BLASTX nr result
ID: Acanthopanax22_contig00000023
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Acanthopanax22_contig00000023
(1232 letters)
Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects
149,584,005 sequences; 54,822,741,787 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
gb|ABE09717.1| hypothetical protein UTI89_C4290 [Escherichia col... 306 e-100
gb|AAN83095.1|AE016769_210 Hypothetical protein c4663 [Escherich... 305 2e-99
gb|ABJ03207.1| conserved hypothetical protein [Escherichia coli ... 301 3e-98
ref|WP_097416670.1| F0F1 ATP synthase subunit B [Escherichia coli] 242 6e-76
ref|WP_096324138.1| F0F1 ATP synthase subunit B [Escherichia coli] 242 6e-76
ref|WP_077580791.1| F0F1 ATP synthase subunit B [Escherichia col... 242 6e-76
ref|WP_075331516.1| F0F1 ATP synthase subunit B [Shigella boydii... 242 6e-76
ref|WP_001052219.1| MULTISPECIES: ATP synthase subunit B [Proteo... 242 6e-76
ref|WP_052934231.1| ATP F0F1 synthase subunit B [Escherichia col... 242 6e-76
ref|WP_033810871.1| F0F1 ATP synthase subunit B [Escherichia coli] 242 6e-76
ref|WP_032255600.1| MULTISPECIES: F0F1 ATP synthase subunit B [E... 242 6e-76
ref|WP_001052217.1| F0F1 ATP synthase subunit B [Escherichia col... 242 6e-76
ref|WP_023568271.1| F0F1 ATP synthase subunit B [Escherichia col... 242 6e-76
ref|WP_001052218.1| F0F1 ATP synthase subunit B [Escherichia col... 242 6e-76
ref|WP_001052220.1| ATP synthase subunit B [Escherichia coli] >g... 241 9e-76
ref|WP_016235054.1| ATP synthase subunit B [Escherichia coli] >g... 241 9e-76
ref|WP_062903466.1| F0F1 ATP synthase subunit B [Escherichia col... 241 2e-75
ref|WP_021573472.1| ATP synthase subunit B [Escherichia coli] >g... 241 2e-75
ref|WP_001617354.1| ATP synthase subunit B [Escherichia coli] >g... 241 2e-75
ref|WP_100541683.1| F0F1 ATP synthase subunit B [Escherichia col... 240 2e-75
>gb|ABE09717.1| hypothetical protein UTI89_C4290 [Escherichia coli UTI89]
Length = 245
Score = 306 bits (784), Expect = e-100
Identities = 161/225 (71%), Positives = 161/225 (71%)
Frame = +2
Query: 2 TQVNKLLQNIRERVKTTIFSHNPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV 181
TQVNKLLQNIRERVKTTIFSH PNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV
Sbjct: 21 TQVNKLLQNIRERVKTTIFSHYPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV 80
Query: 182 FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYXXXXXXXXXXXXXX 361
FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPY
Sbjct: 81 FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYSSATSLSTMSLLAA 140
Query: 362 XXXERSMIFSAPATARIATXXXXXXXXXXXXXXXXXXXWATILVRXXXXXXXXXXRICER 541
ERSMIFSAPATARIAT WATILVR RICER
Sbjct: 141 SSTERSMIFSAPATARIATCLRSSSRARLRSASISACAWATILVRSCSASAFASSRICER 200
Query: 542 RLFACSMITWXXXXXXXXXXXXXXXXRSRSLCARSAEARPSAISF 676
RL ACSMITW RSRSLCARSAEARPSAISF
Sbjct: 201 RLLACSMITWASAFAFFSWSVALAFARSRSLCARSAEARPSAISF 245
>gb|AAN83095.1|AE016769_210 Hypothetical protein c4663 [Escherichia coli CFT073]
gb|AER86777.1| hypothetical protein i02_4254 [Escherichia coli str. 'clone D i2']
gb|AER91696.1| hypothetical protein i14_4254 [Escherichia coli str. 'clone D i14']
Length = 245
Score = 305 bits (781), Expect = 2e-99
Identities = 160/225 (71%), Positives = 161/225 (71%)
Frame = +2
Query: 2 TQVNKLLQNIRERVKTTIFSHNPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV 181
TQVNKLLQNIRER+KTTIFSH PNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV
Sbjct: 21 TQVNKLLQNIRERLKTTIFSHYPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFV 80
Query: 182 FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYXXXXXXXXXXXXXX 361
FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPY
Sbjct: 81 FGYLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYSSATSLSTMSLLAA 140
Query: 362 XXXERSMIFSAPATARIATXXXXXXXXXXXXXXXXXXXWATILVRXXXXXXXXXXRICER 541
ERSMIFSAPATARIAT WATILVR RICER
Sbjct: 141 SSTERSMIFSAPATARIATCLRSSSRARLRSASISACAWATILVRSCSASAFASSRICER 200
Query: 542 RLFACSMITWXXXXXXXXXXXXXXXXRSRSLCARSAEARPSAISF 676
RL ACSMITW RSRSLCARSAEARPSAISF
Sbjct: 201 RLLACSMITWASAFAFFSWSVALAFARSRSLCARSAEARPSAISF 245
>gb|ABJ03207.1| conserved hypothetical protein [Escherichia coli APEC O1]
Length = 223
Score = 301 bits (771), Expect = 3e-98
