli HVH 215
           (4-3008371)]
 gb|EQU89701.1| small heat shock protein ibpA [Escherichia coli HVH 217
           (4-1022806)]
 gb|EQU91397.1| small heat shock protein ibpA [Escherichia coli HVH 216
           (4-3042952)]
 gb|EQU97330.1| small heat shock protein ibpA [Escherichia coli HVH 218
           (4-4500903)]
 gb|EQV04289.1| small heat shock protein ibpA [Escherichia coli HVH 221
           (4-3136817)]
 gb|EQV05123.1| small heat shock protein ibpA [Escherichia coli HVH 220
           (4-5876842)]
 gb|EQV10565.1| small heat shock protein ibpA [Escherichia coli HVH 222
           (4-2977443)]
 gb|EQV18181.1| small heat shock protein ibpA [Escherichia coli HVH 223
           (4-2976528)]
 gb|EQV22289.1| small heat shock protein ibpA [Escherichia coli HVH 227
           (4-2277670)]
 gb|EQV22742.1| small heat shock protein ibpA [Escherichia coli HVH 225
           (4-1273116)]
 gb|EQV29926.1| small heat shock protein ibpA [Escherichia coli KOEGE 30 (63a)]
 gb|EQV42993.1| small heat shock protein ibpA [Escherichia coli KOEGE 33 (68a)]
 gb|EQV44833.1| small heat shock protein ibpA [Escherichia coli KOEGE 32 (66a)]
 gb|EQV50984.1| small heat shock protein ibpA [Escherichia coli KOEGE 43 (105a)]
 gb|EQV53947.1| small heat shock protein ibpA [Escherichia coli KOEGE 40 (102a)]
 gb|EQV54322.1| small heat shock protein ibpA [Escherichia coli KOEGE 44 (106a)]
 gb|EQV62593.1| small heat shock protein ibpA [Escherichia coli KOEGE 56 (169a)]
 gb|EQV64100.1| small heat shock protein ibpA [Escherichia coli KOEGE 61 (174a)]
 gb|EQV64198.1| small heat shock protein ibpA [Escherichia coli KOEGE 58 (171a)]
 gb|EQV76533.1| small heat shock protein ibpA [Escherichia coli KOEGE 68 (182a)]
 gb|EQV80008.1| small heat shock protein ibpA [Escherichia coli KOEGE 70 (185a)]
 gb|EQV80864.1| small heat shock protein ibpA [Escherichia coli KOEGE 62 (175a)]
 gb|EQV87926.1| small heat shock protein ibpA [Escherichia coli KOEGE 71 (186a)]
 gb|EQV96232.1| small heat shock protein ibpA [Escherichia coli KOEGE 77 (202a)]
 gb|EQV98334.1| small heat shock protein ibpA [Escherichia coli KOEGE 73 (195a)]
 gb|EQW09433.1| small heat shock protein ibpA [Escherichia coli KOEGE 131 (358a)]
 gb|EQW10206.1| small heat shock protein ibpA [Escherichia coli KOEGE 118 (317a)]
 gb|EQW14288.1| small heat shock protein ibpA [Escherichia coli UMEA 3014-1]
 gb|EQW15334.1| small heat shock protein ibpA [Escherichia coli UMEA 3022-1]
 gb|EQW25348.1| small heat shock protein ibpA [Escherichia coli UMEA 3033-1]
 gb|EQW27987.1| small heat shock protein ibpA [Escherichia coli UMEA 3041-1]
 gb|EQW28510.1| small heat shock protein ibpA [Escherichia coli UMEA 3052-1]
 gb|EQW38347.1| small heat shock protein ibpA [Escherichia coli UMEA 3053-1]
 gb|EQW40385.1| small heat shock protein ibpA [Escherichia coli UMEA 3065-1]
 gb|EQW48274.1| small heat shock protein ibpA [Escherichia coli UMEA 3087-1]
 gb|EQW52111.1| small heat shock protein ibpA [Escherichia coli UMEA 3097-1]
 gb|EQW57079.1| small heat shock protein ibpA [Escherichia coli UMEA 3088-1]
 gb|EQW62952.1| small heat shock protein ibpA [Escherichia coli UMEA 3113-1]
 gb|EQW63181.1| small heat shock protein ibpA [Escherichia coli UMEA 3108-1]
 gb|EQW72075.1| small heat shock protein ibpA [Escherichia coli UMEA 3117-1]
 gb|EQW74879.1| small heat shock protein ibpA [Escherichia coli UMEA 3121-1]
 gb|EQW80790.1| small heat shock protein ibpA [Escherichia coli UMEA 3122-1]
 gb|EQW83438.1| small heat shock protein ibpA [Escherichia coli UMEA 3124-1]
 gb|EQW88626.1| small heat shock protein ibpA [Escherichia coli UMEA 3139-1]
 gb|EQW98881.1| small heat shock protein ibpA [Escherichia coli UMEA 3152-1]
 gb|EQW99418.1| small heat shock protein ibpA [Escherichia coli UMEA 3140-1]
 gb|EQX07273.1| small heat shock protein ibpA [Escherichia coli UMEA 3159-1]
 gb|EQX07408.1| small heat shock protein ibpA [Escherichia coli UMEA 3155-1]
 gb|EQX12676.1| small heat shock protein ibpA [Escherichia coli UMEA 3160-1]
 gb|EQX15561.1| small heat shock protein ibpA [Escherichia coli UMEA 3161-1]
 gb|EQX24831.1| small heat shock protein ibpA [Escherichia coli UMEA 3162-1]
 gb|EQX28699.1| small heat shock protein ibpA [Escherichia coli UMEA 3163-1]
 gb|EQX29658.1| small heat shock protein ibpA [Escherichia coli UMEA 3172-1]
 gb|EQX38900.1| small heat shock protein ibpA [Escherichia coli UMEA 3173-1]
 gb|EQX40175.1| small heat shock protein ibpA [Escherichia coli UMEA 3175-1]
 gb|EQX48784.1| small heat shock protein ibpA [Escherichia coli UMEA 3174-1]
 gb|EQX52117.1| small heat shock protein ibpA [Escherichia coli UMEA 3176-1]
 gb|EQX52763.1| small heat shock protein ibpA [Escherichia coli UMEA 3178-1]
 gb|EQX62825.1| small heat shock protein ibpA [Escherichia coli UMEA 3185-1]
 gb|EQX65574.1| small heat shock protein ibpA [Escherichia coli UMEA 3180-1]
 gb|EQX72283.1| small heat shock protein ibpA [Escherichia coli UMEA 3193-1]
 gb|EQX75526.1| small heat shock protein ibpA [Escherichia coli UMEA 3190-1]
 gb|EQX80956.1| small heat shock protein ibpA [Escherichia coli UMEA 3199-1]
 gb|EQX83474.1| small heat shock protein ibpA [Escherichia coli UMEA 3200-1]
 gb|EQX92235.1| small heat shock protein ibpA [Escherichia coli UMEA 3201-1]
 gb|EQX96642.1| small heat shock protein ibpA [Escherichia coli UMEA 3203-1]
 gb|EQX97041.1| small heat shock protein ibpA [Escherichia coli UMEA 3206-1]
 gb|EQY07969.1| small heat shock protein ibpA [Escherichia coli UMEA 3208-1]
 gb|EQY10367.1| small heat shock protein ibpA [Escherichia coli UMEA 3215-1]
 gb|EQY13997.1| small heat shock protein ibpA [Escherichia coli UMEA 3212-1]
 gb|EQY19350.1| small heat shock protein ibpA [Escherichia coli UMEA 3216-1]
 gb|EQY25374.1| small heat shock protein ibpA [Escherichia coli UMEA 3217-1]
 gb|EQY29215.1| small heat shock protein ibpA [Escherichia coli UMEA 3220-1]
 gb|EQY36685.1| small heat shock protein ibpA [Escherichia coli UMEA 3221-1]
 gb|EQY38653.1| small heat shock protein ibpA [Escherichia coli UMEA 3222-1]
 gb|EQY39981.1| small heat shock protein ibpA [Escherichia coli UMEA 3230-1]
 gb|EQY51837.1| small heat shock protein ibpA [Escherichia coli UMEA 3244-1]
 gb|EQY52035.1| small heat shock protein ibpA [Escherichia coli UMEA 3233-1]
 gb|EQY56697.1| small heat shock protein ibpA [Escherichia coli UMEA 3240-1]
 gb|EQY64469.1| small heat shock protein ibpA [Escherichia coli UMEA 3264-1]
 gb|EQY67397.1| small heat shock protein ibpA [Escherichia coli UMEA 3257-1]
 gb|EQY72922.1| small heat shock protein ibpA [Escherichia coli UMEA 3268-1]
 gb|EQY80569.1| small heat shock protein ibpA [Escherichia coli UMEA 3304-1]
 gb|EQY83822.1| small heat shock protein ibpA [Escherichia coli UMEA 3314-1]
 gb|EQY90406.1| small heat shock protein ibpA [Escherichia coli UMEA 3317-1]
 gb|EQY94648.1| small heat shock protein ibpA [Escherichia coli UMEA 3329-1]
 gb|EQY95637.1| small heat shock protein ibpA [Escherichia coli UMEA 3318-1]
 gb|EQY97047.1| small heat shock protein ibpA [Escherichia coli UMEA 3337-1]
 gb|EQZ08366.1| small heat shock protein ibpA [Escherichia coli UMEA 3341-1]
 gb|EQZ09519.1| small heat shock protein ibpA [Escherichia coli UMEA 3355-1]
 gb|EQZ15049.1| small heat shock protein ibpA [Escherichia coli UMEA 3391-1]
 gb|EQZ20735.1| small heat shock protein ibpA [Escherichia coli UMEA 3490-1]
 gb|EQZ29892.1| small heat shock protein ibpA [Escherichia coli UMEA 3592-1]
 gb|EQZ30338.1| small heat shock protein ibpA [Escherichia coli UMEA 3585-1]
 gb|EQZ35287.1| small heat shock protein ibpA [Escherichia coli UMEA 3617-1]
 gb|EQZ35623.1| small heat shock protein ibpA [Escherichia coli UMEA 3609-1]
 gb|EQZ47664.1| small heat shock protein ibpA [Escherichia coli UMEA 3632-1]
 gb|EQZ49993.1| small heat shock protein ibpA [Escherichia coli UMEA 3656-1]
 gb|EQZ52504.1| small heat shock protein ibpA [Escherichia coli UMEA 3662-1]
 gb|EQZ61593.1| small heat shock protein ibpA [Escherichia coli UMEA 3682-1]
 gb|EQZ61929.1| small heat shock protein ibpA [Escherichia coli UMEA 3671-1]
 gb|EQZ62068.1| small heat shock protein ibpA [Escherichia coli UMEA 3687-1]
 gb|EQZ72421.1| small heat shock protein ibpA [Escherichia coli UMEA 3694-1]
 gb|EQZ74959.1| small heat shock protein ibpA [Escherichia coli UMEA 3702-1]
 gb|EQZ86231.1| small heat shock protein ibpA [Escherichia coli UMEA 3707-1]
 gb|EQZ87253.1| small heat shock protein ibpA [Escherichia coli UMEA 3703-1]
 gb|EQZ88188.1| small heat shock protein ibpA [Escherichia coli UMEA 3705-1]
 gb|EQZ96944.1| small heat shock protein ibpA [Escherichia coli UMEA 3718-1]
 gb|ERA02449.1| small heat shock protein ibpA [Escherichia coli UMEA 3805-1]
 gb|ERA05060.1| small heat shock protein ibpA [Escherichia coli UMEA 3821-1]
 gb|ERA14190.1| small heat shock protein ibpA [Escherichia coli UMEA 3889-1]
 gb|ERA16534.1| small heat shock protein ibpA [Escherichia coli UMEA 3834-1]
 gb|ERA17200.1| small heat shock protein ibpA [Escherichia coli UMEA 3893-1]
 gb|ERA30685.1| small heat shock protein ibpA [Escherichia coli UMEA 3955-1]
 gb|ERA30985.1| small heat shock protein ibpA [Escherichia coli UMEA 4075-1]
 gb|ERA35922.1| small heat shock protein ibpA [Escherichia coli UMEA 3899-1]
 gb|ERA42785.1| small heat shock protein ibpA [Escherichia coli UMEA 4207-1]
 gb|ERA45928.1| small heat shock protein ibpA [Escherichia coli UMEA 4076-1]
 gb|ERA61947.1| heat shock protein IbpA [Escherichia coli 95NR1]
 gb|ERA64467.1| small heat shock protein ibpA [Escherichia coli HVH 155
           (4-4509048)]
 gb|ERA68948.1| small heat shock protein ibpA [Escherichia coli HVH 156
           (4-3206505)]
 gb|ERA69454.1| small heat shock protein ibpA [Escherichia coli HVH 157
           (4-3406229)]
 gb|ERA74284.1| small heat shock protein ibpA [Escherichia coli HVH 159
           (4-5818141)]
 gb|ERA82610.1| small heat shock protein ibpA [Escherichia coli HVH 160
           (4-5695937)]
 gb|ERA86289.1| small heat shock protein ibpA [Escherichia coli HVH 210
           (4-3042480)]
 gb|ERA89430.1| small heat shock protein ibpA [Escherichia coli HVH 228
           (4-7787030)]
 gb|ERA97827.1| small heat shock protein ibpA [Escherichia coli KOEGE 3 (4a)]
 gb|ERB00614.1| small heat shock protein ibpA [Escherichia coli KOEGE 7 (16a)]
 gb|ERB02382.1| small heat shock protein ibpA [Escherichia coli KOEGE 10 (25a)]
 gb|ERB15266.1| small heat shock protein ibpA [Escherichia coli UMEA 3151-1]
 gb|ERB22857.1| small heat shock protein ibpA [Escherichia coli UMEA 3150-1]
 gb|ERB24788.1| small heat shock protein ibpA [Escherichia coli UMEA 3271-1]
 gb|ERB30944.1| small heat shock protein ibpA [Escherichia coli UMEA 3298-1]
 gb|ERB32043.1| small heat shock protein ibpA [Escherichia coli UMEA 3292-1]
 gb|ERB68680.1| small heat shock protein ibpA [Escherichia coli B107]
 gb|ERB69273.1| small heat shock protein ibpA [Escherichia coli B102]
 gb|ERB69983.1| small heat shock protein ibpA [Escherichia coli 09BKT076207]
 gb|ERB82458.1| small heat shock protein ibpA [Escherichia coli B26-1]
 gb|ERB86339.1| small heat shock protein ibpA [Escherichia coli B26-2]
 gb|ERB93565.1| small heat shock protein ibpA [Escherichia coli B28-1]
 gb|ERB94206.1| small heat shock protein ibpA [Escherichia coli B28-2]
 gb|ERC02984.1| small heat shock protein ibpA [Escherichia coli B29-1]
 gb|ERC10230.1| small heat shock protein ibpA [Escherichia coli B29-2]
 gb|ERC14497.1| small heat shock protein ibpA [Escherichia coli B36-1]
 gb|ERC18379.1| small heat shock protein ibpA [Escherichia coli B36-2]
 gb|ERC26420.1| small heat shock protein ibpA [Escherichia coli B7-1]
 gb|ERC31373.1| small heat shock protein ibpA [Escherichia coli B7-2]
 gb|ERC35791.1| small heat shock protein ibpA [Escherichia coli B93]
 gb|ERC41183.1| small heat shock protein ibpA [Escherichia coli B94]
 gb|ERC48985.1| small heat shock protein ibpA [Escherichia coli B95]
 gb|ERC54339.1| small heat shock protein ibpA [Escherichia coli TW07509]
 gb|ERC55764.1| small heat shock protein ibpA [Escherichia coli 08BKT055439]
 gb|ERC63055.1| small heat shock protein ibpA [Escherichia coli Bd5610_99]
 gb|ERC67394.1| small heat shock protein ibpA [Escherichia coli T1840_97]
 gb|ERC75548.1| small heat shock protein ibpA [Escherichia coli T234_00]
 gb|ERC79307.1| small heat shock protein ibpA [Escherichia coli 14A]
 gb|ERC82024.1| small heat shock protein ibpA [Escherichia coli T924_01]
 gb|ERC92292.1| small heat shock protein ibpA [Escherichia coli 2886-75]
 gb|ERC95550.1| small heat shock protein ibpA [Escherichia coli B103]
 gb|ERC95862.1| small heat shock protein ibpA [Escherichia coli B104]
 gb|ERD07178.1| small heat shock protein ibpA [Escherichia coli B105]
 gb|ERD11221.1| small heat shock protein ibpA [Escherichia coli B106]
 gb|ERD11596.1| small heat shock protein ibpA [Escherichia coli B108]
 gb|ERD23725.1| small heat shock protein ibpA [Escherichia coli B109]
 gb|ERD25729.1| small heat shock protein ibpA [Escherichia coli B112]
 gb|ERD29428.1| small heat shock protein ibpA [Escherichia coli B113]
 gb|ERD38340.1| small heat shock protein ibpA [Escherichia coli B114]
 gb|ERD41868.1| small heat shock protein ibpA [Escherichia coli B15]
 gb|ERD46630.1| small heat shock protein ibpA [Escherichia coli B17]
 gb|ERD56646.1| small heat shock protein ibpA [Escherichia coli B40-2]
 gb|ERD57954.1| small heat shock protein ibpA [Escherichia coli B40-1]
 gb|ERD60712.1| small heat shock protein ibpA [Escherichia coli B49-2]
 gb|ERD69739.1| small heat shock protein ibpA [Escherichia coli B5-2]
 gb|ERD74625.1| small heat shock protein ibpA [Escherichia coli B83]
 gb|ERD78032.1| small heat shock protein ibpA [Escherichia coli B84]
 gb|ERD85092.1| small heat shock protein ibpA [Escherichia coli B85]
 gb|ERD89486.1| small heat shock protein ibpA [Escherichia coli B86]
 gb|ERD99862.1| heat shock protein IbpA [Escherichia coli 95JB1]
 gb|ERE01306.1| small heat shock protein ibpA [Escherichia coli 08BKT77219]
 gb|ERE12005.1| small heat shock protein ibpA [Escherichia coli 09BKT024447]
 gb|ERE15368.1| small heat shock protein ibpA [Escherichia coli T1282_01]
 gb|ERE23562.1| small heat shock protein ibpA [Escherichia coli B89]
 gb|ERE25533.1| small heat shock protein ibpA [Escherichia coli B90]
 gb|ERE30518.1| small heat shock protein ibpA [Escherichia coli Tx1686]
 gb|ERE38514.1| small heat shock protein ibpA [Escherichia coli Tx3800]
 gb|ERF52110.1| small heat shock protein ibpA [Escherichia coli UMEA 3652-1]
 gb|ERF98116.1| heat shock protein IbpA [Escherichia coli O104:H21 str.
           CFSAN002237]
 gb|AGW10745.1| heat shock protein IbpA [Escherichia coli LY180]
 gb|AGX35637.1| heat shock chaperone [synthetic Escherichia coli C321.deltaA]
 gb|ERO92824.1| small heat shock protein ibpA [Escherichia coli BWH 24]
 gb|ERO98703.1| small heat shock protein ibpA [Escherichia coli BIDMC 19C]
 gb|ESA27979.1| 16 kDa heat shock protein A [Escherichia coli SCD1]
 gb|ESA28680.1| 16 kDa heat shock protein A [Escherichia coli SCD2]
 gb|ESA60788.1| small heat shock protein IbpA [Escherichia coli 110957]
 gb|ESA63295.1| small heat shock protein IbpA [Escherichia coli 113303]
 gb|ESA69788.1| small heat shock protein IbpA [Escherichia coli 113290]
 gb|ESA71725.1| small heat shock protein IbpA [Escherichia coli 907357]
 gb|ESA92970.1| small heat shock protein IbpA [Escherichia coli 909945-2]
 gb|ESA93066.1| small heat shock protein IbpA [Escherichia coli 907779]
 gb|ESA95427.1| small heat shock protein IbpA [Escherichia coli 907713]
 gb|ESC93564.1| small heat shock protein IbpA [Escherichia coli 907446]
 gb|ESC94512.1| small heat shock protein IbpA [Escherichia coli 113302]
 gb|ESD01920.1| small heat shock protein IbpA [Escherichia coli 907391]
 gb|ESD03051.1| small heat shock protein IbpA [Escherichia coli 907672]
 gb|ESD15473.1| small heat shock protein IbpA [Escherichia coli 907701]
 gb|ESD16435.1| small heat shock protein IbpA [Escherichia coli 907700]
 gb|ESD16518.1| small heat shock protein IbpA [Escherichia coli 907710]
 gb|ESD29656.1| small heat shock protein IbpA [Escherichia coli 907889]
 gb|ESD31280.1| small heat shock protein IbpA [Escherichia coli 907715]
 gb|ESD40436.1| small heat shock protein IbpA [Escherichia coli 908519]
 gb|ESD43272.1| small heat shock protein IbpA [Escherichia coli 907892]
 gb|ESD58413.1| small heat shock protein IbpA [Escherichia coli 908524]
 gb|ESD60257.1| small heat shock protein IbpA [Escherichia coli 908521]
 gb|ESD62296.1| small heat shock protein IbpA [Escherichia coli 908522]
 gb|ESD64657.1| small heat shock protein IbpA [Escherichia coli 908555]
 gb|ESD70214.1| small heat shock protein IbpA [Escherichia coli 908541]
 gb|ESD78964.1| small heat shock protein IbpA [Escherichia coli 908525]
 gb|ESD85140.1| small heat shock protein IbpA [Escherichia coli 908573]
 gb|ESD87310.1| small heat shock protein IbpA [Escherichia coli 908616]
 gb|ESD96570.1| small heat shock protein IbpA [Escherichia coli 908624]
 gb|ESD97014.1| small heat shock protein IbpA [Escherichia coli 908585]
 gb|ESE08728.1| small heat shock protein IbpA [Escherichia coli 908658]
 gb|ESE11475.1| small heat shock protein IbpA [Escherichia coli 908632]
 gb|ESE18450.1| small heat shock protein IbpA [Escherichia coli 908691]
 gb|ESE20025.1| small heat shock protein IbpA [Escherichia coli 908675]
 gb|ESE25275.1| small heat shock protein IbpA [Escherichia coli 910096-2]
 gb|ESE29219.1| small heat shock protein IbpA [Escherichia coli A25922R]
 gb|ESE37120.1| small heat shock protein IbpA [Escherichia coli A35218R]
 gb|AGY86359.1| heat shock protein IbpA [Escherichia coli JJ1886]
 gb|ESK00594.1| small heat shock protein ibpA [Escherichia coli HVH 98 (4-5799287)]
 gb|ESK03326.1| small heat shock protein ibpA [Escherichia coli UMEA 3336-1]
 gb|ESK12068.1| small heat shock protein ibpA [Escherichia coli UMEA 3426-1]
 gb|ESK14135.1| small heat shock protein ibpA [Escherichia coli UMEA 3290-1]
 gb|ESK17704.1| small heat shock protein ibpA [Escherichia coli HVH 50 (4-2593475)]
 gb|ESK25090.1| small heat shock protein ibpA [Escherichia coli UMEA 3693-1]
 gb|ESK25912.1| small heat shock protein ibpA [Escherichia coli UMEA 3342-1]
 gb|ESK31797.1| small heat shock protein ibpA [Escherichia coli UMEA 3323-1]
 gb|ESL18377.1| small heat shock protein ibpA [Escherichia coli BIDMC 39]
 gb|ESL32139.1| small heat shock protein ibpA [Escherichia coli BIDMC 38]
 gb|ESL32698.1| small heat shock protein ibpA [Escherichia coli BIDMC 37]
 gb|ESM31500.1| small heat shock protein ibpA [Escherichia coli BWH 32]
 gb|ESP06629.1| small heat shock protein ibpA [Escherichia coli HVH 36 (4-5675286)]
 gb|ESP14836.1| small heat shock protein ibpA [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP16362.1| small heat shock protein ibpA [Escherichia coli HVH 86 (4-7026218)]
 gb|ESP29153.1| small heat shock protein ibpA [Escherichia coli HVH 178
           (4-3189163)]
 gb|ESP32278.1| small heat shock protein ibpA [Escherichia coli HVH 152
           (4-3447545)]
 gb|ESP37009.1| small heat shock protein ibpA [Escherichia coli HVH 148
           (4-3192490)]
 gb|ESP41506.1| small heat shock protein ibpA [Escherichia coli HVH 108
           (4-6924867)]
 gb|ESP41732.1| small heat shock protein ibpA [Escherichia coli UMEA 3148-1]
 emb|CDJ73188.1| heat shock protein IbpA [Escherichia coli str. K-12 substr. MC4100]
 gb|ESS94647.1| 16 kDa heat shock protein A [Escherichia coli CE516]
 gb|ESS96773.1| 16 kDa heat shock protein A [Escherichia coli CE549]
 gb|EST00503.1| 16 kDa heat shock protein A [Escherichia coli CE418]
 gb|EST63849.1| heat shock protein IbpA [Escherichia coli ECC-Z]
 gb|EST64034.1| heat shock protein IbpA [Escherichia coli P4-96]
 gb|EST66484.1| heat shock protein IbpA [Escherichia coli P4-NR]
 gb|EST81399.1| heat shock protein IbpA [Escherichia coli ECA-727]
 gb|EST85626.1| heat shock protein IbpA [Escherichia coli ECC-1470]
 gb|EST88700.1| heat shock protein IbpA [Escherichia coli ECA-0157]
 gb|ESV06263.1| 16 kDa heat shock protein A [Escherichia coli E1777]
 gb|ETD47112.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2215]
 gb|ETD60641.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2209]
 gb|ETE09521.1| heat shock protein IbpA [Escherichia coli LAU-EC8]
 gb|ETE14254.1| heat shock protein IbpA [Escherichia coli LAU-EC6]
 gb|ETE24948.1| heat shock protein IbpA [Escherichia coli LAU-EC10]
 gb|ETE28255.1| heat shock protein IbpA [Escherichia coli LAU-EC7]
 gb|ETE38338.1| heat shock protein IbpA [Escherichia coli LAU-EC9]
 gb|ETF15829.1| small heat shock protein ibpA [Escherichia coli HVH 177
           (4-2876612)]
 gb|ETF21194.1| small heat shock protein ibpA [Escherichia coli HVH 23 (4-6066488)]
 gb|ETF26846.1| small heat shock protein ibpA [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF29671.1| small heat shock protein ibpA [Escherichia coli HVH 214
           (4-3062198)]
 gb|ETF34073.1| small heat shock protein ibpA [Escherichia coli UMEA 3489-1]
 gb|ETI71734.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2219]
 gb|ETI72598.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2196]
 gb|ETJ19730.1| Small heat shock protein IbpA [Escherichia coli DORA_A_5_14_21]
 gb|ETJ59878.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2193]
 gb|ETJ68916.1| heat shock protein IbpA [Escherichia coli ATCC 35150]
 gb|ETJ81074.1| heat shock protein IbpA [Escherichia coli ATCC BAA-2192]
 emb|CDK46108.1| 16 kDa heat shock protein A [Escherichia coli IS1]
 emb|CDK55455.1| 16 kDa heat shock protein A [Escherichia coli IS5]
 gb|AHE60117.1| heat shock protein IbpA [Escherichia albertii KF1]
 emb|CDK80674.1| 16 kDa heat shock protein A [Escherichia coli IS25]
 emb|CDL28337.1| 16 kDa heat shock protein A [Escherichia coli ISC7]
 emb|CDK79844.1| 16 kDa heat shock protein A [Klebsiella pneumoniae IS22]
 emb|CDK56618.1| 16 kDa heat shock protein A [Escherichia coli IS9]
 emb|CDL04486.1| 16 kDa heat shock protein A [Escherichia coli IS35]
 emb|CDK88682.1| 16 kDa heat shock protein A [Escherichia coli IS29]
 gb|ETS28548.1| heat shock protein IbpA [Escherichia coli O6:H16:CFA/II str. B2C]
 gb|AHG17156.1| 16 kDa heat shock protein A [Escherichia coli O145:H28 str.
           RM13516]
 gb|AHG11407.1| 16 kDa heat shock protein A [Escherichia coli O145:H28 str.
           RM13514]
 gb|ETX78455.1| small heat shock protein ibpA [Escherichia coli BIDMC 43b]
 gb|ETX86539.1| small heat shock protein ibpA [Escherichia coli BIDMC 43a]
 gb|ETX88274.1| small heat shock protein ibpA [Escherichia coli BIDMC 20B]
 gb|ETX91953.1| small heat shock protein ibpA [Escherichia coli BIDMC 20A]
 gb|ETX99645.1| small heat shock protein ibpA [Escherichia coli BIDMC 19B]
 gb|ETY06382.1| small heat shock protein ibpA [Escherichia coli BIDMC 19A]
 gb|ETY10977.1| small heat shock protein ibpA [Escherichia coli BIDMC 17B]
 gb|ETY17852.1| small heat shock protein ibpA [Escherichia coli BIDMC 17A]
 gb|ETY22851.1| small heat shock protein ibpA [Escherichia coli BIDMC 15]
 gb|ETY29089.1| small heat shock protein ibpA [Escherichia coli BIDMC 9]
 gb|ETY31315.1| small heat shock protein ibpA [Escherichia coli BIDMC 3]
 gb|ETY37165.1| small heat shock protein ibpA [Escherichia coli BIDMC 2B]
 gb|ETY40507.1| small heat shock protein ibpA [Escherichia coli BWH 40]
 gb|ETY47181.1| small heat shock protein ibpA [Escherichia coli BWH 34]
 gb|ETY54358.1| small heat shock protein ibpA [Escherichia coli BIDMC 49b]
 gb|ETY57812.1| small heat shock protein ibpA [Escherichia coli BIDMC 49a]
 gb|ETY63021.1| small heat shock protein ibpA [Escherichia coli BIDMC 6]
 emb|CDL44645.1| 16 kDa heat shock protein A [Escherichia coli ISC41]
 gb|EWC54390.1| small heat shock protein A [Escherichia coli EC096/10]
 gb|EWY55351.1| heat shock protein IbpA [Escherichia coli MP1]
 gb|AHM27926.1| heat shock protein IbpA [Escherichia coli]
 gb|AHM32452.1| heat shock protein IbpA [Escherichia coli]
 gb|AHM37014.1| heat shock protein IbpA [Escherichia coli]
 gb|AHM45950.1| heat shock protein IbpA [Escherichia coli]
 gb|AHM50553.1| heat shock protein IbpA [Escherichia coli]
 gb|AHM54991.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB47152.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB47227.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB49666.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB59283.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB60708.1| heat shock protein IbpA [Escherichia coli]
 gb|EYB62176.1| heat shock protein IbpA [Escherichia coli]
 gb|EYD79859.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S1_C1]
 gb|EYD80143.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S3_C1]
 gb|EYD81327.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S3_C2]
 gb|EYD94924.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S4_C3]
 gb|EYD96202.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S4_C2]
 gb|EYD98147.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S4_C1]
 gb|EYE10390.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S3_C3]
 gb|EYE17154.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S3_C2]
 gb|EYE17736.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S1_C3]
 gb|EYE19524.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S3_C1]
 gb|EYE32503.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S1_C1]
 gb|EYE34032.1| small heat shock protein ibpA [Escherichia coli 1-110-08_S1_C2]
 gb|EYT06936.1| small heat shock protein ibpA [Escherichia coli K02]
 gb|EYU76803.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-4254]
 gb|EYU81691.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU85728.1| heat shock protein IbpA [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU94615.1| heat shock protein IbpA [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU98233.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYU99738.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYV05766.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-3840]
 gb|EYV07738.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-3609]
 gb|EYV08877.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV20247.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV26111.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV26920.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV31643.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV38577.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV41940.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV45317.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV56530.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYV60705.1| heat shock protein IbpA [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYV62380.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV68068.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV78113.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2009EL1412]
 gb|EYV81371.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2009C-4659]
 gb|EYV83539.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5806]
 gb|EYV93578.1| heat shock protein IbpA [Escherichia coli O6:H16 str. 99-3165]
 gb|EYV94086.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F7350]
 gb|EYW04598.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2312]
 gb|EYW05748.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2289]
 gb|EYW09449.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2288]
 gb|EYW14221.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2114]
 gb|EYW16957.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2287]
 gb|EYW24964.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2286]
 gb|EYW29671.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2113]
 gb|EYW32694.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2112]
 gb|EYW41328.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2111]
 gb|EYW48430.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2108]
 gb|EYW51984.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2109]
 gb|EYW53669.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2107]
 gb|EYW61278.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2106]
 gb|EYW63192.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2105]
 gb|EYW71711.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2104]
 gb|EYW78599.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2103]
 gb|EYW79691.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2101]
 gb|EYW82063.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2099]
 gb|EYW88340.1| heat shock protein IbpA [Escherichia coli O111:NM str. 08-4487]
 gb|EYX00475.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX03133.1| heat shock protein IbpA [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX14548.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX15419.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX16753.1| heat shock protein IbpA [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX23779.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2098]
 gb|EYX24250.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2097]
 gb|EYX34550.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2096]
 gb|EYX38623.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2094]
 gb|EYX40215.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2093]
 gb|EYX50139.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2092]
 gb|EYX52557.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2091]
 gb|EYX59141.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2090]
 gb|EYX63203.1| heat shock protein IbpA [Escherichia coli O104:H4 str.
           2011EL-1675A]
 gb|EYX64927.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-1107]
 gb|EYX73923.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX75019.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX85001.1| heat shock protein IbpA [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYX88906.1| heat shock protein IbpA [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX94042.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYX96169.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3537]
 gb|EYY01933.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3500]
 gb|EYY06265.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY13885.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3216]
 gb|EYY16872.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY21251.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3108]
 gb|EYY26506.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3072]
 gb|EYY30077.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010EL1058]
 gb|EYY36367.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-4989]
 gb|EYY39981.1| heat shock protein IbpA [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYY50602.1| heat shock protein IbpA [Escherichia coli O157:H7 str.
           2010C-4979C1]
 gb|EYY51113.1| heat shock protein IbpA [Escherichia coli O165:H25 str. 2010C-4874]
 gb|EYY54035.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-4966]
 gb|EYY59441.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-4824]
 gb|EYY64128.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY70787.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY75370.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY83758.1| heat shock protein IbpA [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY85691.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY91035.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-4732]
 gb|EYY95073.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYY95654.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYZ05141.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ06544.1| heat shock protein IbpA [Escherichia coli O177:NM str. 2010C-4558]
 gb|EYZ11176.1| heat shock protein IbpA [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ14457.1| heat shock protein IbpA [Escherichia coli O103:H25 str. 2010C-4529]
 gb|EYZ14839.1| heat shock protein IbpA [Escherichia coli O145:NM str.