Identities = 158/223 (70%), Positives = 159/223 (71%)
Frame = +2
Query: 8 VNKLLQNIRERVKTTIFSHNPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFVFG 187
+NKLLQNIRERVKTTIFSH PNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFVFG
Sbjct: 1 MNKLLQNIRERVKTTIFSHYPNQVLTVFVQLLTTNCDKRLGERFWRKRAREKLCHLFVFG 60
Query: 188 YLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYXXXXXXXXXXXXXXXX 367
YLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPY
Sbjct: 61 YLGGKRQHVLPAFYTLVFDGKVKSCFGVGASYRNKFRHQPLPPYSSATSLSTMSLLAASS 120
Query: 368 XERSMIFSAPATARIATXXXXXXXXXXXXXXXXXXXWATILVRXXXXXXXXXXRICERRL 547
ERSMIFSAPATARIAT WATILVR RICERRL
Sbjct: 121 TERSMIFSAPATARIATCLRSSSRARLRSASISACAWATILVRSCSASAFASSRICERRL 180
Query: 548 FACSMITWXXXXXXXXXXXXXXXXRSRSLCARSAEARPSAISF 676
ACSMITW RSRSLCARSAEARPSAISF
Sbjct: 181 LACSMITWASAFAFFSWSVALAFARSRSLCARSAEARPSAISF 223
>ref|WP_097416670.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAELKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_096324138.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 135/155 (87%), Positives = 136/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAEXKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_077580791.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOH60793.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWR37486.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PHK70772.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAHAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_075331516.1| F0F1 ATP synthase subunit B [Shigella boydii]
gb|OOO84436.1| F0F1 ATP synthase subunit B [Shigella boydii]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVVQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_001052219.1| MULTISPECIES: ATP synthase subunit B [Proteobacteria]
ref|NP_312705.1| ATP synthase F0F1 subunit B [Escherichia coli O157:H7 str. Sakai]
ref|NP_418192.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli str. K-12 substr. MG1655]
ref|NP_709549.1| ATP synthase F0F1 subunit B [Shigella flexneri 2a str. 301]
ref|YP_405421.1| ATP synthase F0F1 subunit B [Shigella dysenteriae Sd197]
ref|YP_002410215.1| F0F1 ATP synthase subunit B [Escherichia coli IAI39]
ref|YP_002414901.1| F0 sector of membrane-bound ATP synthase subunit b [Escherichia
coli UMN026]
ref|YP_006781674.1| F0F1 ATP synthase subunit B [Escherichia coli O104:H4 str.
2011C-3493]
sp|P0ABA2.1|ATPF_ECO57 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|P0ABA1.1|ATPF_ECOL6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|P0ABA0.1|ATPF_ECOLI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|P0ABA3.1|ATPF_SHIFL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q1R4J6.1|ATPF_ECOUT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q0SYU0.1|ATPF_SHIF8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q0TAX3.1|ATPF_ECOL5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q31UN6.1|ATPF_SHIBS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q329S5.1|ATPF_SHIDS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|Q3YVP0.1|ATPF_SHISS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B2TUN9.1|ATPF_SHIB3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|A7ZTU8.1|ATPF_ECO24 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B5YXE0.1|ATPF_ECO5E RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B1X9W4.1|ATPF_ECODH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|A8A6J9.1|ATPF_ECOHS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B1IX02.1|ATPF_ECOLC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B6I3X3.1|ATPF_ECOSE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B1LL63.1|ATPF_ECOSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
sp|B7LK81.1|ATPF_ESCF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
F(0) sector subunit b; AltName: Full=ATPase subunit I;
AltName: Full=F-type ATPase subunit b; Short=F-ATPase
subunit b
gb|AAG58939.1|AE005605_7 membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
O157:H7 str. EDL933]
gb|AAN83096.1|AE016769_211 ATP synthase B chain [Escherichia coli CFT073]
gb|AAA83871.1| integral membrane proton channel F0 subunit B [Escherichia coli]
gb|AAA24733.1| ATP synthase b subunit [Escherichia coli]