           2010C-4557C2]
 gb|EYZ28193.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ29052.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ33362.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ46292.1| heat shock protein IbpA [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ49348.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ50207.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ57123.1| heat shock protein IbpA [Escherichia coli O79:H7 str. 06-3501]
 gb|EYZ60331.1| heat shock protein IbpA [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ64001.1| heat shock protein IbpA [Escherichia coli O55:H7 str. 06-3555]
 gb|EYZ72854.1| heat shock protein IbpA [Escherichia coli O145:NM str. 06-3484]
 gb|EYZ74118.1| heat shock protein IbpA [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ80322.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 06-3003]
 gb|EYZ88948.1| heat shock protein IbpA [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ93003.1| heat shock protein IbpA [Escherichia coli O118:H16 str. 06-3256]
 gb|EYZ98291.1| heat shock protein IbpA [Escherichia coli O119:H4 str. 03-3458]
 gb|EYZ99130.1| heat shock protein IbpA [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA03450.1| heat shock protein IbpA [Escherichia coli O111:NM str. 03-3484]
 gb|EZA08293.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA14002.1| heat shock protein IbpA [Escherichia coli O81:NM str. 02-3012]
 gb|EZA23256.1| heat shock protein IbpA [Escherichia coli O28ac:NM str. 02-3404]
 gb|EZA24315.1| heat shock protein IbpA [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA28596.1| heat shock protein IbpA [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA35531.1| heat shock protein IbpA [Escherichia coli O174:H8 str. 04-3038]
 gb|EZA43635.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA63095.1| heat shock protein IbpA [Escherichia coli O104:H21 str. 94-3025]
 gb|EZA73323.1| heat shock protein IbpA [Escherichia coli O25:NM str. E2539C1]
 gb|EZA73407.1| heat shock protein IbpA [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA79782.1| heat shock protein IbpA [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA83360.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F6142]
 gb|EZA85774.1| heat shock protein IbpA [Escherichia coli O111:H8 str. F6627]
 gb|EZA91351.1| heat shock protein IbpA [Escherichia coli O121:H19 str. F6714]
 gb|EZA98267.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F6750]
 gb|EZB05042.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F6749]
 gb|EZB08038.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F6751]
 gb|EZB15606.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F7384]
 gb|EZB17444.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F7377]
 gb|EZB23236.1| heat shock protein IbpA [Escherichia coli O169:H41 str. F9792]
 gb|EZB24178.1| heat shock protein IbpA [Escherichia coli O157:H7 str. F7410]
 gb|EZB32577.1| heat shock protein IbpA [Escherichia coli O157:H7 str. G5303]
 gb|EZB43683.1| heat shock protein IbpA [Escherichia coli O157:H7 str. H2495]
 gb|EZB44181.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1420]
 gb|EZB47799.1| heat shock protein IbpA [Escherichia coli O157:H7 str. H2498]
 gb|EZB53106.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1793]
 gb|EZB55400.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1792]
 gb|EZB69929.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1795]
 gb|EZB71997.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1796]
 gb|EZB75336.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1845]
 gb|EZB83948.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1921]
 gb|EZB85822.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K1927]
 gb|EZB87037.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2188]
 gb|EZB97924.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2191]
 gb|EZC03154.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2324]
 gb|EZC05398.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2192]
 gb|EZC12524.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2581]
 gb|EZC17910.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2622]
 gb|EZC21603.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2845]
 gb|EZC23839.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K2854]
 gb|EZC31877.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K4406]
 gb|EZC32026.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K4406]
 gb|EZC33484.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K4396]
 gb|EZC36164.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K4405]
 gb|EZC46249.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K4527]
 gb|EZC50903.1| heat shock protein IbpA [Escherichia coli O121:H19 str. K5198]
 gb|EZC56376.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5418]
 gb|EZC62347.1| heat shock protein IbpA [Escherichia coli O121:H19 str. K5269]
 gb|EZC67060.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5448]
 gb|EZC73658.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5449]
 gb|EZC75043.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5453]
 gb|EZC81001.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5460]
 gb|EZC87768.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5467]
 gb|EZC91028.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5602]
 gb|EZC94110.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5609]
 gb|EZC95867.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5607]
 gb|EZD04899.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K5852]
 gb|EZD12112.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K6676]
 gb|EZD14362.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K6590]
 gb|EZD20084.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6723]
 gb|EZD22786.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K6687]
 gb|EZD33239.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6722]
 gb|EZD34551.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6890]
 gb|EZD38606.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6728]
 gb|EZD47119.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6895]
 gb|EZD53417.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6897]
 gb|EZD57073.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6904]
 gb|EZD59608.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6898]
 gb|EZD68078.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6908]
 gb|EZD69202.1| heat shock protein IbpA [Escherichia coli O111:NM str. K6915]
 gb|EZD73783.1| heat shock protein IbpA [Escherichia coli O157:H7 str. K7140]
 gb|EZD80887.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD85743.1| heat shock protein IbpA [Escherichia coli O39:NM str. F8704-2]
 gb|EZD87540.1| heat shock protein IbpA [Escherichia coli O157:NM str. 08-4540]
 gb|EZD95367.1| heat shock protein IbpA [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZD98794.1| heat shock protein IbpA [Escherichia coli O145:H28 str. 2009C-3292]
 gb|EZE00779.1| heat shock protein IbpA [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE09830.1| heat shock protein IbpA [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE12489.1| heat shock protein IbpA [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE19432.1| heat shock protein IbpA [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE24119.1| heat shock protein IbpA [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE31678.1| heat shock protein IbpA [Escherichia coli O123:H11 str. 2009C-3307]
 gb|EZE35251.1| heat shock protein IbpA [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE40890.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE43072.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2009C-4050]
 gb|EZE49386.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE57037.1| heat shock protein IbpA [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZE60425.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE67028.1| heat shock protein IbpA [Escherichia coli O91:H21 str. 2009C-4646]
 gb|EZE70760.1| heat shock protein IbpA [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE73117.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2009C-4750]
 gb|EZE81416.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZE84432.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2009EL1302]
 gb|EZE84756.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZE93328.1| heat shock protein IbpA [Escherichia coli O145:NM str. 2010C-3508]
 gb|EZE97553.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2010C-3794]
 gb|EZF06376.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2313]
 gb|EZF06707.1| heat shock protein IbpA [Escherichia coli O157:H7 str. 2011EL-2290]
 gb|EZG33727.1| heat shock protein IbpA [Escherichia coli E1728]
 gb|EZG46558.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG48510.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG58955.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG62777.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG71101.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG75920.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG81003.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG87907.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG96117.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZH01684.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZH02303.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3506]
 gb|EZH10648.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH10976.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH18174.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH22246.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH23616.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH28029.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH35921.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH39661.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH43450.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH54888.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH55285.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZJ16591.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ18606.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ26373.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ33727.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ35069.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ38471.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ48230.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S4_C2]
 gb|EZJ51278.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ58973.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S4_C1]
 gb|EZJ66676.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S3_C3]
 gb|EZJ66804.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S4_C1]
 gb|EZJ68066.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ80383.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S3_C2]
 gb|EZJ82203.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S3_C1]
 gb|EZJ88694.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S3_C1]
 gb|EZJ92636.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S1_C3]
 gb|EZK05527.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S1_C3]
 gb|EZK11448.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S1_C3]
 gb|EZK14721.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S1_C2]
 gb|EZK18050.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S1_C2]
 gb|EZK27220.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S1_C1]
 gb|EZK28038.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S1_C2]
 gb|EZK36977.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ27682.1| heat shock protein IbpA [Escherichia coli O111:H8 str. 2009EL-2169]
 gb|EZQ28046.1| heat shock protein IbpA [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ33629.1| heat shock protein IbpA [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ36552.1| heat shock protein IbpA [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ45043.1| heat shock protein IbpA [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ45680.1| heat shock protein IbpA [Escherichia coli O111:H8 str. 2011C-3453]
 gb|EZQ53211.1| heat shock protein IbpA [Escherichia coli O157: str. 2010EL-2044]
 gb|EZQ59219.1| small heat shock protein ibpA [Escherichia coli BIDMC 83]
 gb|EZQ61488.1| small heat shock protein ibpA [Escherichia coli BIDMC 82]
 gb|AHY67479.1| 16 kDa heat shock protein A [Escherichia coli O145:H28 str.
           RM12761]
 gb|AHY73229.1| 16 kDa heat shock protein A [Escherichia coli O145:H28 str.
           RM12581]
 gb|KCW96437.1| heat shock protein IbpA [Escherichia coli]
 gb|KDA55801.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S1_C1]
 gb|KDA61603.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S1_C1]
 gb|KDA66609.1| small heat shock protein ibpA [Escherichia coli 1-182-04_S1_C2]
 gb|KDA71485.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S3_C2]
 gb|KDA77734.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S3_C2]
 gb|KDA82820.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S3_C3]
 gb|KDA88048.1| small heat shock protein ibpA [Escherichia coli 1-176-05_S4_C2]
 emb|CDP74501.1| Small heat shock protein IbpA [Escherichia coli]
 emb|CDP67771.1| Small heat shock protein IbpA [Escherichia coli D6-113.11]
 emb|CDP76868.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
 gb|KDF65235.1| small heat shock protein ibpA [Escherichia coli BIDMC 59]
 gb|KDF72356.1| small heat shock protein ibpA [Escherichia coli BIDMC 58]
 gb|KDF83794.1| small heat shock protein ibpA [Escherichia coli BIDMC 62]
 gb|KDF84841.1| small heat shock protein ibpA [Escherichia coli BIDMC 64]
 gb|KDF85695.1| small heat shock protein ibpA [Escherichia coli BIDMC 63]
 gb|KDF94290.1| small heat shock protein ibpA [Escherichia coli BIDMC 65]
 gb|KDG00471.1| small heat shock protein ibpA [Escherichia coli BIDMC 70]
 gb|KDG04582.1| small heat shock protein ibpA [Escherichia coli BIDMC 72]
 gb|KDG04680.1| small heat shock protein ibpA [Escherichia coli BIDMC 71]
 gb|KDG14581.1| small heat shock protein ibpA [Escherichia coli BIDMC 73]
 gb|KDG19178.1| small heat shock protein ibpA [Escherichia coli BIDMC 74]
 gb|KDG25476.1| small heat shock protein ibpA [Escherichia coli BIDMC 76]
 gb|KDG26041.1| small heat shock protein ibpA [Escherichia coli BIDMC 75]
 gb|KDG38362.1| small heat shock protein ibpA [Escherichia coli BIDMC 77]
 gb|KDG39348.1| small heat shock protein ibpA [Escherichia coli BIDMC 78]
 gb|KDG43485.1| small heat shock protein ibpA [Escherichia coli BIDMC 79]
 gb|KDG45668.1| small heat shock protein ibpA [Escherichia coli CHS 68]
 gb|KDG56722.1| small heat shock protein ibpA [Escherichia coli CHS 77]
 gb|KDG57758.1| small heat shock protein ibpA [Escherichia coli CHS 69]
 gb|KDG62859.1| small heat shock protein ibpA [Escherichia coli MGH 57]
 gb|KDG69137.1| small heat shock protein ibpA [Escherichia coli UCI 51]
 gb|KDG70556.1| small heat shock protein ibpA [Escherichia coli MGH 58]
 gb|KDG74112.1| small heat shock protein ibpA [Escherichia coli UCI 53]
 gb|KDG82187.1| small heat shock protein ibpA [Escherichia coli UCI 57]
 gb|KDG83477.1| small heat shock protein ibpA [Escherichia coli UCI 58]
 gb|KDG90274.1| small heat shock protein ibpA [Escherichia coli UCI 65]
 gb|KDG93793.1| small heat shock protein ibpA [Escherichia coli UCI 66]
 gb|KDM71537.1| heat shock protein IbpA [Escherichia coli]
 gb|KDM76907.1| heat shock protein IbpA [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM80821.1| heat shock protein IbpA [Escherichia coli]
 gb|KDM87706.1| heat shock protein IbpA [Escherichia coli]
 gb|KDN09192.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|KDO88465.1| heat shock protein IbpA [Escherichia coli]
 gb|KDP17421.1| heat shock protein IbpA [Escherichia coli]
 gb|KDS96097.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S3_C1]
 gb|KDS96328.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S1_C3]
 gb|KDT01565.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S4_C1]
 gb|KDT10407.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S1_C3]
 gb|KDT14395.1| small heat shock protein ibpA [Escherichia coli 2-011-08_S4_C3]
 gb|KDT15830.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S3_C1]
 gb|KDT25154.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S4_C1]
 gb|KDT35191.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S3_C1]
 gb|KDT37990.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S1_C1]
 gb|KDT42224.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S4_C2]
 gb|KDT47995.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S3_C2]
 gb|KDT53994.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S4_C3]
 gb|KDT62943.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S1_C3]
 gb|KDT66194.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S3_C1]
 gb|KDT69673.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S3_C1]
 gb|KDT73719.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S3_C3]
 gb|KDT80077.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S1_C2]
 gb|KDT83686.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S4_C1]
 gb|KDT91074.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S1_C1]
 gb|KDT94394.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S4_C1]
 gb|KDT97295.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S3_C2]
 gb|KDU03576.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S1_C2]
 gb|KDU10623.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S3_C2]
 gb|KDU16307.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S3_C3]
 gb|KDU20106.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S1_C1]
 gb|KDU24106.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S4_C2]
 gb|KDU29685.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S4_C2]
 gb|KDU38935.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S4_C1]
 gb|KDU40437.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S1_C3]
 gb|KDU46239.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S1_C1]
 gb|KDU51438.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S4_C1]
 gb|KDU59405.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S4_C2]
 gb|KDU61479.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S1_C1]
 gb|KDU68657.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S4_C3]
 gb|KDV16473.1| heat shock protein IbpA [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV16971.1| heat shock protein IbpA [Escherichia coli O111:NM str. 01-3076]
 gb|KDV33244.1| heat shock protein IbpA [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV37297.1| heat shock protein IbpA [Escherichia coli O145:H25 str. 07-3858]
 gb|KDV40588.1| heat shock protein IbpA [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV45494.1| heat shock protein IbpA [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDV54115.1| heat shock protein IbpA [Escherichia coli O121:H19 str. 2011C-3609]
 gb|KDV58958.1| heat shock protein IbpA [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV62839.1| heat shock protein IbpA [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV68247.1| heat shock protein IbpA [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDV73906.1| heat shock protein IbpA [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV78956.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S4_C2]
 gb|KDV79130.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S4_C3]
 gb|KDV79477.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S3_C3]
 gb|KDV98315.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S3_C1]
 gb|KDV98494.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S1_C3]
 gb|KDW04676.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S3_C3]
 gb|KDW12993.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S3_C1]
 gb|KDW15200.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S1_C1]
 gb|KDW15442.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S4_C1]
 gb|KDW28274.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S3_C2]
 gb|KDW28363.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S1_C2]
 gb|KDW37597.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S1_C3]
 gb|KDW44190.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S4_C2]
 gb|KDW52408.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S1_C3]
 gb|KDW58940.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S3_C1]
 gb|KDW63193.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S3_C2]
 gb|KDW67126.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S3_C3]
 gb|KDW75115.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S1_C1]
 gb|KDW79681.1| small heat shock protein ibpA [Escherichia coli 2-005-03_S4_C1]
 gb|KDW82716.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S1_C2]
 gb|KDW87870.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S4_C1]
 gb|KDW94216.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S1_C2]
 gb|KDX00338.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S3_C2]
 gb|KDX07129.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S3_C1]
 gb|KDX08209.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S4_C3]
 gb|KDX21473.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S3_C3]
 gb|KDX23121.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S4_C2]
 gb|KDX38610.1| small heat shock protein ibpA [Escherichia coli 2-156-04_S4_C3]
 gb|KDX44978.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S3_C2]
 gb|KDX51573.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S4_C1]
 gb|KDX54379.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S3_C1]
 gb|KDX60082.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S4_C2]
 gb|KDX66236.1| small heat shock protein ibpA [Escherichia coli 2-210-07_S4_C3]
 gb|KDX67382.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S1_C1]
 gb|KDX74507.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S1_C2]
 gb|KDX79893.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S1_C3]
 gb|KDX85531.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S3_C3]
 gb|KDX91241.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S4_C2]
 gb|KDX96169.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S3_C1]
 gb|KDY01713.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S3_C2]
 gb|KDY06377.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S3_C3]
 gb|KDY10643.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S4_C1]
 gb|KDY16800.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S4_C3]
 gb|KDY17784.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S4_C2]
 gb|KDY26955.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S1_C2]
 gb|KDY30066.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S3_C3]
 gb|KDY32403.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S3_C1]
 gb|KDY43411.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S4_C1]
 gb|KDY47194.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S4_C2]
 gb|KDY52717.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S3_C1]
 gb|KDY63574.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S3_C3]
 gb|KDY70042.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S4_C2]
 gb|KDY76826.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S4_C3]
 gb|KDY81193.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S1_C1]
 gb|KDY90700.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S3_C1]
 gb|KDY93210.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S1_C3]
 gb|KDY98138.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ01423.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ06580.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ13407.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ19102.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ22040.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ26566.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ31914.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ39757.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ42955.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ49018.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S4_C3]
 gb|KDZ52026.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S1_C1]
 gb|KDZ62893.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ70299.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ70379.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ76983.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S4_C2]
 gb|KDZ84414.1| small heat shock protein ibpA [Escherichia coli 3-073-06_S4_C3]
 gb|KDZ84454.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ93523.1| small heat shock protein ibpA [Escherichia coli 3-105-05_S1_C3]
 gb|KDZ95672.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ06199.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ07127.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S1_C2]
 gb|KEJ07268.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ21415.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ22533.1| small heat shock protein ibpA [Escherichia coli 2-316-03_S1_C2]
 gb|KEJ27437.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S4_C3]
 gb|KEJ37648.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ44022.1| small heat shock protein ibpA [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ47018.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ54753.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S4_C1]
 gb|KEJ57282.1| small heat shock protein ibpA [Escherichia coli 3-267-03_S4_C1]
 gb|KEJ65588.1| small heat shock protein ibpA [Escherichia coli 3-020-07_S3_C2]
 gb|KEJ71889.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S1_C3]
 gb|KEJ74604.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S3_C2]
 gb|KEK77389.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S3_C1]
 gb|KEK80630.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S3_C2]
 gb|KEK81728.1| small heat shock protein ibpA [Escherichia coli 3-475-03_S1_C2]
 gb|KEK93292.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S1_C2]
 gb|KEK98836.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S1_C3]
 gb|KEL01267.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S3_C3]
 gb|KEL11511.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S3_C2]
 gb|KEL12382.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S4_C2]
 gb|KEL18696.1| small heat shock protein ibpA [Escherichia coli 4-203-08_S3_C1]
 gb|KEL23602.1| small heat shock protein ibpA [Escherichia coli 3-373-03_S4_C3]
 gb|KEL26744.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S4_C2]
 gb|KEL33495.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S4_C2]
 gb|KEL37586.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S4_C1]
 gb|KEL44465.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S3_C3]
 gb|KEL52403.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S1_C1]
 gb|KEL55530.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S3_C1]
 gb|KEL59147.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S1_C3]
 gb|KEL59637.1| small heat shock protein ibpA [Escherichia coli 5-172-05_S4_C3]
 gb|KEL68238.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S1_C1]
 gb|KEL72628.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S3_C3]
 gb|KEL83930.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S3_C2]
 gb|KEL89354.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S3_C1]
 gb|KEL90730.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S3_C1]
 gb|KEL98355.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S3_C3]
 gb|KEM01291.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S4_C2]
 gb|KEM02349.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S4_C1]
 gb|KEM10032.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S1_C2]
 gb|KEM19210.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S3_C1]
 gb|KEM23417.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S1_C3]
 gb|KEM27367.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S3_C2]
 gb|KEM27509.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S4_C2]
 gb|KEM37803.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S1_C1]
 gb|KEM45645.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S4_C3]
 gb|KEM49809.1| small heat shock protein ibpA [Escherichia coli 6-175-07_S1_C3]
 gb|KEM56535.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S4_C3]
 gb|KEM58625.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S3_C3]
 gb|KEM59265.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S1_C2]
 gb|KEM69431.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S3_C1]
 gb|KEM73386.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S3_C1]
 gb|KEM81315.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S3_C3]
 gb|KEM86896.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S4_C1]
 gb|KEM88261.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S4_C1]
 gb|KEM97478.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S1_C3]
 gb|KEM98455.1| small heat shock protein ibpA [Escherichia coli 6-319-05_S1_C1]
 gb|KEM98815.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S3_C3]
 gb|KEN10213.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S4_C2]
 gb|KEN14609.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S3_C2]
 gb|KEN20559.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S3_C2]
 gb|KEN21266.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S1_C1]
 gb|KEN31113.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S3_C3]
 gb|KEN37293.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S3_C1]
 gb|KEN39194.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S4_C1]
 gb|KEN44525.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S1_C2]
 gb|KEN51590.1| small heat shock protein ibpA [Escherichia coli 7-233-03_S4_C3]
 gb|KEN59997.1| small heat shock protein ibpA [Escherichia coli 6-537-08_S4_C2]
 gb|KEN63964.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S4_C3]
 gb|KEN69210.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S3_C2]
 gb|KEN73115.1| small heat shock protein ibpA [Escherichia coli 2-052-05_S3_C2]
 gb|KEN82771.1| small heat shock protein ibpA [Escherichia coli 2-474-04_S4_C1]
 gb|KEN86389.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S3_C1]
 gb|KEN94489.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S3_C2]
 gb|KEN96681.1| small heat shock protein ibpA [Escherichia coli 1-392-07_S4_C1]
 gb|KEO06093.1| small heat shock protein ibpA [Escherichia coli 8-415-05_S1_C2]
 gb|KEO06397.1| small heat shock protein ibpA [Escherichia coli 2-177-06_S3_C3]
 gb|KEO13051.1| small heat shock protein ibpA [Escherichia coli 2-222-05_S4_C3]
 gb|KEO21336.1| small heat shock protein ibpA [Escherichia coli 5-366-08_S4_C1]
 gb|KEO26294.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S1_C1]
 gb|KEO27304.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S3_C2]
 gb|KEO36712.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S1_C2]
 gb|AID80854.1| heat shock protein IbpA [Escherichia coli Nissle 1917]
 gb|KEO95960.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP01183.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP03362.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP08601.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP15739.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP16351.1| heat shock protein IbpA [Escherichia coli]
 gb|KEP77382.1| heat shock protein IbpA [Escherichia coli E1140]
 gb|AIF38973.1| heat shock protein IbpA [Escherichia coli KLY]
 gb|AIF63000.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia coli B7A]
 emb|CDU34962.1| Small heat shock protein IbpA [Escherichia coli D6-113.11]
 emb|CDU41692.1| Small heat shock protein IbpA [Escherichia coli]
 gb|AIF96323.1| heat shock protein A [Escherichia coli O157:H7 str. SS17]
 gb|AIG71155.1| 16 kDa heat shock protein A [Escherichia coli O157:H7 str. EDL933]
 gb|KFB97351.1| heat shock protein A [Escherichia coli DSM 30083 = JCM 1649 = ATCC
           11775]
 gb|KFD78443.1| heat shock protein IbpA [Escherichia coli]
 gb|KFF38951.1| heat shock protein IbpA [Escherichia coli]
 gb|KFF53801.1| heat shock protein IbpA [Escherichia coli]
 gb|KFH75547.1| heat shock protein IbpA [Escherichia coli]
 gb|KFH82786.1| heat shock protein IbpA [Escherichia coli]
 gb|KFH91997.1| heat shock protein IbpA [Escherichia coli]
 gb|KFH94859.1| heat shock protein IbpA [Escherichia coli]
 gb|AIL15404.1| small heat shock protein ibpA [Escherichia coli ATCC 25922]
 gb|AIL38111.1| inclusion body protein A - yellow fluorescent protein fusion
           [Shigella flexneri 2003036]
 gb|AIL43051.1| inclusion body protein A - yellow fluorescent protein fusion
           [Shigella flexneri Shi06HN006]
 gb|KFV23760.1| heat shock protein IbpA [Escherichia coli]
 gb|KFV31138.1| heat shock protein IbpA [Escherichia coli]
 gb|KFV31712.1| heat shock protein IbpA [Escherichia coli]
 gb|KFV37884.1| heat shock protein IbpA [Escherichia coli]
 emb|CEE03414.1| small heat shock protein ibpA [Escherichia coli]
 gb|AIN34011.1| heat shock chaperone [Escherichia coli BW25113]
 gb|KFZ98684.1| small heat shock protein ibpA [Shigella flexneri]
 gb|KGA82327.1| heat shock protein IbpA [Escherichia coli]
 emb|CDY62934.1| small heat shock protein IbpA [Escherichia coli]
 emb|CDZ22466.1| small heat shock protein IbpA [Escherichia coli]
 dbj|GAL55105.1| small heat shock protein IbpA [Escherichia albertii NBRC 107761]
 gb|KGI47972.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|AIT36841.1| heat shock protein IbpA [Escherichia coli FAP1]
 gb|KGL70229.1| small heat shock protein A [Escherichia coli NCTC 50110]
 gb|KGM61552.1| Small heat shock protein IbpA [Escherichia coli G3/10]
 gb|KGM67109.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KGM72271.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KGM76072.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KGM84818.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KGM85688.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KGP14905.1| heat shock protein IbpA [Escherichia coli]
 gb|KGP16613.1| heat shock protein IbpA [Escherichia coli]
 gb|KGP17856.1| heat shock protein IbpA [Escherichia coli]
 gb|KGP41444.1| heat shock protein IbpA [Escherichia coli]
 gb|KGP49244.1| heat shock protein IbpA [Escherichia coli]
 gb|KGP52073.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT07615.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT12865.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT16773.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT17429.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT26481.1| heat shock protein IbpA [Escherichia coli]
 gb|KGT32082.1| heat shock protein IbpA [Escherichia coli]
 gb|AIX65683.1| heat shock protein IbpA [Escherichia coli]
 gb|KHD41844.1| heat shock protein IbpA [Escherichia coli]
 gb|KHD52004.1| heat shock protein IbpA [Escherichia coli]
 gb|KHD54588.1| heat shock protein IbpA [Escherichia coli]
 gb|KHD56380.1| heat shock protein IbpA [Escherichia coli]
 gb|KHG72603.1| heat shock protein IbpA [Escherichia coli]
 gb|KHG76042.1| heat shock protein IbpA [Escherichia coli]
 gb|KHG84497.1| heat shock protein IbpA [Escherichia coli]
 gb|KHG88897.1| heat shock protein IbpA [Escherichia coli]
 gb|KHG93020.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH09376.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH12658.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH13809.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH18960.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH29470.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH31654.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH38383.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH41785.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH43294.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH52174.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH56735.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH58497.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH66100.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH71354.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH73712.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH82586.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH86587.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH90480.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH93787.1| heat shock protein IbpA [Escherichia coli]
 gb|KHH99297.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI04604.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI10470.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI11639.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI12996.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI23904.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI28706.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI29235.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI34263.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI39774.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI46825.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI50895.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI51156.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI58934.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI69224.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI69630.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI77127.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI81904.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI83818.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI90169.1| heat shock protein IbpA [Escherichia coli]
 gb|KHI94444.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ02593.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ06953.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ15610.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ17315.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ20283.1| heat shock protein IbpA [Escherichia coli]
 gb|KHJ21030.1| heat shock protein IbpA [Escherichia coli]
 gb|AIZ30175.1| heat shock chaperone [Escherichia coli ER2796]
 gb|AIZ53499.1| heat shock chaperone [Escherichia coli K-12]
 gb|AIZ84727.1| heat shock protein IbpA [Escherichia coli]
 gb|AIZ89297.1| heat shock protein IbpA [Escherichia coli]
 gb|AIZ93508.1| heat shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|AJA28792.1| 16 kDa heat shock protein A [Escherichia coli O157:H7 str. SS52]
 gb|KHO58817.1| heat shock protein IbpA [Escherichia coli]
 emb|CEK07883.1| heat shock chaperone [Escherichia coli O26:H11]
 gb|AJB36936.1| small heat shock protein A [Escherichia coli APEC IMT5155]
 gb|AJB53712.1| heat shock protein IbpA [Escherichia coli]
 emb|CCQ31329.2| heat shock chaperone [Escherichia coli]
 gb|KIE65680.1| heat shock protein IbpA [Escherichia coli]
 gb|KIE72204.1| heat shock protein IbpA [Escherichia coli]
 gb|KIE75568.1| heat shock protein IbpA [Escherichia coli]
 gb|KIE79809.1| heat shock protein IbpA [Escherichia coli RS218]
 gb|KIG24239.1| heat shock protein IbpA [Escherichia coli C691-71 (14b)]
 gb|KIG31431.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG36956.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG37366.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG43853.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG55840.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG56186.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG57683.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG65989.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG73780.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG73798.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG80741.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG84846.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG85282.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG94636.1| heat shock protein IbpA [Escherichia coli]