gb|AAA62088.1| ATP synthase F0 subunit b [Escherichia coli]
emb|CAA23516.1| unnamed protein product [Escherichia coli]
emb|CAA23523.1| atpF [Escherichia coli]
emb|CAA25778.1| unnamed protein product [Escherichia coli]
gb|AAC76759.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli str. K-12 substr. MG1655]
dbj|BAB38101.1| membrane-bound ATP synthase subunit b AtpF [Escherichia coli
O157:H7 str. Sakai]
gb|AAN45256.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
flexneri 2a str. 301]
gb|AAP18941.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
flexneri 2a str. 2457T]
gb|AAZ90422.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella sonnei
Ss046]
gb|ABB63930.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
dysenteriae Sd197]
gb|ABB68222.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella boydii
Sb227]
dbj|BAE77552.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli str. K-12 substr. W3110]
gb|ABE09718.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli
UTI89]
gb|ABG71906.1| ATP synthase B chain [Escherichia coli 536]
gb|ABF05775.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
flexneri 5 str. 8401]
gb|ABV08153.1| ATP synthase F0, B subunit [Escherichia coli HS]
gb|ABV18345.1| ATP synthase F0, B subunit [Escherichia coli O139:H28 str. E24377A]
gb|ACA79854.1| ATP synthase F0, B subunit [Escherichia coli ATCC 8739]
gb|ACB04779.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli str. K-12 substr. DH10B]
gb|ACB16426.1| ATP synthase F0, B subunit [Escherichia coli SMS-3-5]
gb|ACD06747.1| ATP synthase F0, B subunit [Shigella boydii CDC 3083-94]
gb|EDU35461.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196]
gb|EDU55099.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113]
gb|EDU66196.1| ATP synthase F0, B subunit [Escherichia coli 53638]
gb|EDU71265.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076]
gb|EDU77417.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401]
gb|EDU83020.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486]
gb|EDU88268.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501]
gb|EDU91704.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869]
gb|EDU97174.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508]
gb|EDV63865.1| ATP synthase F0, B subunit [Escherichia coli B7A]
gb|EDV68969.1| ATP synthase F0, B subunit [Escherichia coli F11]
gb|EDV83160.1| ATP synthase F0, B subunit [Escherichia coli E22]
gb|EDV87932.1| ATP synthase F0, B subunit [Escherichia coli E110019]
gb|EDX30137.1| ATP synthase F0, B subunit [Escherichia coli B171]
gb|EDX36620.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012]
gb|EDX41484.1| ATP synthase F0, B subunit [Escherichia coli 101-1]
gb|EDZ77572.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206]
gb|EDZ82182.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045]
gb|EDZ88834.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042]
gb|ACI34939.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115]
gb|ACI75231.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
gb|ACI75232.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
gb|ACI75233.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
gb|ACI75234.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
gb|ACI75235.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
dbj|BAG79550.1| ATP synthase subunit B [Escherichia coli SE11]
emb|CAS11594.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O127:H6 str. E2348/69]
gb|EEC29573.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14588]
emb|CAV00825.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli 55989]
emb|CAQ91469.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
fergusonii ATCC 35469]
emb|CAR00714.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli IAI1]
emb|CAR05364.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli S88]
emb|CAR20446.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli IAI39]
emb|CAR10410.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli ED1a]
emb|CAR15406.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli UMN026]
gb|EEH70947.1| ATP synthase subunit B [Escherichia sp. 1_1_43]
gb|EEH89060.1| ATP synthase subunit B [Escherichia sp. 3_2_53FAA]
gb|EEJ49702.1| ATP synthase F0, B subunit [Escherichia coli 83972]
gb|ACR63063.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli BW2952]
emb|CAQ34081.1| ATP synthase, F0 complex, b subunit, subunit of b subunit complex,
ATP synthase, F0 complex and ATP synthase [Escherichia
coli BL21(DE3)]
gb|ACT31275.1| ATP synthase F0, B subunit [Escherichia coli 'BL21-Gold(DE3)pLysS
AG']
gb|ACT41260.1| F0F1 ATP synthase subunit B [Escherichia coli B str. REL606]
gb|ACT45415.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli BL21(DE3)]
gb|ACT74503.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O157:H7 str. TW14359]
dbj|BAI28000.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
[Escherichia coli O26:H11 str. 11368]
dbj|BAI33123.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
[Escherichia coli O103:H2 str. 12009]
dbj|BAI38321.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
[Escherichia coli O111:H- str. 11128]
gb|ACX41829.1| ATP synthase F0, B subunit [Escherichia coli DH1]
dbj|BAI57124.1| ATP synthase subunit B [Escherichia coli SE15]
gb|ADA76118.1| ATP synthase B chain [Shigella flexneri 2002017]
emb|CBG36949.1| ATP synthase subunit B [Escherichia coli 042]
gb|ADD58994.1| ATP synthase B chain [Escherichia coli O55:H7 str. CB9615]
gb|EFE61130.1| ATP synthase F0 [Escherichia coli B088]
gb|EFE98700.1| F0F1 ATP synthase subunit B [Escherichia coli FVEC1412]
gb|EFF04233.1| ATP synthase F0 [Escherichia coli B185]
gb|EFF10814.1| ATP synthase F0 [Escherichia coli B354]
gb|ADE89427.1| ATP synthase F0, B subunit [Escherichia coli IHE3034]
gb|EFI18469.1| ATP synthase subunit B [Escherichia coli FVEC1302]
gb|EFI90271.1| ATP synthase F0, B subunit [Escherichia coli MS 196-1]
gb|EFJ56930.1| ATP synthase F0, B subunit [Escherichia coli MS 185-1]
gb|EFJ61381.1| ATP synthase F0, B subunit [Escherichia coli MS 200-1]
gb|EFJ64409.1| ATP synthase F0, B subunit [Escherichia coli MS 175-1]
gb|EFJ75921.1| ATP synthase F0, B subunit [Escherichia coli MS 198-1]
gb|EFJ81968.1| ATP synthase F0, B subunit [Escherichia coli MS 69-1]
gb|EFJ88515.1| ATP synthase F0, B subunit [Escherichia coli MS 84-1]
gb|EFJ91924.1| ATP synthase F0, B subunit [Escherichia coli MS 45-1]
gb|EFJ99609.1| ATP synthase F0, B subunit [Escherichia coli MS 115-1]
gb|EFK01651.1| ATP synthase F0, B subunit [Escherichia coli MS 182-1]
gb|EFK13643.1| ATP synthase F0, B subunit [Escherichia coli MS 116-1]
gb|EFK17845.1| ATP synthase F0, B subunit [Escherichia coli MS 21-1]
gb|EFK23369.1| ATP synthase F0, B subunit [Escherichia coli MS 187-1]
gb|EFK44024.1| ATP synthase F0, B subunit [Escherichia coli MS 119-7]
gb|EFK52963.1| ATP synthase F0, B subunit [Escherichia coli MS 107-1]
gb|EFK66883.1| ATP synthase F0, B subunit [Escherichia coli MS 124-1]
gb|EFK75894.1| ATP synthase F0, B subunit [Escherichia coli MS 78-1]
gb|EFK92057.1| ATP synthase F0, B subunit [Escherichia coli MS 146-1]
gb|EFM50765.1| F0F1 ATP synthase subunit B [Escherichia coli NC101]
gb|EFN37384.1| ATP synthase F0, B subunit [Escherichia coli W]
gb|ADN48650.1| membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
ABU 83972]
gb|ADN73114.1| F0F1 ATP synthase subunit B [Escherichia coli UM146]
gb|EFO57848.1| ATP synthase F0, B subunit [Escherichia coli MS 145-7]
gb|EFP73422.1| ATP synthase F0, B subunit [Shigella dysenteriae 1617]
emb|CBJ03531.1| ATP synthase subunit B [Escherichia coli ETEC H10407]
gb|EFQ00554.1| ATP synthase F0, B subunit [Escherichia coli 1827-70]
gb|EFR15323.1| ATP synthase F0, B subunit [Escherichia coli 2362-75]
gb|EFS12096.1| ATP synthase F0, B subunit [Shigella flexneri 2a str. 2457T]
gb|ADT77373.1| F0 sector of membrane-bound ATP synthase, subunit B [Escherichia
coli W]
dbj|BAJ45480.1| ATP synthase subunit B [Escherichia coli DH1]
gb|EFU34539.1| ATP synthase F0, B subunit [Escherichia coli MS 85-1]
gb|EFU44989.1| ATP synthase F0, B subunit [Escherichia coli MS 110-3]
gb|EFU52174.1| ATP synthase F0, B subunit [Escherichia coli MS 153-1]
gb|EFU56169.1| ATP synthase F0, B subunit [Escherichia coli MS 16-3]
gb|EFW49763.1| ATP synthase B chain [Shigella dysenteriae CDC 74-1112]