 gb|KIG99768.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH03793.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH16749.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH17058.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH24146.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH28313.1| heat shock protein IbpA [Escherichia coli]
 gb|KIH33476.1| heat shock protein IbpA [Escherichia coli]
 gb|AJE58258.1| small heat shock protein IbpA [Escherichia coli]
 gb|KII06613.1| heat shock protein IbpA [Escherichia coli]
 gb|AJF58561.1| heat shock chaperone [Escherichia coli 1303]
 gb|AJF78818.1| heat shock protein IbpA [Escherichia coli]
 gb|KIN84494.1| heat shock protein IbpA [Escherichia coli]
 gb|AJG10691.1| heat shock chaperone [Escherichia coli ECC-1470]
 gb|KIO40218.1| heat shock protein IbpA [Escherichia coli O139:H28 str. E24377A]
 gb|AJH12335.1| heat shock protein IbpA [Escherichia coli]
 gb|KIO85688.1| Hsp20/alpha crystallin family protein [Escherichia coli 97.0264]
 gb|KIQ41919.1| heat shock protein IbpA [Escherichia coli]
 gb|KIQ45304.1| heat shock protein IbpA [Escherichia coli]
 gb|AJM75887.1| heat shock protein IbpA [Escherichia coli RS218]
 gb|AJO85751.1| heat shock protein IbpA [Escherichia coli]
 gb|KIY26275.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ11270.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ63762.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ63783.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ64767.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ72670.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ80445.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ84104.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ91156.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ94696.1| heat shock protein IbpA [Escherichia coli]
 gb|KIZ97187.1| heat shock protein IbpA [Escherichia coli]
 gb|KJA02759.1| heat shock protein IbpA [Escherichia coli]
 gb|KJA07329.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD61063.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD69858.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD72979.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD77817.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD83740.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD91708.1| heat shock protein IbpA [Escherichia coli]
 gb|KJD91850.1| heat shock protein IbpA [Escherichia coli]
 gb|KJG97645.1| heat shock protein IbpA [Escherichia coli]
 gb|KJH02049.1| heat shock protein IbpA [Escherichia coli]
 gb|KJH08261.1| heat shock protein IbpA [Escherichia coli]
 gb|KJI07391.1| heat shock protein IbpA [Escherichia coli]
 gb|KJI09776.1| heat shock protein IbpA [Escherichia coli]
 gb|KJI18174.1| heat shock protein IbpA [Escherichia coli]
 gb|KJJ46983.1| heat shock protein IbpA [Escherichia coli]
 gb|KJJ74110.1| heat shock chaperone [Escherichia coli]
 gb|KJJ79339.1| heat shock chaperone [Escherichia coli]
 gb|KJW26620.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW30999.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW35534.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW38524.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW46453.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW50923.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW58337.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW61037.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW62602.1| heat shock protein IbpA [Escherichia coli]
 gb|KJW73951.1| heat shock protein IbpA [Escherichia coli]
 gb|KJY09834.1| heat shock protein IbpA [Escherichia coli]
 gb|AKA92884.1| small heat shock protein IbpA [Escherichia coli VR50]
 emb|CQR83113.1| heat shock chaperone [Escherichia coli K-12]
 gb|KKA63339.1| Hsp20/alpha crystallin family protein [Escherichia coli 9.1649]
 gb|KKB21098.1| heat shock protein IbpA [Escherichia coli]
 gb|KKB22247.1| heat shock protein IbpA [Escherichia coli]
 gb|AKC14157.1| heat shock protein IbpA [Escherichia coli]
 gb|AKD63129.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD67501.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD71852.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD76220.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD80631.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD85000.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD89356.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|AKD93792.1| heat shock protein IbpA [Escherichia coli K-12]
 gb|KKF75824.1| heat shock protein IbpA [Escherichia coli O157:H7]
 gb|KKF85723.1| heat shock protein IbpA [Escherichia coli O157:H7]
 gb|KKJ12841.1| heat shock protein IbpA [Escherichia coli MRSN 10204]
 gb|AKE86819.1| heat shock protein IbpA [Escherichia coli O104:H4 str. C227-11]
 gb|KKK30763.1| heat shock protein IbpA [Escherichia coli]
 gb|KKO22885.1| heat shock protein IbpA [Escherichia coli]
 gb|KKO26747.1| heat shock protein IbpA [Escherichia coli]
 gb|KKO30139.1| heat shock protein IbpA [Escherichia coli]
 gb|KKO40223.1| heat shock protein IbpA [Escherichia coli]
 gb|AKF22909.1| heat shock protein IbpA [Escherichia coli]
 gb|AKF57440.1| heat shock chaperone [Escherichia coli]
 gb|AKF61580.1| heat shock chaperone [Escherichia coli]
 gb|AKF65718.1| heat shock chaperone [Escherichia coli]
 gb|AKF69858.1| heat shock chaperone [Escherichia coli]
 gb|AKF73997.1| heat shock chaperone [Escherichia coli]
 gb|KKY45411.1| heat shock protein IbpA [Escherichia coli O157:H7]
 gb|AKH24359.1| heat shock protein IbpA [Escherichia coli]
 gb|KLD48574.1| heat shock protein IbpA [Escherichia coli]
 gb|KLD52843.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG30585.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG37411.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG38876.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG46169.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG53719.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG57031.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG61021.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG68637.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG72846.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG77029.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG79280.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG88321.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG91179.1| heat shock protein IbpA [Escherichia coli]
 gb|KLG99101.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH06595.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH13199.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH14610.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH21541.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH25781.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH32333.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH36476.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH44663.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH51376.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH55464.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH56593.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH70217.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH73428.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH74972.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH81519.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH85936.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH91149.1| heat shock protein IbpA [Escherichia coli]
 gb|KLH91303.1| heat shock protein IbpA [Escherichia coli]
 gb|AKI68680.1| heat shock protein IbpA [Shigella boydii]
 gb|AKK50566.1| heat shock chaperone [Escherichia coli PCN033]
 gb|AKK35281.1| heat shock protein IbpA [Escherichia coli APEC O18]
 gb|AKK41124.1| heat shock protein IbpA [Escherichia coli APEC O2-211]
 gb|AKK44876.1| heat shock protein IbpA [Escherichia coli]
 gb|AKK56190.1| heat shock protein IbpA [Shigella flexneri G1663]
 gb|AKM37272.1| heat shock chaperone [Escherichia coli PCN061]
 gb|KLU94197.1| heat shock protein IbpA [Escherichia coli]
 gb|KLW99561.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLW99943.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX03069.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX14306.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX18586.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX26251.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX30482.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX30661.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX44612.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX47109.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX52168.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX52448.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX62304.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX63527.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX68965.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX70276.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX81093.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX84675.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX90876.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX93739.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLX98873.1| small heat shock protein IbpA [Escherichia coli]
 gb|KLY05466.1| small heat shock protein IbpA [Escherichia coli]
 gb|KME62049.1| small heat shock protein IbpA [Escherichia coli]
 gb|AKN49573.1| heat shock protein IbpA [Escherichia coli]
 gb|AKO54867.1| heat shock protein IbpA [Escherichia coli]
 gb|AKP86706.1| heat shock protein IbpA [Escherichia coli ACN001]
 gb|KMV37792.1| heat shock protein IbpA [Escherichia coli]
 gb|KMV42616.1| heat shock protein IbpA [Escherichia coli]
 gb|KMV44763.1| heat shock protein IbpA [Escherichia coli]
 gb|KMV46987.1| heat shock protein IbpA [Escherichia coli]
 gb|KMV56732.1| heat shock protein IbpA [Escherichia coli]
 gb|KMV60580.1| heat shock protein IbpA [Escherichia coli]
 gb|EEH89009.2| small heat shock protein ibpA [Escherichia sp. 3_2_53FAA]
 gb|AKR22501.1| heat shock protein IbpA [Escherichia coli]
 gb|AKR26854.1| heat shock protein IbpA [Escherichia coli]
 gb|AKR31341.1| heat shock protein IbpA [Escherichia coli]
 gb|KNA42609.1| hsp20-like protein [Escherichia coli M114]
 gb|KNF16986.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF17510.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF22530.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF28297.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF32931.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF37987.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF42246.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF55329.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF60857.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF66374.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF67692.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF79078.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF80223.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF85659.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF92036.1| heat shock protein IbpA [Escherichia coli]
 gb|KNF97442.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG00842.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG10943.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG12800.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG14714.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG28373.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG28574.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG34327.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG38711.1| heat shock protein IbpA [Escherichia coli]
 gb|KNG41277.1| heat shock protein IbpA [Escherichia coli]
 gb|KNY01368.1| heat shock protein IbpA [Escherichia coli]
 gb|KNY54700.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY62113.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY62198.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY70458.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY75308.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY82359.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY88888.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY90511.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNY97526.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ04340.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ06056.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ07233.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ12896.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ19750.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ27417.1| heat-shock protein IbpA [Escherichia coli]
 gb|KNZ98515.1| heat shock protein IbpA [Escherichia coli]
 gb|KOA24883.1| heat shock protein IbpA [Escherichia coli]
 gb|KOA31229.1| heat shock protein IbpA [Escherichia coli]
 gb|KOA35044.1| heat shock protein IbpA [Escherichia coli]
 gb|KOR07321.1| heat shock protein IbpA [Escherichia coli]
 gb|ALB33712.1| heat shock protein IbpA [Escherichia coli]
 gb|ALD22919.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALD37877.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALD28150.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALD33093.1| heat-shock protein IbpA [Escherichia coli]
 emb|CUH57933.1| heat shock chaperone [Escherichia coli KRX]
 gb|KOZ07029.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ10566.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ16998.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ23430.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ25715.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ34089.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ38145.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ44355.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ48367.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ55538.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ56189.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ65045.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ68307.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ73832.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ78436.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ79936.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ87014.1| heat shock protein IbpA [Escherichia coli]
 gb|KOZ93854.1| heat shock protein IbpA [Escherichia coli]
 gb|KPH32359.1| heat shock protein IbpA [Escherichia coli]
 gb|KPH33941.1| heat shock protein IbpA [Escherichia coli]
 gb|KPH42945.1| heat shock protein IbpA [Escherichia coli]
 gb|KPH48661.1| heat shock protein IbpA [Escherichia coli]
 emb|CUQ98963.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|ALH93010.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|ALI38620.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|ALI43019.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALI47416.1| heat-shock protein IbpA [Escherichia coli]
 gb|KPO08920.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO10484.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO13579.1| heat-shock protein IbpA [Escherichia coli]
 gb|KPO21913.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO27365.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO27572.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO32077.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO49974.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO59573.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO63042.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO64532.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO67897.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO72632.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO75772.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO82401.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO90280.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO91117.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO94604.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP00058.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP13041.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP14928.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP20093.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP23417.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP29400.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP37094.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP42606.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP46372.1| heat shock protein IbpA [Escherichia coli]
 gb|KPP47469.1| heat shock protein IbpA [Escherichia coli]
 gb|KPQ49641.1| Small heat shock protein IbpA [Escherichia coli TW10598]
 gb|KQB27361.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQC25271.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI75125.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI79789.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI86704.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI89485.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI95868.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQI97955.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ03315.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ08494.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ17918.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ19606.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ21299.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ27567.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ33778.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ40041.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ43901.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQJ48827.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALL88139.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALL95823.1| heat-shock protein IbpA [Escherichia coli]
 gb|KQL79158.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia coli]
 gb|KRQ05013.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 dbj|BAT37149.1| heat shock chaperone [Escherichia albertii]
 dbj|BAT41440.1| heat shock chaperone [Escherichia albertii]
 gb|KRR52678.1| small heat shock protein A [Escherichia coli VL2732]
 gb|KRR58198.1| small heat shock protein A [Escherichia coli K71]
 gb|KRR63076.1| small heat shock protein A [Escherichia coli VL2874]
 gb|ALN47772.1| heat-shock protein IbpA [Escherichia coli]
 gb|KRT20153.1| heat-shock protein IbpA [Escherichia coli]
 gb|KRV79541.1| heat-shock protein IbpA [Escherichia coli]
 gb|KRV96313.1| heat-shock protein IbpA [Escherichia coli]
 gb|KRW04039.1| heat-shock protein IbpA [Escherichia coli]
 dbj|BAT45686.1| heat shock chaperone [Escherichia albertii]
 gb|KST32048.1| heat-shock protein IbpA [Escherichia coli]
 gb|KST35823.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALQ57288.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALQ74703.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSW93255.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSX67177.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSX80222.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSX88869.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY08187.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY09681.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY36708.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY53606.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY60039.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY66149.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY80213.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSY90171.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSZ07356.1| heat-shock protein IbpA [Escherichia coli]
 gb|KSZ22004.1| heat-shock protein IbpA [Escherichia coli]
 emb|CRL91442.1| heat shock chaperone [Escherichia coli]
 gb|ALT51621.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG68782.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG72497.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG73305.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG82851.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG86184.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG88146.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUG96454.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH01903.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH02408.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH08368.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH08951.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH15272.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH19387.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH24513.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUH25993.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALV71188.1| heat shock protein IbpA [Escherichia coli]
 gb|ALX54579.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALX59798.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALX64586.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALY15243.1| heat shock protein IbpA [Escherichia coli]
 emb|CUW79077.1| heat shock chaperone [Escherichia coli]
 gb|KUR27614.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUR38839.1| heat-shock protein IbpA [Escherichia coli]
 gb|ALZ57736.1| heat shock protein IbpA [Shigella sonnei]
 gb|KUR83802.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUR85760.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUR95298.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS02401.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS06366.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS06934.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS10316.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS16244.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS23456.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS28323.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS35702.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS37333.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS39129.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS51236.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS54645.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS54909.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS67415.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS71727.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS84653.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS85355.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS86020.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS92834.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS94095.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUS96713.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT10848.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT15480.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT18911.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT24204.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT27000.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT33386.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT41958.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT42463.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT45479.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT54625.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT58907.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT60539.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT70026.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT70243.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT79595.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT87434.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT99862.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU01970.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU02753.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU03741.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU14010.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU17241.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU25165.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU25327.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU44819.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU51012.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU51441.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU52146.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU61945.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU63786.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU65547.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU66238.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU76038.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU86740.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU97664.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV03741.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV10876.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV11959.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV16338.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV21419.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV22617.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV27823.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV32456.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV34462.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV47699.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV52169.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV53415.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV63994.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV66379.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV67333.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV69074.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV71239.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV85858.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV91592.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV95874.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW12016.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW12283.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW14743.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW24791.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW32742.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW32874.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW35035.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW44742.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW45433.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW48396.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW59838.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW61273.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW66251.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW76701.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW78669.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW85993.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW91209.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW93354.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW97845.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX10209.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX11560.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX14773.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX20157.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX26282.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX28143.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX33731.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX40348.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX41258.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX55528.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX55644.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX55661.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX64578.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX66853.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX67510.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX78834.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX87762.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX88136.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUX95465.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUY00731.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUY03526.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUY04035.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUY07918.1| heat-shock protein IbpA [Escherichia coli]
 gb|KVI23432.1| heat-shock protein IbpA [Escherichia coli]
 gb|KVI23946.1| heat-shock protein IbpA [Escherichia coli]
 gb|KVI44572.1| heat-shock protein IbpA [Escherichia coli]
 gb|KWV18508.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMB56534.1| heat-shock protein IbpA [Escherichia coli]
 gb|KWV97866.1| heat-shock protein IbpA [Escherichia fergusonii]
 gb|KWV98515.1| heat-shock protein IbpA [Escherichia fergusonii]
 gb|KWV99965.1| heat-shock protein IbpA [Escherichia fergusonii]
 gb|AMC96579.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|KXC11945.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMG17599.1| heat-shock protein IbpA [Shigella sonnei]
 gb|AMG80968.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AMH24338.1| heat-shock protein IbpA [Escherichia coli B]
 gb|AMH28654.1| heat-shock protein IbpA [Escherichia coli B]
 gb|AMH32296.1| heat-shock protein IbpA [Escherichia coli K-12]
 gb|AMH37016.1| heat-shock protein IbpA [Escherichia coli K-12]
 gb|KXG55495.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KXG57957.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KXG60751.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KXG71338.1| Small heat shock protein IbpA [Escherichia coli]
 gb|AMF89711.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXG96990.1| small heat shock protein IbpA [Escherichia coli]
 gb|KXH03382.1| small heat shock protein IbpA [Escherichia coli]
 gb|KXH91640.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXH93875.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXI03488.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXI06209.1| heat-shock protein IbpA [Escherichia coli]
 emb|CUW23791.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|AMK99814.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|AML06966.1| heat-shock protein IbpA [Escherichia coli]
 gb|AML11613.1| heat-shock protein IbpA [Escherichia coli]
 gb|AML16634.1| heat-shock protein IbpA [Escherichia coli]
 gb|AML21570.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXK74084.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXK76373.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXK77450.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXK92403.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXK99820.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL06028.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL06873.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL10070.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL14032.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL17756.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL25716.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL27444.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL34905.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL36476.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL54859.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL55733.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL64885.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL75069.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL79751.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL87496.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL89000.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL93399.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXL96604.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM10225.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM15203.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM16539.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM25138.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM26670.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM33334.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM36375.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM41899.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM43693.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM56098.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM66079.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM71807.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM71896.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM78664.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM86407.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM89420.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM91214.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXM97431.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN05354.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN09077.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN09759.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN20285.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN24178.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN29333.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN33659.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN42533.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN42793.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN46754.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN57291.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXN63113.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP16665.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP19595.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP20307.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP32065.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP37522.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP39974.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP48350.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP49117.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP51820.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP57788.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP61739.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP65823.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP72076.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP75538.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP80597.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP83803.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXP92464.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ03302.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ03473.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ06307.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ10853.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ23645.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ24573.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ25235.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ30009.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ36146.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ40994.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ42927.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ52379.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ56414.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ58918.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ62008.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ65291.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ73847.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ76662.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ80408.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ82180.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ88775.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXQ98558.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR00331.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR05366.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR09592.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR10891.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR17794.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR20773.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR32035.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR35434.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR38744.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR41643.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR46995.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR52170.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR55766.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR59752.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR66389.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR70144.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR71632.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR79050.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR79862.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR86863.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR90905.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXR95735.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXS00098.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMM38677.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMM77291.1| heat-shock protein IbpA [Shigella flexneri 1a]
 emb|CUU95995.1| heat shock chaperone [Escherichia coli]
 gb|AMN60029.1| heat shock protein IbpA [Shigella flexneri 2a]
 gb|AMN64854.1| heat shock protein IbpA [Shigella flexneri 4c]
 gb|KXU67683.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXU73364.1| heat-shock protein IbpA [Escherichia coli]
 gb|KXU73977.1| heat-shock protein IbpA [Escherichia coli]
 emb|CUX81801.1| heat shock chaperone [Escherichia coli]
 gb|AMQ53495.1| heat-shock protein IbpA [Escherichia coli JJ1887]
 gb|AMR25224.1| heat-shock protein IbpA [Shigella sp. PAMC 28760]
 gb|KYL37986.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYN56129.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYN56407.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYO68524.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KYO70470.1| Small heat shock protein IbpA [Escherichia coli]