gb|EFW55024.1| ATP synthase B chain [Shigella boydii ATCC 9905]
gb|EFW61017.1| ATP synthase B chain [Shigella flexneri CDC 796-83]
gb|EFW65810.1| ATP synthase B chain [Escherichia coli O157:H7 str. EC1212]
gb|EFW68352.1| ATP synthase B chain [Escherichia coli WV_060327]
gb|EFW75812.1| ATP synthase B chain [Escherichia coli EC4100B]
gb|EFX09079.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. G5101]
gb|EFX13940.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. 493-89]
gb|EFX18666.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. H 2687]
gb|EFX23454.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. 3256-97]
gb|EFX28578.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. USDA
5905]
gb|EFX33277.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. LSU-61]
gb|EFZ41600.1| ATP synthase F0, B subunit [Escherichia coli EPECa14]
gb|EFZ46931.1| ATP synthase F0, B subunit [Escherichia coli E128010]
gb|EFZ52749.1| ATP synthase F0, B subunit [Shigella sonnei 53G]
gb|EFZ58990.1| ATP synthase F0, B subunit [Escherichia coli LT-68]
gb|EFZ63340.1| ATP synthase F0, B subunit [Escherichia coli OK1180]
gb|EFZ74811.1| ATP synthase F0, B subunit [Escherichia coli RN587/1]
gb|ADX53160.1| ATP synthase F0, B subunit [Escherichia coli KO11FL]
gb|EGB31291.1| ATP synthase F0 [Escherichia coli E1520]
gb|EGB35414.1| ATP synthase F0 [Escherichia coli E482]
gb|EGB40292.1| ATP synthase F0 [Escherichia coli H120]
gb|EGB45863.1| ATP synthase F0 [Escherichia coli H252]
gb|EGB50747.1| ATP synthase F0 [Escherichia coli H263]
gb|EGB55452.1| ATP synthase F0 [Escherichia coli H489]
gb|EGB61255.1| ATP synthase F0 [Escherichia coli M863]
gb|EGB66461.1| ATP synthase F0 [Escherichia coli TA007]
gb|EGB70300.1| ATP synthase F0 [Escherichia coli TW10509]
gb|EGB77223.1| ATP synthase F0, B subunit [Escherichia coli MS 57-2]
gb|EGB81977.1| ATP synthase F0, B subunit [Escherichia coli MS 60-1]
gb|EGB87685.1| ATP synthase F0, B subunit [Escherichia coli MS 117-3]
gb|EGC05616.1| ATP synthase F0 [Escherichia fergusonii B253]
gb|EGC09834.1| ATP synthase F0 [Escherichia coli E1167]
gb|EGC97401.1| F0F1 ATP synthase subunit B [Escherichia fergusonii ECD227]
gb|EGD64315.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1044]
gb|EGD65371.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1125]
gb|EGE62590.1| ATP synthase F0, B subunit [Escherichia coli STEC_7v]
gb|EGH36568.1| ATP synthase B chain [Escherichia coli AA86]
gb|EGI08983.1| ATP synthase F0, B subunit [Escherichia coli H736]
gb|EGI14204.1| ATP synthase F0, B subunit [Escherichia coli M605]
gb|EGI19491.1| ATP synthase F0, B subunit [Escherichia coli M718]
gb|EGI25328.1| ATP synthase F0, B subunit [Escherichia coli TA206]
gb|EGI29886.1| ATP synthase F0, B subunit [Escherichia coli TA143]
gb|EGI34568.1| ATP synthase F0, B subunit [Escherichia coli TA271]
gb|EGI44337.1| ATP synthase F0, B subunit [Escherichia coli H591]
gb|EGI49046.1| ATP synthase F0, B subunit [Escherichia coli H299]
gb|EGI89792.1| ATP synthase F0, B subunit [Shigella boydii 5216-82]
gb|EGI89933.1| ATP synthase F0, B subunit [Shigella dysenteriae 155-74]
gb|EGI94495.1| ATP synthase F0, B subunit [Shigella boydii 3594-74]
gb|EGJ08167.1| ATP synthase F0, B subunit [Escherichia coli D9]
gb|AEE59060.1| ATP synthase F0, B subunit AtpF [Escherichia coli UMNK88]
gb|EGJ81153.1| ATP synthase F0, B subunit [Shigella flexneri 4343-70]
gb|EGJ81307.1| ATP synthase F0, B subunit [Shigella flexneri K-671]
gb|EGJ82158.1| ATP synthase F0, B subunit [Shigella flexneri 2747-71]
gb|EGJ94244.1| ATP synthase F0, B subunit [Shigella flexneri 2930-71]
gb|EGK16669.1| ATP synthase F0, B subunit [Shigella flexneri K-218]
gb|EGK17645.1| ATP synthase F0, B subunit [Shigella flexneri K-272]
gb|EGK32840.1| ATP synthase F0, B subunit [Shigella flexneri K-304]
gb|EGK33075.1| ATP synthase F0, B subunit [Shigella flexneri K-227]
gb|EGM59754.1| ATP synthase F0, B subunit [Shigella flexneri SFJ17B]
gb|AEJ59146.1| ATP synthase F0, B subunit [Escherichia coli UMNF18]
gb|EGR72234.1| F0F1 ATP synthase subunit B [Escherichia coli O104:H4 str.
LB226692]
gb|EGT69269.1| hypothetical protein C22711_3299 [Escherichia coli O104:H4 str.
C227-11]
gb|EGU25202.1| F0F1 ATP synthase subunit B [Escherichia coli XH140A]
gb|EGU99760.1| ATP synthase F0, B subunit [Escherichia coli MS 79-10]
gb|EGV48024.1| F0F1 ATP synthase subunit B [Escherichia coli XH001]
gb|EGW63780.1| ATP synthase F0, B subunit [Escherichia coli 2534-86]
gb|EGW64344.1| ATP synthase F0, B subunit [Escherichia coli STEC_C165-02]
gb|EGW66872.1| ATP synthase F0, B subunit [Escherichia coli STEC_B2F1]
gb|EGW79486.1| ATP synthase F0, B subunit [Escherichia coli STEC_94C]
gb|EGW80970.1| ATP synthase F0, B subunit [Escherichia coli 3030-1]
gb|EGW85906.1| ATP synthase F0, B subunit [Escherichia coli STEC_DG131-3]
gb|EGW90118.1| ATP synthase F0, B subunit [Escherichia coli STEC_EH250]
gb|EGX01616.1| ATP synthase F0, B subunit [Escherichia coli G58-1]
gb|EGX02446.1| ATP synthase F0, B subunit [Escherichia coli STEC_MHI813]
gb|EGX05068.1| ATP synthase F0, B subunit [Escherichia coli STEC_H.1.8]
gb|EGX14813.1| ATP synthase F0, B subunit [Escherichia coli STEC_S1191]
gb|EGX19520.1| ATP synthase F0, B subunit [Escherichia coli TX1999]
gb|AEQ15080.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O7:K1 str. CE10]
gb|EHF17981.1| ATP synthase subunit B [Escherichia coli O104:H4 str. C236-11]
gb|EHF21519.1| ATP synthase subunit B [Escherichia coli O104:H4 str. C227-11]
gb|EHF23979.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 04-8351]
gb|EHF31980.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 09-7901]
gb|EHF36697.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-3677]
gb|EHF45761.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4404]
gb|EHF49533.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4522]
gb|EHF52832.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4623]
gb|EHF64791.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4632 C1]
gb|EHF68544.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4632 C2]
gb|EHF70417.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4632 C3]
gb|EHF72479.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4632 C4]
gb|EHF80583.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-4632 C5]
gb|EHF98939.1| ATP synthase B chain [Escherichia coli cloneA_i1]
gb|AER86778.1| F0F1 ATP synthase subunit B [Escherichia coli str. 'clone D i2']
gb|AER91697.1| F0F1 ATP synthase subunit B [Escherichia coli str. 'clone D i14']
dbj|BAL40328.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli str. K-12 substr. MDS42]
gb|EHN81463.1| ATP synthase subunit B [Escherichia coli H494]
gb|EHN82713.1| ATP synthase subunit B [Escherichia coli TA124]
gb|EHN91552.1| ATP synthase subunit B [Escherichia coli B093]
gb|EHN92735.1| ATP synthase subunit B [Escherichia coli H397]
gb|EHN98736.1| ATP synthase subunit B [Escherichia coli E101]
gb|EHP63353.1| ATP synthase subunit B [Escherichia coli 4_1_47FAA]
gb|AEZ42896.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. RM12579]
gb|EHU04271.1| ATP synthase F0, B subunit [Escherichia coli DEC1C]
gb|EHU04314.1| ATP synthase F0, B subunit [Escherichia coli DEC1A]
gb|EHU07016.1| ATP synthase F0, B subunit [Escherichia coli DEC1B]
gb|EHU17960.1| ATP synthase F0, B subunit [Escherichia coli DEC1D]
gb|EHU21680.1| ATP synthase F0, B subunit [Escherichia coli DEC1E]
gb|EHU23219.1| ATP synthase F0, B subunit [Escherichia coli DEC2A]
gb|EHU35164.1| ATP synthase F0, B subunit [Escherichia coli DEC2B]
gb|EHU36960.1| ATP synthase F0, B subunit [Escherichia coli DEC2C]
gb|EHU39284.1| ATP synthase F0, B subunit [Escherichia coli DEC2D]
gb|EHU50658.1| ATP synthase F0, B subunit [Escherichia coli DEC2E]
gb|EHU53772.1| ATP synthase F0, B subunit [Escherichia coli DEC3A]
gb|EHU54471.1| ATP synthase F0, B subunit [Escherichia coli DEC3B]
gb|EHU67105.1| ATP synthase F0, B subunit [Escherichia coli DEC3C]
gb|EHU69769.1| ATP synthase F0, B subunit [Escherichia coli DEC3D]
gb|EHU71146.1| ATP synthase F0, B subunit [Escherichia coli DEC3E]
gb|EHU81202.1| ATP synthase F0, B subunit [Escherichia coli DEC3F]
gb|EHU87191.1| ATP synthase F0, B subunit [Escherichia coli DEC4A]
gb|EHU91908.1| ATP synthase F0, B subunit [Escherichia coli DEC4B]
gb|EHV01313.1| ATP synthase F0, B subunit [Escherichia coli DEC4D]
gb|EHV01746.1| ATP synthase F0, B subunit [Escherichia coli DEC4C]