 gb|KYR03666.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR10090.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR16818.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR17604.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR24690.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR28899.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR33767.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR40470.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR49876.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR57662.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR61821.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR62476.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR68993.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR70101.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR80408.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR81156.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR91451.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR91727.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYR96245.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS04070.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS05772.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS13801.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS27555.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS31982.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS38619.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS41811.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS48490.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS54711.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS55505.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS63465.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS63708.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS66494.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS71343.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS78328.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS82703.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS88489.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYS94522.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT03496.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT14165.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT14992.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT18955.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT20199.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT24633.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT25417.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT42863.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT46125.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT48114.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT48699.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT63515.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT76360.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT78941.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT84145.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT94251.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYT94972.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU02075.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU06603.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU14534.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU15827.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU20556.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU27500.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU33805.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU40967.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU44938.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU48555.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU56421.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU57554.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU62803.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU70343.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU72930.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU75155.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU76734.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU95293.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYU97028.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV02609.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV12314.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV13205.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV15331.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV23403.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV28940.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV34183.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV41495.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV44092.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV47489.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV51481.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV61994.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV63324.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV68389.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV72604.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV85006.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV86662.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYV88682.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW00872.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW01988.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW05171.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW08457.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW16902.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW21658.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW35190.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW35769.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW37743.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW40599.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW50050.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW58071.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW61122.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW66553.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW74732.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW75978.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYW78194.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMU84262.1| heat shock protein IbpA [Escherichia coli str. Sanji]
 gb|KYZ90875.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYZ95188.1| heat-shock protein IbpA [Escherichia coli]
 gb|KYZ97629.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMW43532.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMW48950.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMX13637.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMX31260.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMX34165.1| heat-shock protein IbpA [Escherichia coli]
 gb|AMX41769.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZF31523.1| heat-shock protein IbpA [Escherichia coli APEC O2]
 gb|KZG96455.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZG96636.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH10879.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH12510.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH20075.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH31462.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH32955.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH43087.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH43528.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH49130.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH60052.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH61837.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH65279.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH77342.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH78126.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH79659.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH90079.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH90948.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI01591.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI06641.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI16763.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI17872.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI20817.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI33014.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI33323.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI34815.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI37598.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI39417.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI49092.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI50835.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI58998.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI59453.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI71803.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI76095.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI82620.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI87861.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI89487.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZI93686.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ03481.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ07761.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ07834.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ18118.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ20646.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ21568.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ25863.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ32927.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ34491.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ37611.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ51416.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ53676.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ54542.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ58782.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ67307.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ75845.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ82772.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ82906.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ85045.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ86154.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZJ97415.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZK03254.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZO61320.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO66932.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO70968.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO75823.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO79334.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO82526.1| heat shock protein IbpA [Escherichia coli]
 gb|KZO88334.1| heat shock protein IbpA [Escherichia coli]
 gb|KZP44537.1| heat shock protein IbpA [Escherichia coli]
 gb|OAC00818.1| heat shock chaperone [Escherichia coli]
 gb|OAC01515.1| heat shock chaperone [Escherichia coli]
 gb|OAC09381.1| heat shock chaperone [Escherichia coli]
 gb|OAC11269.1| heat shock chaperone [Escherichia coli]
 gb|OAC18051.1| heat shock chaperone [Escherichia coli]
 gb|OAC21586.1| heat shock chaperone [Escherichia coli]
 gb|OAC29066.1| heat shock chaperone [Escherichia coli]
 gb|OAC32844.1| heat shock chaperone [Escherichia coli]
 gb|OAC38621.1| heat shock chaperone [Escherichia coli]
 gb|OAC41101.1| heat shock chaperone [Escherichia coli]
 gb|OAE51045.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAE73939.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF23282.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF26090.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF31825.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF36449.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF44593.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF47158.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF53052.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAF91011.1| Small heat shock protein ibpA [Escherichia coli PCN079]
 gb|OAI35355.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANE60002.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANE64754.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAJ79735.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAJ84351.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAM47343.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAN06927.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OAO39390.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO46928.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO47189.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO52875.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO57356.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO59090.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO65087.1| heat shock protein IbpA [Escherichia coli]
 gb|OAO72445.1| heat shock protein IbpA [Escherichia coli]
 gb|ANG71198.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|ANG76697.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|ANG82379.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OAP70601.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAR88686.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAR96698.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAS04360.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAS93199.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAT64111.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAV62245.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANJ33039.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANJ40203.1| heat-shock protein IbpA [Escherichia coli]
 gb|OAY11881.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANK07276.1| heat-shock protein IbpA [Escherichia coli]
 emb|CTQ84311.1| heat shock chaperone [Escherichia coli]
 gb|ANK50872.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANM84504.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANK34519.1| heat-shock protein IbpA [Escherichia coli]
 gb|OBU92336.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANO91657.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANP09713.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANP20528.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANP34676.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANO80242.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANQ03063.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANO27710.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANR83520.1| heat-shock protein IbpA [Escherichia coli]
 gb|OBZ36616.1| heat-shock protein IbpA [Escherichia coli]
 gb|OBZ36773.1| heat-shock protein IbpA [Escherichia coli]
 gb|OBZ49555.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCC37427.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC39894.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC42827.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC52623.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC52830.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC53640.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC57490.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC58649.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC67427.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC69092.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC72825.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC74372.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC82969.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC88608.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC93116.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCC96908.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD01946.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD03552.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD10686.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD13854.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD18466.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD20585.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD22390.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD24822.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD37360.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD43762.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD46778.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD49011.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD50638.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD57653.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD67426.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD69829.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD71742.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD79168.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD79229.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD82371.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD89652.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD95965.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD96924.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCD99408.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE07358.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE11734.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE11760.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE20071.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE20211.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE24434.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE31193.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE31249.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE38016.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE38553.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE42862.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE50492.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE61970.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE62880.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE63893.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE69585.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE74523.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE79225.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE82488.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE88976.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE93331.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCE98469.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF00468.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF01919.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF10570.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF16991.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF18275.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OCF20289.1| heat-shock protein IbpA [Shigella sonnei]
 emb|SCA73576.1| heat shock protein IbpA [Escherichia coli]
 gb|OCJ85100.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCJ89900.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCJ94499.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCJ97520.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCK02125.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANV95660.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCK69034.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANW29615.1| heat-shock protein IbpA [Escherichia coli]
 gb|ANW42679.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OCO62907.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCQ17220.1| heat shock protein IbpA [Escherichia coli]
 gb|OCQ26804.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCQ34552.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCQ49705.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS55485.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS56513.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS61524.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS63587.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS73149.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCS80281.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCT06875.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCW51957.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCW80235.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOD09145.1| heat-shock protein IbpA [Escherichia coli]
 gb|OCZ11940.1| heat-shock protein IbpA [Acinetobacter pittii]
 gb|ODA88266.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODB47890.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODB49192.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODG70723.1| heat-shock protein IbpA [Shigella sp. FC1661]
 gb|ODG72748.1| heat-shock protein IbpA [Shigella sp. FC2045]
 gb|ODG78610.1| heat-shock protein IbpA [Shigella sp. FC2928]
 gb|ODG87334.1| heat-shock protein IbpA [Shigella sp. FC1882]
 gb|ODG88587.1| heat-shock protein IbpA [Shigella sp. FC1764]
 gb|ODH15353.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODH22722.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODH27844.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODH36344.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODH40640.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODJ24156.1| heat-shock protein IbpA [Shigella sp. FC1180]
 gb|ODJ24843.1| heat-shock protein IbpA [Shigella sp. FC1172]
 gb|ODJ31371.1| heat-shock protein IbpA [Shigella sp. FC2383]
 gb|ODJ33737.1| heat-shock protein IbpA [Shigella sp. FC2833]
 gb|ODJ35508.1| heat-shock protein IbpA [Escherichia coli]
 gb|ODJ39794.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOM43009.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOM55700.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOM60179.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOM72224.1| Small heat shock protein IbpA [Escherichia coli]
 gb|ODQ04988.1| heat-shock protein IbpA [Shigella sp. FC569]
 gb|ODQ17167.1| heat-shock protein IbpA [Shigella sp. FC1544]
 gb|ODQ19905.1| heat-shock protein IbpA [Shigella sp. FC1056]
 gb|ODQ20138.1| heat-shock protein IbpA [Shigella sp. FC1139]
 gb|AOO71898.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEB95090.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEG32790.1| heat-shock protein IbpA [Shigella sp. FC2117]
 gb|OEG34025.1| heat-shock protein IbpA [Shigella sp. FC2175]
 gb|OEG35070.1| heat-shock protein IbpA [Shigella sp. FC2125]
 gb|OEG43962.1| heat-shock protein IbpA [Shigella sp. FC2531]
 gb|OEG45721.1| heat-shock protein IbpA [Shigella sp. FC2710]
 gb|OEG48300.1| heat-shock protein IbpA [Shigella sp. FC2541]
 gb|OEG53079.1| heat-shock protein IbpA [Shigella sp. FC3196]
 gb|OEG65716.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOR21911.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI10776.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI12143.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI13320.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI16192.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI26236.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI27517.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI28728.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI35962.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI36514.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI43718.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI49917.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI50642.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI51617.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEI63125.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEJ00820.1| heat-shock protein IbpA [Shigella sp. FC1567]
 gb|OEJ03227.1| heat-shock protein IbpA [Shigella sp. FC1708]
 gb|OEJ05787.1| heat-shock protein IbpA [Shigella sp. FC1737]
 gb|OEL41634.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL44323.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL50146.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL53849.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL59688.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL63347.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL73058.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL76206.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL80821.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL80963.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL88019.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL91818.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEL95438.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM03653.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM11449.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM11894.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM22377.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM23670.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM27582.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM31846.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM37585.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM41513.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM46706.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM50201.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM57002.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM58077.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM69141.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM71120.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM76233.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM79583.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM84885.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM88353.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM96925.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEM99024.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN06932.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN12261.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN14106.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN19622.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN22066.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN29555.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN37303.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN39483.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN42313.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN47104.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN56746.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN58023.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN62909.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN70584.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN73274.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN78503.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN83440.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN84131.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN96460.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEN97263.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEO01668.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEO04502.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEO11153.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEO15789.1| heat-shock protein IbpA [Escherichia coli]
 gb|OEO18219.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOT30486.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|AOV19345.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV24698.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV30050.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV35416.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV40830.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV46174.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|AOV51589.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OFE29111.1| heat-shock protein IbpA [Escherichia coli]
 emb|SDO72242.1| molecular chaperone IbpA [Shigella sonnei]
 gb|AOX49939.1| heat-shock protein IbpA [Escherichia coli]
 gb|AOX55343.1| heat-shock protein IbpA [Escherichia coli]
 gb|OHV07306.1| heat-shock protein IbpA [Escherichia coli]
 gb|OHW33128.1| heat-shock protein IbpA [Escherichia coli]
 emb|SEQ01826.1| molecular chaperone IbpA [Escherichia coli]
 gb|APA24253.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII46328.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII51337.1| heat-shock protein IbpA [Escherichia coli]
 gb|APA39826.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII80474.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII92957.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII94725.1| heat-shock protein IbpA [Escherichia coli]
 gb|OII99157.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIJ02278.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIJ08875.1| heat-shock protein IbpA [Escherichia coli]
 emb|SCQ09848.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|OIU77435.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIU79563.1| heat-shock protein IbpA [Escherichia coli]
 gb|APC53721.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. W3110]
 gb|OIY23731.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY28174.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY37226.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY38789.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY41820.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY46263.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY50658.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY56048.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY63094.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY74526.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY76967.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY81584.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY83880.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY89594.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY91079.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIY97360.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ00305.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ06357.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ21669.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ22128.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ22650.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ26054.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ58827.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ71134.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ77341.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ86789.1| heat-shock protein IbpA [Escherichia coli]
 gb|OIZ90218.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF20473.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF23812.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF23861.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF36206.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF38068.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF46644.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF52807.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF53047.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF63066.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJF88139.1| heat-shock protein IbpA [Escherichia coli]
 emb|SHD58718.1| heat shock chaperone [Escherichia coli]
 gb|APE55436.1| heat-shock protein IbpA [Escherichia coli]
 gb|APE60386.1| heat-shock protein IbpA [Escherichia coli]
 gb|APE65266.1| heat-shock protein IbpA [Escherichia coli]
 gb|APE70101.1| heat-shock protein IbpA [Escherichia coli]
 gb|APE77630.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|APE89845.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|OJH23968.1| heat-shock protein IbpA [Escherichia coli NA114]
 gb|APG34431.1| heat-shock protein IbpA [Escherichia coli]
 gb|API00816.1| heat-shock protein IbpA [Escherichia coli]
 gb|API06434.1| heat-shock protein IbpA [Escherichia coli]
 gb|API12009.1| heat-shock protein IbpA [Escherichia coli]
 gb|API17573.1| heat-shock protein IbpA [Escherichia coli]
 gb|API23217.1| heat-shock protein IbpA [Escherichia coli]
 gb|API28711.1| heat-shock protein IbpA [Escherichia coli]
 gb|API34382.1| heat-shock protein IbpA [Escherichia coli]
 gb|API39943.1| heat-shock protein IbpA [Escherichia coli]
 gb|API49646.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK12580.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK17517.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK21130.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK26177.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK38494.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK43512.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK44009.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK51571.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK51784.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK60594.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK65136.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK72515.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK75861.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK79472.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK84067.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK90858.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJK91407.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL02346.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL07607.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL10966.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL20613.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL21410.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL23112.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL34665.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL37428.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL44318.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL46948.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL52385.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL53299.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL63802.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL68070.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL72594.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL79890.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL80027.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL91246.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL92166.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJL96706.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM03182.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM05530.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM12385.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM20893.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM25504.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM28942.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM35521.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM40509.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM46584.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM51038.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM56446.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM58471.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM61235.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM70456.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM74698.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM80842.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM83645.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM93581.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM98138.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJM99206.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN09162.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN13003.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN14844.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN19056.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN23476.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN30054.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN40061.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN44963.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN46855.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN55301.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN59260.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN67985.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN70018.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN72597.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN75137.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN80258.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN90540.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN93006.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJN99952.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO00194.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO07250.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO13838.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO19249.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO20723.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO28994.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO29206.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO44170.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO48433.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO49264.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO51889.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO54095.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO68459.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO71856.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO72785.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO80143.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO86651.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO89605.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO93107.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJO99536.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP01448.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP08621.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP12673.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP16736.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP21655.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP26381.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP37202.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP40302.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP41927.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP42972.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP52683.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP59185.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP66648.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP72914.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP73132.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP76618.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP76757.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP89650.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP94673.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJP99288.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ02461.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ07809.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ14314.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ15651.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ15769.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ24125.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ31762.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ38815.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ39273.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ45040.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ45434.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ56660.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ62735.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ63287.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ70157.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ75220.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ80448.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ84415.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ88545.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ93637.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJQ99432.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR02239.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR09022.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR16364.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR19427.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR20301.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR27070.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR29125.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR41311.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR44856.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR45134.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR55090.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR58022.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR68815.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR72582.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR77803.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR81286.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR87392.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR90404.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJR98054.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS03612.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS09639.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS09995.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS16146.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS24803.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS30203.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS32070.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS39163.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS39271.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS46759.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS52759.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS59186.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS61202.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS66301.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS75309.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS76142.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS91300.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJS92234.1| heat-shock protein IbpA [Escherichia coli]
 gb|OJZ36166.1| heat-shock protein IbpA [Escherichia coli]
 gb|APJ56141.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ63486.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ66319.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ70360.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ79091.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ84299.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ85146.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ90179.1| heat shock protein IbpA [Escherichia coli]
 gb|APJ96202.1| heat shock protein IbpA [Escherichia coli]
 gb|APK01506.1| heat shock protein IbpA [Escherichia coli]
 gb|APK04293.1| heat shock protein IbpA [Escherichia coli]
 gb|APK12985.1| heat shock protein IbpA [Escherichia coli]
 gb|APK17625.1| heat shock protein IbpA [Escherichia coli]
 gb|APK21378.1| heat shock protein IbpA [Escherichia coli]
 gb|APK25097.1| heat shock protein IbpA [Escherichia coli]
 gb|APK29965.1| heat shock protein IbpA [Escherichia coli]
 gb|APK36125.1| heat shock protein IbpA [Escherichia coli]
 gb|APK41200.1| heat shock protein IbpA [Escherichia coli]
 gb|APK46125.1| heat shock protein IbpA [Escherichia coli]
 gb|APK48857.1| heat shock protein IbpA [Escherichia coli]
 gb|APK55986.1| heat shock protein IbpA [Escherichia coli]
 gb|APK61101.1| heat shock protein IbpA [Escherichia coli]
 gb|APK64691.1| heat shock protein IbpA [Escherichia coli]
 gb|APK71746.1| heat shock protein IbpA [Escherichia coli]
 gb|APK74612.1| heat shock protein IbpA [Escherichia coli]
 gb|APK81964.1| heat shock protein IbpA [Escherichia coli]
 gb|APK84249.1| heat shock protein IbpA [Escherichia coli]
 gb|APK90901.1| heat shock protein IbpA [Escherichia coli]
 gb|APK94609.1| heat shock protein IbpA [Escherichia coli]
 gb|APK98920.1| heat shock protein IbpA [Escherichia coli]
 gb|APL05454.1| heat shock protein IbpA [Escherichia coli]
 gb|APL08175.1| heat shock protein IbpA [Escherichia coli]
 gb|APL16125.1| heat shock protein IbpA [Escherichia coli]
 gb|APL18827.1| heat shock protein IbpA [Escherichia coli]
 gb|APL25008.1| heat shock protein IbpA [Escherichia coli]
 gb|APL30968.1| heat shock protein IbpA [Escherichia coli]
 gb|APL33758.1| heat shock protein IbpA [Escherichia coli]
 gb|APL39003.1| heat shock protein IbpA [Escherichia coli]
 gb|APL44942.1| heat shock protein IbpA [Escherichia coli]
 gb|APL49377.1| heat shock protein IbpA [Escherichia coli]
 gb|APL57677.1| heat shock protein IbpA [Escherichia coli]
 gb|APL61917.1| heat shock protein IbpA [Escherichia coli]
 gb|APL64028.1| heat shock protein IbpA [Escherichia coli]
 gb|APL72426.1| heat shock protein IbpA [Escherichia coli]
 gb|APL75191.1| heat shock protein IbpA [Escherichia coli]
 gb|APL80033.1| heat shock protein IbpA [Escherichia coli]
 gb|APL84580.1| heat shock protein IbpA [Escherichia coli]
 gb|APL89354.1| heat shock protein IbpA [Escherichia coli]
 gb|APL51413.1| heat shock protein IbpA [Escherichia coli]
 gb|OKA61777.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKB70034.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKB73074.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKB84903.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKB90759.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKB93613.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKL78327.1| small heat shock protein IbpA [Escherichia coli]
 gb|OKL97756.1| small heat shock protein IbpA [Escherichia coli]
 gb|OKO60732.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKP63606.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKS71202.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKS98688.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT00407.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT06346.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT06513.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT16406.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT17429.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT20136.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT32105.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT34587.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT43700.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT44649.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT54438.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT55088.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT62592.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT65502.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT68420.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT71046.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT84574.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT86411.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT92277.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKT93506.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU03327.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU04341.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU12047.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU21677.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU22870.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU27805.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU35764.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU41369.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU46922.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU48607.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU56238.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU65570.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU79602.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU80243.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU86180.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU87837.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU95439.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKU97295.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV01920.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV13317.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV14527.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV16827.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV23016.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV23165.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV33387.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV39102.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV41303.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV48183.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV56173.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV64082.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV64227.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV67172.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV73548.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV79843.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV87849.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV89537.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKV99619.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW00512.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW00636.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW14983.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW20306.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW20641.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW30262.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW32823.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW42338.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW45034.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW47898.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW52782.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW60329.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW63542.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW67268.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW73867.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW85381.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW85586.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW89964.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKW97856.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX00268.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX03712.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX14613.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX18027.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX24275.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX27831.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX31628.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX32945.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX40626.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX45945.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX47689.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX61141.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX62349.1| heat-shock protein IbpA [Escherichia coli]
 gb|OKX67119.1| heat-shock protein IbpA [Escherichia coli]
 gb|APQ19442.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|OLL62829.1| heat-shock protein IbpA [Escherichia coli]
 gb|APT00514.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLN78207.1| heat shock protein IbpA [Escherichia coli]
 gb|OLO95581.1| heat-shock protein IbpA [Escherichia coli]
 gb|APT64929.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLR35795.1| heat shock protein IbpA [Escherichia coli O25b:H4-ST131]
 gb|OLR87772.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLS68597.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLS73000.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLS77377.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLS80818.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLS90182.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLT00211.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLT04855.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLY54573.1| heat-shock protein IbpA [Escherichia coli]
 gb|OLY88372.1| heat-shock protein IbpA [Escherichia coli O157:H43]
 gb|OMG95718.1| heat-shock protein IbpA [Escherichia coli]
 gb|OMH06414.1| heat-shock protein IbpA [Escherichia coli]
 gb|OMH08332.1| heat-shock protein IbpA [Escherichia coli]
 gb|APW92839.1| heat-shock protein IbpA [Escherichia coli]
 gb|OMI44654.1| heat shock protein IbpA [Escherichia coli N37058PS]
 gb|OMI46404.1| heat shock protein IbpA [Escherichia coli N37122PS]
 gb|OMI56874.1| heat shock protein IbpA [Escherichia coli N40513]
 gb|OMI61494.1| heat shock protein IbpA [Escherichia coli N40607]
 gb|OMI62780.1| heat shock protein IbpA [Escherichia coli N36410PS]
 gb|OMI64644.1| heat shock protein IbpA [Escherichia coli N37139PS]
 gb|OMI71519.1| heat shock protein IbpA [Escherichia coli N36254PS]
 gb|ONF80926.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONG05256.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONG21227.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONG24575.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONG31890.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONG35550.1| heat-shock protein IbpA [Escherichia coli]
 emb|SJK90674.1| heat shock chaperone [Escherichia coli]
 gb|ONK36003.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONK40251.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONK49701.1| heat-shock protein IbpA [Escherichia coli]
 gb|ONN30659.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOC69608.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOC73938.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOC78212.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOD57196.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQP93611.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOG29000.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOH61892.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOH64635.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOH65341.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOH66432.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI13533.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI16686.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI24373.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI29751.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI31936.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI39448.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI41553.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI46058.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI52683.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI58882.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI62113.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI69116.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI74547.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI82030.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI88033.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI92240.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI98459.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ01355.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ07329.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ11727.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ16949.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ23323.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ26763.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ32484.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ35759.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ42432.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ51395.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ52317.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ57491.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ63044.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ70303.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ73056.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ76838.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ80748.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ85656.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ89280.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOJ93279.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK03028.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK06044.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK12615.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK16004.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK22267.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK28334.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK28553.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK33884.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOK55555.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOM83956.1| heat-shock protein IbpA [Escherichia coli]
 gb|OON53131.1| heat-shock protein IbpA [Escherichia coli]
 gb|OON76820.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQU01483.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQU94860.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOO79855.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OOO82812.1| heat-shock protein IbpA [Shigella boydii]
 gb|OOO84478.1| heat-shock protein IbpA [Shigella boydii]
 gb|OOO89902.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|OOO94295.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|OOO97846.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|OOP06201.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP08530.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP11322.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP11791.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP17860.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP23533.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP24765.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP31762.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OOP35257.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OOP40020.1| heat-shock protein IbpA [Shigella flexneri]
 gb|AQV18327.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV25671.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV35110.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV40157.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV46642.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV53596.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV57003.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV63978.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV68900.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV74148.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV81148.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV85248.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV88168.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV99985.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQW07125.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQW11840.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQW19781.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOV73803.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOW13416.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOW24857.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOW28259.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQW75385.1| heat-shock protein IbpA [Escherichia coli M8]
 gb|AQX98979.1| heat-shock protein IbpA [Escherichia coli NU14]
 gb|OPH60086.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OPH67633.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OPH71164.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OPI30091.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI31601.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI37734.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI45616.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI50289.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI52200.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI65223.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI73430.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI73709.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI75687.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI85432.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI88472.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPI90811.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ00810.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ02852.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ05643.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ19569.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ20313.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ20467.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ39912.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ41070.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ43084.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ48800.1| heat-shock protein IbpA [Escherichia coli]
 gb|OPJ49068.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQZ28462.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQZ75092.1| heat shock protein IbpA [Escherichia coli]
 gb|AQZ83994.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA00109.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA05459.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA17970.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA31487.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA37091.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARA66483.1| heat-shock protein IbpA [Escherichia coli]
 gb|OQK69469.1| heat-shock protein IbpA [Shigella sonnei]
 gb|ARD53484.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARD79009.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARD82876.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARE45578.1| heat-shock protein IbpA [Escherichia coli C]
 dbj|BAX13154.1| small heat shock protein IbpA [Escherichia coli]
 dbj|BAX18321.1| small heat shock protein IbpA [Escherichia coli]
 dbj|BAX23199.1| small heat shock protein IbpA [Escherichia coli]
 gb|ORC96553.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORC97678.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD05893.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD14897.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD16844.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD24436.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD25078.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD36755.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD38881.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD53519.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD60503.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD69160.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD72945.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD85467.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD86739.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORD88718.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORE77344.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORE80442.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARH99348.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORJ73943.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORR78677.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORR78856.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORR87506.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORR90461.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORR90883.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS01752.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS02921.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS05656.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS15072.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS17659.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS18508.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS28639.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS30691.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS31337.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS42985.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS50165.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS56275.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS58610.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS64023.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS67282.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS71077.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS72371.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS80866.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS87095.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS87755.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS98113.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORS99055.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT02139.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT12820.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT15661.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT15894.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT27595.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT30617.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT37368.1| heat-shock protein IbpA [Escherichia coli]
 gb|ORT42367.1| heat-shock protein IbpA [Escherichia coli]
 emb|SMB21269.1| 16 kDa heat shock protein A [Escherichia coli]
 emb|SMB21479.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|OSB88490.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSB89646.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSC10030.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSC15242.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSC19931.1| heat-shock protein IbpA [Escherichia coli]
 emb|SMH27287.1| molecular chaperone IbpA [Escherichia coli]
 gb|ARJ94071.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSK05226.1| small heat shock protein A [Escherichia coli SHECO001]
 gb|OSK08998.1| hypothetical protein EAOG_03937 [Escherichia coli R527]
 gb|OSK10380.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli FVEC1465]
 gb|OSK19115.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli M056]
 gb|OSK22379.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA144]
 gb|OSK24715.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B574]
 gb|OSK34660.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E267]
 gb|OSK36678.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B671]
 gb|OSK39294.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B108]
 gb|OSK48445.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H588]
 gb|OSK50919.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H413]
 gb|OSK59144.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B921]
 gb|OSK59986.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E560]
 gb|OSK61164.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E1114]
 gb|OSK71839.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H223]
 gb|OSK74216.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H001]
 gb|OSK82707.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H378]
 gb|OSK83706.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B367]
 gb|OSK90756.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA447]
 gb|OSK95787.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E1002]
 gb|OSL02221.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H386]
 gb|OSL03782.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H296]
 gb|OSL09472.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H305]
 gb|OSL16846.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli B175]
 gb|OSL22337.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA255]
 gb|OSL27497.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H617]
 gb|OSL28861.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia albertii B156]
 gb|OSL34467.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA464]
 gb|OSL41979.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H461]
 gb|OSL44155.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H605]
 gb|OSL52183.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H454]
 gb|OSL52324.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H383]
 gb|OSL58628.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli H420]
 gb|OSL68185.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA008]
 gb|OSL68299.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA054]
 gb|OSL73401.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA014]
 gb|OSL82303.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli TA249]
 gb|OSL85228.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E704]
 gb|OSL85356.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli T426]
 gb|OSL96225.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli E1118]
 gb|OSL98512.1| small heat shock protein IbpA (16 kDa heat shock protein A)
           [Escherichia coli R424]
 gb|OSM85803.1| small heat shock protein A [Escherichia coli SHECO003]
 gb|OSM91559.1| small heat shock protein A [Escherichia coli SHECO002]
 gb|OSP34797.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARM40913.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARM77666.1| heat-shock protein IbpA [Escherichia coli]
 gb|OSY85782.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARQ24095.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTA09765.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB23730.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB25291.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB34135.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB38007.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB45003.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB49035.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB55241.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB58333.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB61156.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB70331.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB78170.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB78912.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB83846.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB91382.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTB96853.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC04331.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC07394.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC11038.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC21452.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC26153.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC32198.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC39052.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC43151.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC47948.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC53281.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC65538.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC68553.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC69517.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC79039.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC87765.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC87956.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTC96562.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD00774.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD09727.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD12547.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD18397.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD22800.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD28446.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD36240.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD40746.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD40871.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD49796.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD54007.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD60399.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD65950.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD69274.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD73395.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD81325.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD84384.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD93071.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTD93404.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE01410.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE07651.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE09107.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE20367.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE22581.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE24903.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE33334.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE36632.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE45499.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE51868.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE55009.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE59719.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE65026.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE71101.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE74100.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE79544.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE85426.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTE90945.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARR32972.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARR41028.1| heat-shock protein IbpA [Shigella sonnei]
 gb|ARR58420.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARR66170.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTU99428.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV08283.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV08390.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV16252.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV18446.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV19851.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV45008.1| heat-shock protein IbpA [Escherichia coli]
 gb|OTV51642.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUD17016.1| heat-shock protein IbpA [Escherichia coli M4]
 gb|ARS05648.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OUF52906.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF64837.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF68098.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF71128.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF79147.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF81670.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF86057.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF94265.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF95821.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUF98744.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG05622.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG12163.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG14480.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG20863.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG23893.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG32475.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUG34003.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUJ56663.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUJ63987.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUJ80191.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUJ90510.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK50078.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK52031.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK64261.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK88302.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK93803.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUK96073.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUL15986.1| heat-shock protein IbpA [Escherichia coli]
 gb|ART19058.1| Small heat shock protein IbpA [Escherichia coli]
 gb|ART26838.1| Small heat shock protein IbpA [Escherichia coli]
 gb|ART41939.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUP41566.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUR46280.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUR49467.1| small heat shock protein IbpA [Escherichia coli]
 gb|OUR52079.1| small heat shock protein IbpA [Escherichia coli]
 gb|ARV29782.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARV34631.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARV48991.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARV55508.1| heat-shock protein IbpA [Escherichia coli]
 gb|OUZ48664.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ49687.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ53757.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ61026.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OUZ64050.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ67031.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OUZ73693.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ76961.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ79043.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ83668.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OUZ94845.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OUZ97543.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OVA37446.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA49594.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA50123.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA55619.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA61579.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA63766.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA72650.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA76997.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA77759.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA86660.1| heat shock protein IbpA [Escherichia coli]