gb|EHV08047.1| ATP synthase F0, B subunit [Escherichia coli DEC4E]
gb|EHV18431.1| ATP synthase F0, B subunit [Escherichia coli DEC4F]
gb|EHV21161.1| ATP synthase F0, B subunit [Escherichia coli DEC5A]
gb|EHV25335.1| ATP synthase F0, B subunit [Escherichia coli DEC5B]
gb|EHV33178.1| ATP synthase F0, B subunit [Escherichia coli DEC5C]
gb|EHV34028.1| ATP synthase F0, B subunit [Escherichia coli DEC5D]
gb|EHV44492.1| ATP synthase F0, B subunit [Escherichia coli DEC5E]
gb|EHV52162.1| ATP synthase F0, B subunit [Escherichia coli DEC6B]
gb|EHV52452.1| ATP synthase F0, B subunit [Escherichia coli DEC6A]
gb|EHV56467.1| ATP synthase F0, B subunit [Escherichia coli DEC6C]
gb|EHV67017.1| ATP synthase F0, B subunit [Escherichia coli DEC6D]
gb|EHV69871.1| ATP synthase F0, B subunit [Escherichia coli DEC6E]
gb|EHV74359.1| ATP synthase F0, B subunit [Escherichia coli DEC7A]
gb|EHV83884.1| ATP synthase F0, B subunit [Escherichia coli DEC7C]
gb|EHV87521.1| ATP synthase F0, B subunit [Escherichia coli DEC7D]
gb|EHV97744.1| ATP synthase F0, B subunit [Escherichia coli DEC7E]
gb|EHW05434.1| ATP synthase F0, B subunit [Escherichia coli DEC8A]
gb|EHW06048.1| ATP synthase F0, B subunit [Escherichia coli DEC8B]
gb|EHW11407.1| ATP synthase F0, B subunit [Escherichia coli DEC8C]
gb|EHW23131.1| ATP synthase F0, B subunit [Escherichia coli DEC8D]
gb|EHW23238.1| ATP synthase F0, B subunit [Escherichia coli DEC8E]
gb|EHW30330.1| ATP synthase F0, B subunit [Escherichia coli DEC9A]
gb|EHW35630.1| ATP synthase F0, B subunit [Escherichia coli DEC9B]
gb|EHW41262.1| ATP synthase F0, B subunit [Escherichia coli DEC9C]
gb|EHW48849.1| ATP synthase F0, B subunit [Escherichia coli DEC9D]
gb|EHW51098.1| ATP synthase F0, B subunit [Escherichia coli DEC9E]
gb|EHW58013.1| ATP synthase F0, B subunit [Escherichia coli DEC10A]
gb|EHW63208.1| ATP synthase F0, B subunit [Escherichia coli DEC10B]
gb|EHW67977.1| ATP synthase F0, B subunit [Escherichia coli DEC10C]
gb|EHW74162.1| ATP synthase F0, B subunit [Escherichia coli DEC10D]
gb|EHW85026.1| ATP synthase F0, B subunit [Escherichia coli DEC10E]
gb|EHW86105.1| ATP synthase F0, B subunit [Escherichia coli DEC10F]
gb|EHW86804.1| ATP synthase F0, B subunit [Escherichia coli DEC11A]
gb|EHW99821.1| ATP synthase F0, B subunit [Escherichia coli DEC11B]
gb|EHX05719.1| ATP synthase F0, B subunit [Escherichia coli DEC11D]
gb|EHX07825.1| ATP synthase F0, B subunit [Escherichia coli DEC11C]
gb|EHX16777.1| ATP synthase F0, B subunit [Escherichia coli DEC11E]
gb|EHX22328.1| ATP synthase F0, B subunit [Escherichia coli DEC12B]
gb|EHX26313.1| ATP synthase F0, B subunit [Escherichia coli DEC12A]
gb|EHX26661.1| ATP synthase F0, B subunit [Escherichia coli DEC12C]
gb|EHX39923.1| ATP synthase F0, B subunit [Escherichia coli DEC12D]
gb|EHX43318.1| ATP synthase F0, B subunit [Escherichia coli DEC13A]
gb|EHX43888.1| ATP synthase F0, B subunit [Escherichia coli DEC12E]
gb|EHX56377.1| ATP synthase F0, B subunit [Escherichia coli DEC13B]
gb|EHX56657.1| ATP synthase F0, B subunit [Escherichia coli DEC13C]
gb|EHX59474.1| ATP synthase F0, B subunit [Escherichia coli DEC13D]
gb|EHX70141.1| ATP synthase F0, B subunit [Escherichia coli DEC13E]
gb|EHX72318.1| ATP synthase F0, B subunit [Escherichia coli DEC14A]
gb|EHX75269.1| ATP synthase F0, B subunit [Escherichia coli DEC14B]
gb|EHX84371.1| ATP synthase F0, B subunit [Escherichia coli DEC14C]
gb|EHX88314.1| ATP synthase F0, B subunit [Escherichia coli DEC14D]
gb|EHX93670.1| ATP synthase F0, B subunit [Escherichia coli DEC15A]
gb|EHY00201.1| ATP synthase F0, B subunit [Escherichia coli DEC15B]
gb|EHY03154.1| ATP synthase F0, B subunit [Escherichia coli DEC15C]
gb|EHY11421.1| ATP synthase F0, B subunit [Escherichia coli DEC15D]
gb|EHY15998.1| ATP synthase F0, B subunit [Escherichia coli DEC15E]
gb|EIA34547.1| F0F1 ATP synthase subunit B [Escherichia coli SCI-07]
gb|AFH15736.1| F0F1 ATP synthase subunit B [Escherichia coli KO11FL]
gb|AFH13592.1| F0F1 ATP synthase subunit B [Escherichia coli W]
gb|EID64011.1| F0F1 ATP synthase subunit B [Shigella flexneri 5a str. M90T]
gb|EID68617.1| F0F1 ATP synthase subunit B [Escherichia coli W26]
gb|EIE39103.1| F0F1 ATP synthase subunit B [Escherichia coli J53]