 gb|OVA90998.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB00304.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB04642.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB12450.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB16794.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB20482.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB23352.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB28127.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB36989.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB44975.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB47619.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB54783.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB60329.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB63114.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB72212.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB75597.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB77552.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB86241.1| heat shock protein IbpA [Escherichia coli]
 gb|OVB90705.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC00489.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC02628.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC06676.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC10908.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC17391.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC20396.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC29064.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC34189.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC39665.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC46242.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC52865.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC54827.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC57690.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC69847.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC71325.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC79082.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC81543.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC92365.1| heat shock protein IbpA [Escherichia coli]
 gb|OVC94008.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD00776.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD05820.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD07262.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD19736.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD22918.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD25646.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD31699.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD34732.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD42372.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD47016.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD52789.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD58716.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD63248.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD68109.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD75655.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD81923.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD82563.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD90322.1| heat shock protein IbpA [Escherichia coli]
 gb|OVD99747.1| heat shock protein IbpA [Escherichia coli]
 gb|OVE03173.1| heat shock protein IbpA [Escherichia coli]
 gb|OVE21143.1| heat shock protein IbpA [Escherichia coli]
 gb|OVE26784.1| heat shock protein IbpA [Escherichia coli]
 gb|OVE27349.1| heat shock protein IbpA [Escherichia coli]
 gb|ARW85668.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARW90581.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARX16487.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARX23773.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARX28341.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARX54395.1| heat-shock protein IbpA [Escherichia coli]
 gb|OVG05025.1| heat-shock protein IbpA [Escherichia coli]
 gb|OVG50321.1| heat-shock protein IbpA [Escherichia coli]
 gb|OVJ51438.1| heat-shock protein IbpA [Escherichia coli]
 gb|OVY44800.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWB87139.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWB89670.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWB92989.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC00318.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC10400.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC16505.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC17663.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC22138.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC26659.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC37701.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC38329.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC40202.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC56595.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC56995.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC61004.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC65344.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC73427.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC76770.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC80489.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC80841.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC87195.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC87881.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC88905.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWC96311.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD01778.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD02118.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD08286.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD09193.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD12980.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD20496.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD26274.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD38137.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD47256.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD49352.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD56399.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD57236.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD65415.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD74664.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD76759.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD77006.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD79439.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD84964.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD86486.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD96503.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWD99477.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE00750.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE05466.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE14619.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE15248.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE24607.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE36243.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE36451.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE43231.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE45163.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE51279.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE53551.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE63201.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE65941.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE68628.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE75432.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE81370.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE87676.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE88887.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWE93375.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF01097.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF04761.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF10542.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF11282.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF18579.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF23258.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWF31138.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARZ83967.1| heat-shock protein IbpA [Escherichia coli]
 gb|ARZ88010.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASA40611.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG43333.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG48718.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG54654.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG57478.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG63756.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG67282.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG72620.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG76954.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG80597.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG88162.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG88965.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG96187.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG98870.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWG99877.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWH09163.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWH11158.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWH16943.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWH24012.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASA59695.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASA63568.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASB78201.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASC16879.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWP97223.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWR18678.1| heat-shock protein IbpA [Shigella boydii]
 gb|OWR37652.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWS80771.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWS84820.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASE47967.1| heat-shock protein IbpA [Escherichia coli O157]
 gb|ASF04609.1| heat-shock protein IbpA [Escherichia coli O104:H4]
 gb|ASG47509.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWW49087.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWW55793.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWX79561.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWX80410.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWX89485.1| heat-shock protein IbpA [Escherichia coli]
 gb|OWY54830.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASI14320.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASI48330.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|ASJ28570.1| heat shock protein IbpA [Escherichia coli]
 gb|ASJ36062.1| heat shock protein IbpA [Escherichia coli]
 gb|ASJ45565.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXB29886.1| Small heat shock protein IbpA [Shigella flexneri 2a str. 301]
 gb|ASL29635.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASL56764.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|OXJ43731.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ51125.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ52881.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ60788.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ67315.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ70118.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ74357.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ79340.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ85740.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ90342.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ96110.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXJ97433.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK06417.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK10844.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK18769.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK23808.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK29906.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK30328.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK38581.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK41002.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK45008.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK52847.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK58071.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK64022.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK70774.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK75619.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK78416.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK83416.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK84718.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK93167.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXK95195.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXL02197.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASN32059.1| heat-shock protein IbpA [Shigella sonnei]
 gb|ASN35667.1| heat-shock protein IbpA [Shigella sonnei]
 gb|ASN42080.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXL48465.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXL51814.1| heat shock protein IbpA [Escherichia coli]
 gb|OXL53066.1| heat shock protein IbpA [Escherichia coli]
 gb|OXL59932.1| heat shock protein IbpA [Escherichia coli]
 gb|OXL70707.1| heat shock protein IbpA [Escherichia coli]
 gb|OXL72157.1| heat shock protein IbpA [Escherichia coli]
 gb|OXL72743.1| heat shock protein IbpA [Escherichia coli]
 gb|ASO02793.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASO76853.1| heat shock protein IbpA [Escherichia coli]
 gb|ASO85604.1| heat shock protein IbpA [Escherichia coli]
 gb|ASO90400.1| heat shock protein IbpA [Escherichia coli]
 gb|ASO95159.1| heat shock protein IbpA [Escherichia coli]
 gb|OXU86406.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXU91141.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASQ55169.1| heat-shock protein IbpA [Shigella flexneri 4c]
 gb|ASQ58981.1| heat-shock protein IbpA [Shigella flexneri 4c]
 gb|ASQ61744.1| heat-shock protein IbpA [Shigella flexneri 1a]
 gb|ASQ69322.1| heat shock chaperone [Escherichia coli NCCP15648]
 gb|ASQ80182.1| heat-shock protein IbpA [Shigella flexneri 1a]
 gb|OXV19859.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXV20630.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXV35275.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXV41848.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXV41994.1| heat-shock protein IbpA [Escherichia coli]
 gb|OXW59934.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW64476.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW66809.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXW73480.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW77616.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW80690.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXW86974.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW87565.1| heat-shock protein IbpA [Shigella boydii]
 gb|OXW95348.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXW99947.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXX04600.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXX08610.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXX14052.1| heat-shock protein IbpA [Shigella flexneri]
 gb|OXX17194.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OXZ48778.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ52802.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ52895.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ63905.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ73111.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ73989.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ75493.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ81826.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ82223.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ88885.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ95289.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ95523.1| small heat shock protein IbpA [Escherichia coli]
 gb|OXZ95743.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA10918.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA14158.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA14364.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA23881.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA31985.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA32484.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA38161.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA40593.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA44176.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA52865.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA53811.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA54627.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA65908.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA74773.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA76477.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA80732.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA83292.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA91816.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA98873.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYA99497.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB01804.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB06340.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB12720.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB18596.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB19730.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB29664.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB34304.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB35322.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB38176.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB48331.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB49922.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB50491.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB62700.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB66975.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB69859.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB74825.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB76134.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB83210.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB88934.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYB92357.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC03777.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC04071.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC05363.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC10402.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC14639.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC18743.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC21792.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC30091.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC36151.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC44953.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC48254.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC50893.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC55251.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC59300.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC60969.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC68019.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC74152.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC74949.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYC83605.1| small heat shock protein IbpA [Escherichia coli]
 gb|OYD29055.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYE25126.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYE25516.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYE49770.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYE57392.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYE71130.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYE77256.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYF37636.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYF70058.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYF72077.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYF91135.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG09559.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG53691.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYG67477.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG73309.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG74788.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYG78348.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG91681.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG94064.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG97223.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYG99596.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI01178.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI14021.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI23238.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI35525.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI38879.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI49018.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI52377.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYI59658.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI65692.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI69167.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI72642.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI74657.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYI77754.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYI85784.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ04865.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYJ22139.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ22602.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ30257.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ41917.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYJ43767.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYJ47850.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ60500.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ64498.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYJ67236.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ75725.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYJ79141.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYK23432.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK28458.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK28657.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK37815.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYK38674.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYK50418.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYK50578.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK51512.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK61772.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK61935.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYK65565.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYK70643.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYL21358.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL27366.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL32152.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL39283.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYL42148.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL42836.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYL57085.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL62338.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYL68136.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYL93220.1| heat-shock protein IbpA [Shigella sonnei]
 gb|OYN29979.1| heat-shock protein IbpA [Shigella boydii]
 gb|OYN39467.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYN48436.1| heat-shock protein IbpA [Escherichia coli]
 gb|OYN70436.1| heat-shock protein IbpA [Escherichia coli]
 gb|AST63808.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZC28247.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZG35138.1| heat-shock protein IbpA [Escherichia coli O157:H7]
 gb|OZM85625.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZM92243.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZN01374.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZN08426.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO55163.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO58949.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO63746.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO69127.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO73643.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO78775.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO83954.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO88805.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO93480.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZO98342.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP02982.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP09807.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP13079.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP18207.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP23171.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP27383.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZP32389.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZR91125.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZR96107.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZS01149.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZS06056.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZS11178.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX62121.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX67949.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX72208.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX78662.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX84293.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX89006.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX92321.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZX97362.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZY04485.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZY07964.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZY15408.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZY20288.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZY24247.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB65180.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB78248.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB84014.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB84864.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB96677.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAB97196.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAC02412.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAC25088.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAL30052.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAL38693.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAL42945.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAL51349.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAL59448.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ19697.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ25234.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ28433.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ33240.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ36151.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ46675.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ48112.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ54125.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ55647.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ62520.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ76050.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ76823.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ82328.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ85056.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ96247.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAQ96347.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAR06629.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS47716.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS49120.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS60242.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS66569.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS72084.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS76643.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAS83230.1| heat-shock protein IbpA [Escherichia coli]
 emb|CTP94169.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|ASW61977.1| small heat shock protein IbpA [Escherichia coli]
 gb|ASX03718.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAT80664.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAT82225.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAT91423.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAT96017.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAT99981.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAU05973.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAU10842.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAU12667.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAU24908.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAU33141.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAX42936.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAX47813.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAX53901.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASZ43668.1| heat-shock protein IbpA [Escherichia coli]
 gb|ASZ48155.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAY68113.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PAY69877.1| heat-shock protein IbpA [Shigella boydii]
 gb|PAY79651.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PAY81643.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PAY90711.1| heat-shock protein IbpA [Shigella boydii]
 gb|PAY92053.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PAY95488.1| heat-shock protein IbpA [Shigella boydii]
 gb|PAZ57032.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAZ65477.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAZ72768.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAZ87067.1| heat-shock protein IbpA [Escherichia coli]
 gb|PAZ93230.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB10661.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB15858.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK10835.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK13323.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK17927.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK22602.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK29647.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK34868.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK40878.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBK45801.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB71028.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB76103.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB80963.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB85924.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB90865.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATB96006.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATC00708.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATC09832.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATC10373.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATC15195.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN55870.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN57217.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN62027.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN71684.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN75017.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN85411.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN86183.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBN91899.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO09591.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PBO43862.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO44553.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO56226.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO58300.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO59330.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO72278.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO72560.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO79029.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBO94548.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PBO98441.1| heat-shock protein IbpA [Shigella boydii]
 gb|PBO99902.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBP05362.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PBP05792.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PBQ36592.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ41226.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ46364.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ53445.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ56450.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ62444.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ67060.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ72082.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ77358.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ83147.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ87896.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ92464.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBQ98706.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR04556.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR09746.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR18790.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR25079.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR30562.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR34710.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR39486.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR44745.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR53339.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR57208.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR61401.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR66835.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR72513.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR76759.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR82931.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR88700.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR93988.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBR98210.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS01316.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS08185.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS21589.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS26507.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS31454.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS37598.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS42719.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS49723.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS51836.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS55891.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS60453.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS66422.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS72377.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS78319.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS83049.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS86866.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS89320.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS97350.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBS99178.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT03978.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT08799.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT17200.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT17716.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT24242.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT28275.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT33116.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT38853.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT39523.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT47178.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT53713.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT54934.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT60998.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT66203.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT73019.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT79360.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT80274.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT87061.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT89085.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT94429.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBT98257.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU03059.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU11481.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU11721.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU19305.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU22429.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU27262.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU31992.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU37253.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU42583.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU47446.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU51991.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU56512.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU61690.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU69141.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU75527.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU79561.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU86438.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU91333.1| heat-shock protein IbpA [Escherichia coli]
 gb|PBU94303.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCD48711.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCD55485.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCD73217.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG23466.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG28127.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG34011.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG39576.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG44183.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG48533.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCG53947.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATG08273.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATG12587.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATG64245.1| heat-shock protein IbpA [Escherichia coli O104:H21 str.
           CFSAN002236]
 gb|PCM07261.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM08477.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM16412.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM20257.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM24182.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM33117.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCM37368.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO24503.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO32177.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO54798.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO62157.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO75895.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO80921.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO89035.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCO97191.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCP03356.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCQ51889.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCQ83351.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCQ90125.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCQ94494.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCR55249.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCR57756.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCR65063.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCR67793.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCR76364.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS33022.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS35847.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS39603.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS48544.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS50376.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS57111.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS60803.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS68350.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS72713.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS76454.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS81595.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS85409.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCS92274.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT00584.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT11814.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT19341.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT21636.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT28546.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT31578.1| heat-shock protein IbpA [Escherichia coli]
 gb|PCT42331.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATH69880.1| heat-shock protein IbpA [Shigella flexneri 1c]
 gb|ATH86675.1| heat-shock protein IbpA [Shigella sonnei]
 gb|ATI04404.1| heat-shock protein IbpA [Escherichia coli M12]
 gb|PDM31992.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDM44125.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDM86606.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDM91185.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDM95865.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDN02417.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDN90283.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDN92421.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDN96381.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO14545.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO21894.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO23427.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO28073.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO36397.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO36937.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO43048.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO50675.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO55501.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO56899.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO61182.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDO68201.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDS07881.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDS15507.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDS20254.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDT96244.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU01690.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU07155.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU11948.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU18052.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU23192.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU28181.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU33798.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU39058.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU42788.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU49205.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU55235.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU62700.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU67806.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU73132.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU78939.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU84775.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU90643.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDU94127.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV01054.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV06019.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV11536.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV16955.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV23526.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV27971.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV32766.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV38757.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV44075.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV51251.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV56248.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV56734.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV64022.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV71382.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV77316.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV82337.1| heat-shock protein IbpA [Escherichia coli]
 gb|PDV92851.1| heat-shock protein IbpA [Escherichia coli]
 gb|PEG24575.1| heat-shock protein IbpA [Escherichia coli]
 gb|PEH63823.1| heat-shock protein IbpA [Escherichia coli]
 gb|PEH94381.1| heat-shock protein IbpA [Escherichia coli]
 gb|PEI00167.1| heat-shock protein IbpA [Escherichia coli]
 gb|PEI19171.1| heat-shock protein IbpA [Escherichia coli]
 gb|PFF94002.1| heat-shock protein IbpA [Escherichia albertii]
 gb|PGF61836.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF64607.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF71954.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF75981.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF82752.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF86923.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF88849.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGF95755.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG01356.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG03513.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG14365.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG14722.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG23230.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG26980.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG28838.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG35048.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG37485.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG44906.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG54407.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG55481.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG57184.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG69830.1| heat-shock protein IbpA [Escherichia coli]
 gb|PGG70848.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHG88351.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHG92132.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHH32382.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATM10542.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATM26444.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATM82814.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHK63513.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHK72030.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL24556.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL32559.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL33949.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL41023.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL46022.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL51552.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL52985.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL57901.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL64013.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL70637.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL94400.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHL98705.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHN14385.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATO77602.1| heat-shock protein IbpA [Escherichia coli O91 str. RM7190]
 gb|PHU44897.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PHU49369.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PHU53870.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PHU58409.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PHU62503.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PHU66938.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PHU69936.1| heat-shock protein IbpA [Shigella boydii]
 gb|PHU75571.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PHU79979.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PHU82990.1| heat-shock protein IbpA [Shigella boydii]
 gb|PHU88559.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PHU91762.1| heat-shock protein IbpA [Shigella boydii]
 gb|PHU95936.1| heat-shock protein IbpA [Shigella boydii]
 emb|SLM08837.1| heat shock protein IbpA [Escherichia coli O127:H6]
 emb|SNU19361.1| heat shock protein IbpA [Escherichia coli O127:H6]
 gb|ATP24276.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHW97267.1| heat-shock protein IbpA [Escherichia coli]
 gb|PHX02525.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIA84590.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM06734.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM12678.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM16464.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM23120.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM28431.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM32170.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM37047.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM40392.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM48061.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM56589.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIM65422.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATU32994.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATV11061.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATV48806.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATV78043.1| heat-shock protein IbpA [Escherichia coli]
 gb|PIS72896.1| heat shock protein IbpA [Escherichia coli O55:H7 str. USDA 5905]
 gb|ATW95698.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX10105.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX12583.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX18279.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX41098.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX48530.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX52689.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX57336.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF56821.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF60886.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF65338.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF70900.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF78136.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF78826.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF84595.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF88555.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJF95909.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG01160.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG05596.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG09625.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG14692.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG19982.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG24329.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG25556.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG35379.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJG74363.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATY20458.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATY25792.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJH98746.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJI58001.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJI62797.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJN77784.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJO17645.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATX33557.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATZ40370.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJR33150.1| heat shock protein IbpA [Escherichia coli O157:H7 str. TW14313]
 gb|PJR39001.1| heat shock protein IbpA [Escherichia coli O55:H7 str. TB182A]
 gb|PJR44565.1| heat shock protein IbpA [Escherichia coli O157:H7 str. EC1825]
 gb|PJW25018.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW32412.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW35109.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW39582.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW48761.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW54355.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW60387.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW63154.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW69264.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW74807.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW80136.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW84374.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW89015.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJW97391.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJX03990.1| heat-shock protein IbpA [Escherichia coli]
 gb|ATZ32697.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia coli]
 gb|PJX79237.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJX83204.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJX90156.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJX98530.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY01840.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY08897.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY15518.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY19088.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY24396.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY28407.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY32920.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY39540.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY46257.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY49867.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY52962.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY61922.1| heat-shock protein IbpA [Escherichia coli]
 gb|PJY90025.1| heat-shock protein IbpA [Shigella sonnei]
 emb|SMZ47702.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|AUA41534.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUA44384.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD55371.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD57920.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD65768.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD71423.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD74976.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD86620.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD88952.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKD94558.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE05327.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE09169.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE79383.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE84134.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE88654.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE93260.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKE97772.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKF06835.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKF17613.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKF53013.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKG05286.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKI92598.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKI93962.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ01561.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ08261.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ10095.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ15986.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ23723.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ24637.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ34735.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ37565.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ46156.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKJ50835.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUF78003.1| heat-shock protein IbpA [Escherichia coli O121:H19]
 gb|AUG18401.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|PKQ96109.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKR63691.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKR67895.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKR73215.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUG66858.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUG95656.1| small heat shock protein IbpA [Escherichia coli]
 gb|PKZ10318.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKZ32565.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKZ50420.1| heat-shock protein IbpA [Escherichia coli]
 gb|PKZ77688.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLA85500.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB01159.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB58573.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB61925.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB69346.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB71023.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLB78910.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUJ88985.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUJ93997.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUJ98940.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUK04372.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUK09331.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUK14588.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUK19720.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLJ80178.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLJ82312.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLJ90992.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLJ95743.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLK02238.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLK08462.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLK10838.1| heat-shock protein IbpA [Escherichia coli]
 gb|PLR13529.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUF93170.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUL61439.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUL67930.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUL82809.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUL92555.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUM05948.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUM20339.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUN45549.1| heat-shock protein IbpA [Escherichia coli]
 gb|PMB61980.1| heat-shock protein IbpA [Escherichia coli]
 gb|PMD82207.1| heat-shock protein IbpA [Escherichia coli]
 gb|PMD86750.1| heat-shock protein IbpA [Escherichia coli]
 gb|PMD89266.1| heat-shock protein IbpA [Escherichia coli]
 gb|PMD98911.1| heat-shock protein IbpA [Escherichia coli]
 emb|SOQ98296.1| heat shock chaperone [Escherichia coli]
 emb|SOQ89351.1| heat shock chaperone [Escherichia coli]
 emb|SOR03308.1| heat shock chaperone [Escherichia coli]
 emb|SOQ85638.1| heat shock chaperone [Escherichia coli]
 emb|SOQ64288.1| heat shock chaperone [Escherichia coli]
 emb|SOQ65457.1| heat shock chaperone [Escherichia coli]
 emb|SOQ76821.1| heat shock chaperone [Escherichia coli]
 emb|SOQ81606.1| heat shock chaperone [Escherichia coli]
 emb|SOQ72988.1| heat shock chaperone [Escherichia coli]
 emb|SOR08797.1| heat shock chaperone [Escherichia coli]
 gb|AUO34579.1| small heat shock protein IbpA [Escherichia coli]
 gb|AUO40452.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUO55248.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNB96763.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNC01573.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNC15595.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND44630.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUQ39588.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND68279.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND74404.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND78775.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND86445.1| heat-shock protein IbpA [Escherichia coli]
 gb|PND96908.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNL71066.1| heat-shock protein IbpA [Escherichia coli O157]
 gb|PNM75624.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PNN27181.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNO48233.1| heat-shock protein IbpA [Shigella sonnei]
 gb|PNO96072.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNP03159.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PNP62158.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUP44576.1| inclusion body protein A - yellow fluorescent protein fusion
           [Escherichia coli]
 gb|AUS36171.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUS67623.1| heat-shock protein IbpA [Escherichia albertii]
 gb|PNR01777.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNR06435.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNR12368.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNR20371.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNR22430.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNS25579.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUT07001.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUN92561.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUT28636.1| heat-shock protein IbpA [Escherichia marmotae]
 gb|PNY52691.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNY56489.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNY66055.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUV21873.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUV31829.1| heat-shock protein IbpA [Escherichia coli]
 gb|POF66956.1| heat-shock protein IbpA [Escherichia coli]
 gb|POF72185.1| heat-shock protein IbpA [Escherichia coli]
 gb|POF78118.1| heat-shock protein IbpA [Escherichia coli]
 gb|POF82717.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUU29929.1| heat-shock protein IbpA [Shigella flexneri]
 gb|POH45634.1| heat-shock protein IbpA [Escherichia coli]
 gb|POH76934.1| heat-shock protein IbpA [Escherichia coli]
 gb|POH92949.1| heat-shock protein IbpA [Escherichia coli]
 gb|POH95062.1| heat-shock protein IbpA [Escherichia coli]
 gb|POI01336.1| heat-shock protein IbpA [Escherichia coli]
 gb|POI05444.1| heat-shock protein IbpA [Escherichia coli]
 gb|POI11617.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL48174.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL50890.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL58799.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL59211.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL70214.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL73276.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL76738.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL85139.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL85400.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL95594.1| heat-shock protein IbpA [Escherichia coli]
 gb|POL98560.1| heat-shock protein IbpA [Escherichia coli]
 gb|POM03627.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUX00292.1| 16 kDa heat shock protein A [Escherichia coli]
 gb|POO35465.1| heat-shock protein IbpA [Escherichia coli]
 gb|POO40507.1| heat-shock protein IbpA [Escherichia coli]
 gb|POO46170.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUY03356.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUY44836.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUY27262.1| Small heat shock protein IbpA [Escherichia coli]
 gb|POR90165.1| heat-shock protein IbpA [Shigella flexneri]
 gb|POR96340.1| heat-shock protein IbpA [Shigella flexneri]
 gb|POS15466.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS19784.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS20795.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS29550.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS35521.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS37980.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS43236.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS44807.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS55120.1| heat-shock protein IbpA [Escherichia coli]
 gb|POS60291.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT04429.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT05612.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT06014.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT16314.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT20105.1| heat-shock protein IbpA [Escherichia coli]
 gb|POT20894.1| heat-shock protein IbpA [Escherichia coli]
 gb|POU28675.1| heat-shock protein IbpA [Escherichia coli]
 gb|POV25318.1| heat-shock protein IbpA [Escherichia coli]
 gb|AUZ91238.1| heat-shock protein IbpA [Escherichia coli]
 gb|POZ07634.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVB43543.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPA53383.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVD30930.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE10619.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE16657.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE21583.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE27575.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE31138.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE35794.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE39107.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE46892.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE53730.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPE91047.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVE95991.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVG01342.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPI93110.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPK20032.1| heat-shock protein IbpA [Klebsiella pneumoniae]
 gb|PPO21171.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPO91935.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPQ50916.1| heat-shock protein IbpA [Escherichia albertii]
 gb|PPV45098.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV48177.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV54896.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV62405.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV62764.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV70664.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV72944.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV86615.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV89603.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV94251.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPV99261.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW04500.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW11200.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW12978.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW15878.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW23730.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW28072.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW29306.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW38373.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW41836.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW47059.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW54201.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW62932.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW63898.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW69029.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW69716.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW79420.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW82315.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW89329.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPW92870.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX01184.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX01462.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX07940.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX13744.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX16771.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX23120.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX23901.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX34182.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX37670.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX43807.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX47945.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX53097.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX57172.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPX60221.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY60807.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY65896.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY66506.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY75420.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY81512.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY81756.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY87899.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY93812.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPY94780.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ05213.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ11405.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ16742.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ19770.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ25921.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ29881.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ34761.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ40725.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ54878.1| heat-shock protein IbpA [Escherichia coli]
 gb|PPZ99868.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA05617.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA06583.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA13615.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA19680.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA21814.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA27224.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA32005.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA38902.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA43004.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA48049.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA53884.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA63324.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQA66714.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQH08386.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQI95866.1| heat-shock protein IbpA [Escherichia fergusonii]
 gb|PQJ00911.1| heat-shock protein IbpA [Escherichia fergusonii]
 gb|PQK20413.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK26996.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK32464.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK33075.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK40725.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK44139.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK50865.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK56040.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK62126.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQK63448.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVI53858.1| heat-shock protein IbpA [Escherichia coli str. K-12 substr. MG1655]
 gb|AVJ15416.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQM80698.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQM93513.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|PQM95682.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN00181.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN01767.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN07714.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|PQN19341.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN25130.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN29850.1| heat-shock protein IbpA [Shigella boydii]
 gb|PQN36644.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN42200.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN47894.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|PQN54572.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|PQN56951.1| heat-shock protein IbpA [Shigella boydii]
 gb|PQN63664.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN66964.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN70674.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN72855.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN77001.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN83031.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN91380.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN96378.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQN98659.1| heat-shock protein IbpA [Shigella dysenteriae]
 gb|PQO05831.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQO11286.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQO15601.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQO18561.1| heat-shock protein IbpA [Shigella flexneri]
 gb|PQO64732.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQO67273.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQO70907.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQO79620.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQO83919.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQO92029.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQP07447.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQP32496.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVJ68942.1| small heat shock protein IbpA [Escherichia coli]
 gb|AVJ74232.1| small heat shock protein IbpA [Escherichia coli]
 gb|PQV18700.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQV19929.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQV25174.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQV33119.1| heat-shock protein IbpA [Escherichia coli]
 gb|PQV39445.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRB38615.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRC26771.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVL31752.1| heat-shock protein IbpA [Escherichia coli O104:H4]
 gb|AVM04435.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP03514.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP06798.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP08412.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP14759.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP19066.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP20454.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP29301.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP34590.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP42570.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP44940.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRP45160.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVM99120.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVN10335.1| small heat shock protein IbpA [Escherichia coli]
 gb|AVL08659.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVN37553.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRT58894.1| heat-shock protein IbpA [Escherichia coli]
 gb|PRW36563.1| small heat shock protein IbpA [Escherichia coli]
 gb|PRW48955.1| small heat shock protein IbpA [Escherichia coli]
 gb|PRW55132.1| small heat shock protein IbpA [Escherichia coli]
 gb|PSB93726.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF26475.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF27145.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF40506.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF44558.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF48953.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF56421.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF57582.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF63439.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF71768.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF73029.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF77033.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF86155.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF90549.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSF92831.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG00378.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG04376.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG08881.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG14011.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG19522.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG22905.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG32866.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG37857.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG42865.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG47332.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG53900.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG56809.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG68497.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG74894.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSG80692.1| heat-shock protein IbpA [Escherichia coli]
 gb|AVP31860.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSK19583.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSK25360.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSL65483.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSL66017.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSL72485.1| heat-shock protein IbpA [Escherichia coli]
 gb|PSL74603.1| heat-shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  276 bits (705), Expect = 2e-90
 Identities = 137/137 (100%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_001586460.1| heat-shock protein IbpA [Escherichia coli]
 gb|ELG08940.1| small heat shock protein ibpA [Escherichia coli KTE50]
 gb|ELH47518.1| small heat shock protein ibpA [Escherichia coli KTE202]
 gb|ELI50505.1| small heat shock protein ibpA [Escherichia coli KTE125]
 gb|EQO67544.1| small heat shock protein ibpA [Escherichia coli HVH 44 (4-2298570)]
 gb|EQO70582.1| small heat shock protein ibpA [Escherichia coli HVH 43 (4-2173468)]
 gb|EQT33482.1| small heat shock protein ibpA [Escherichia coli HVH 182
           (4-0985554)]
 gb|ERB11606.1| small heat shock protein ibpA [Escherichia coli UMEA 3144-1]
 gb|ESP13087.1| small heat shock protein ibpA [Escherichia coli HVH 136
           (4-5970458)]
 gb|EZJ93493.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S1_C3]
 gb|KDX33170.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S1_C2]
 gb|KDX34913.1| small heat shock protein ibpA [Escherichia coli 1-250-04_S1_C1]
 gb|KUS36454.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT23288.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUT63783.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU23208.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU44548.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUU86997.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUV91123.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW17582.1| heat-shock protein IbpA [Escherichia coli]
 gb|KUW79348.1| heat-shock protein IbpA [Escherichia coli]
 gb|KZH71841.1| heat-shock protein IbpA [Escherichia coli]
 gb|OOI77440.1| heat-shock protein IbpA [Escherichia coli]
 gb|AQV29842.1| heat-shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  275 bits (704), Expect = 3e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIH+RGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHIRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (316), Expect = 5e-32
 Identities = 66/128 (51%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ + GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHIRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_096930299.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  275 bits (702), Expect = 5e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQ+QSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQNQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  125 bits (314), Expect = 1e-31
 Identities = 66/128 (51%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  ++QS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQNQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_065222256.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  275 bits (702), Expect = 5e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAH+DEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHSDEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  127 bits (318), Expect = 3e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHSDEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_032188966.1| heat-shock protein IbpA [Escherichia coli]
 gb|KDY61199.1| small heat shock protein ibpA [Escherichia coli 2-460-02_S3_C2]
          Length = 137

 Score =  275 bits (702), Expect = 5e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGF+ESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFSESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFSES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>gb|EGI90059.1| hsp20/alpha crystallin family protein [Shigella boydii 5216-82]
          Length = 137

 Score =  275 bits (702), Expect = 5e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKG+HADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGSHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  127 bits (318), Expect = 3e-32
 Identities = 67/128 (52%), Positives = 88/128 (68%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG+    ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGSHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_105274419.1| heat shock protein IbpA [Escherichia sp. MOD1-EC7003]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHA+EQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHAEEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  127 bits (319), Expect = 2e-32
 Identities = 67/128 (52%), Positives = 88/128 (68%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG   + ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHAEEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_097415674.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPE KKPRRIEIN
Sbjct: 121 LERVIPEVKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_095764430.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ24895.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ30942.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ35986.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ39487.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ43706.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ53083.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ54561.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ73172.1| heat shock protein IbpA [Escherichia coli]
 gb|PAZ81199.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVV+GAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVEGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  125 bits (313), Expect = 2e-31
 Identities = 66/128 (51%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L V+G     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVEGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_089625119.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDR FNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRFFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  125 bits (313), Expect = 2e-31
 Identities = 66/128 (51%), Positives = 86/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+  N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRFFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>gb|EIQ16955.1| small heat shock protein ibpA [Shigella flexneri K-315]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRI IAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRITIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  128 bits (322), Expect = 7e-33
 Identities = 68/128 (53%), Positives = 88/128 (68%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRIT+A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRITIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_054628017.1| heat shock protein IbpA [Escherichia coli]
 gb|KPO21488.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKG HADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGVHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGVHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_053890241.1| heat-shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGF ESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFTESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFTES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_024250412.1| MULTISPECIES: heat shock protein IbpA [Enterobacteriaceae]
 gb|OAF90920.1| Small heat shock protein ibpA [Escherichia coli PCN009]
 gb|APK51516.1| heat shock protein IbpA [Escherichia coli]
 gb|OSQ33206.1| heat-shock protein IbpA [Escherichia coli]
 gb|OZM97982.1| heat-shock protein IbpA [Escherichia coli]
 gb|PNY39182.1| heat shock protein IbpA [Escherichia coli]
 gb|PSG28427.1| heat shock protein IbpA [Escherichia coli]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 137/137 (100%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFA+SE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAKSE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (316), Expect = 5e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAKS 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


>ref|WP_032329610.1| heat-shock protein IbpA [Escherichia coli]
 gb|EYV92714.1| heat shock protein IbpA [Escherichia coli O86:H34 str. 99-3124]
          Length = 137

 Score =  274 bits (701), Expect = 7e-90
 Identities = 136/137 (99%), Positives = 136/137 (99%)
 Frame = +3

Query: 123 MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 302
           MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE
Sbjct: 1   MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESE 60

Query: 303 LEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 482
           LEIT QDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID
Sbjct: 61  LEITTQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYID 120

Query: 483 LERVIPEAKKPRRIEIN 533
           LERVIPEAKKPRRIEIN
Sbjct: 121 LERVIPEAKKPRRIEIN 137



 Score =  126 bits (317), Expect = 4e-32
 Identities = 67/128 (52%), Positives = 87/128 (67%), Gaps = 3/128 (2%)
 Frame = +3

Query: 648  MRNFDLSPLMRQWIGFDKLANALQNAGESQS---FPPYNIEKSDDNHYRITLALAGFRQE 818
            MRNFDLSPL R  IGFD+L N L+N  +SQS   +PPYN+E  D+NHYRI +A+AGF + 
Sbjct: 1    MRNFDLSPLYRSAIGFDRLFNHLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59

Query: 819  DLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHI 998
            +LEI  +   L VKG     ++E+ +L+QG+  + F   F LAEN+ V GA  VNGLL+I
Sbjct: 60   ELEITTQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIHVRGANLVNGLLYI 119

Query: 999  DLIRNEPE 1022
            DL R  PE
Sbjct: 120  DLERVIPE 127


Top