gb|EIE54545.1| F0F1 ATP synthase subunit B [Escherichia coli AI27]
gb|EIF18448.1| F0F1 ATP synthase subunit B [Escherichia coli O32:H37 str. P4]
gb|EIF84576.1| ATP synthase subunit B [Escherichia coli M919]
gb|EIG45420.1| ATP synthase subunit B [Escherichia coli H730]
gb|EIG45969.1| ATP synthase subunit B [Escherichia coli B799]
gb|EIG68841.1| ATP synthase subunit B [Escherichia sp. 4_1_40B]
gb|EIG80356.1| ATP synthase F0, B subunit [Escherichia coli 1.2741]
gb|EIG92012.1| ATP synthase F0, B subunit [Escherichia coli 97.0246]
gb|EIH04711.1| ATP synthase F0, B subunit [Escherichia coli 5.0588]
gb|EIH11668.1| ATP synthase F0, B subunit [Escherichia coli 97.0259]
gb|EIH23143.1| ATP synthase F0, B subunit [Escherichia coli 1.2264]
gb|EIH33575.1| ATP synthase F0, B subunit [Escherichia coli 96.0497]
gb|EIH42332.1| ATP synthase F0, B subunit [Escherichia coli 99.0741]
gb|EIH55532.1| ATP synthase F0, B subunit [Escherichia coli 3.2608]
gb|EIH65676.1| ATP synthase F0, B subunit [Escherichia coli 93.0624]
gb|EIH75567.1| ATP synthase F0, B subunit [Escherichia coli 4.0522]
gb|EIH90241.1| ATP synthase F0, B subunit [Escherichia coli JB1-95]
gb|EII00983.1| ATP synthase F0, B subunit [Escherichia coli 96.154]
gb|EII12654.1| ATP synthase F0, B subunit [Escherichia coli 5.0959]
gb|EII20449.1| ATP synthase F0, B subunit [Escherichia coli 9.0111]
gb|EII36512.1| ATP synthase F0, B subunit [Escherichia coli 4.0967]
gb|EII43696.1| ATP synthase F0, B subunit [Escherichia coli 2.3916]
gb|EII55514.1| ATP synthase F0, B subunit [Escherichia coli 3.3884]
gb|EII66243.1| ATP synthase F0, B subunit [Escherichia coli 2.4168]
gb|EII74820.1| ATP synthase F0, B subunit [Escherichia coli 3.2303]
gb|EII88139.1| ATP synthase F0, B subunit [Escherichia coli 3003]
gb|EII97380.1| ATP synthase F0, B subunit [Escherichia coli TW07793]
gb|EIJ01198.1| ATP synthase F0, B subunit [Escherichia coli B41]
gb|EIJ15245.1| ATP synthase F0, B subunit [Escherichia coli 900105 (10e)]
gb|AFJ31466.1| F0F1 ATP synthase subunit B [Escherichia coli Xuzhou21]
gb|EIL01414.1| F0F1 ATP synthase subunit B [Escherichia coli O103:H2 str. CVM9450]
gb|EIL03292.1| F0F1 ATP synthase subunit B [Escherichia coli O103:H25 str.
CVM9340]
gb|EIL14482.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H8 str. CVM9570]
gb|EIL16139.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H11 str.
CVM9534]
gb|EIL20098.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H8 str. CVM9574]
gb|EIL27963.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H11 str.
CVM9545]
gb|EIL34049.1| hypothetical protein ECO10026_26423 [Escherichia coli O26:H11 str.
CVM10026]
gb|EIL42726.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str. CVM9942]
gb|EIL44671.1| F0F1 ATP synthase subunit B [Escherichia coli 541-15]
gb|EIL54707.1| F0F1 ATP synthase subunit B [Escherichia coli KD2]
gb|EIL55007.1| F0F1 ATP synthase subunit B [Escherichia coli KD1]
gb|EIL64296.1| F0F1 ATP synthase subunit B [Escherichia coli 541-1]
gb|EIL69762.1| F0F1 ATP synthase subunit B [Escherichia coli 576-1]
gb|EIL71932.1| F0F1 ATP synthase subunit B [Escherichia coli 75]
gb|EIL78635.1| F0F1 ATP synthase subunit B [Escherichia coli CUMT8]
gb|EIL79625.1| F0F1 ATP synthase subunit B [Escherichia coli HM605]
gb|EIN16923.1| ATP synthase F0, B subunit [Escherichia coli FRIK1996]
gb|EIN17340.1| ATP synthase F0, B subunit [Escherichia coli FDA505]
gb|EIN18229.1| ATP synthase F0, B subunit [Escherichia coli FDA517]
gb|EIN33813.1| ATP synthase F0, B subunit [Escherichia coli FRIK1985]
gb|EIN34585.1| ATP synthase F0, B subunit [Escherichia coli 93-001]
gb|EIN37349.1| ATP synthase F0, B subunit [Escherichia coli FRIK1990]
gb|EIN50352.1| ATP synthase F0, B subunit [Escherichia coli PA3]
gb|EIN53444.1| ATP synthase F0, B subunit [Escherichia coli PA5]
gb|EIN56669.1| ATP synthase F0, B subunit [Escherichia coli PA9]
gb|EIN66761.1| ATP synthase F0, B subunit [Escherichia coli PA10]
gb|EIN70773.1| ATP synthase F0, B subunit [Escherichia coli PA14]
gb|EIN71976.1| ATP synthase F0, B subunit [Escherichia coli PA15]
gb|EIN84416.1| ATP synthase F0, B subunit [Escherichia coli PA22]
gb|EIN90604.1| ATP synthase F0, B subunit [Escherichia coli PA24]
gb|EIN91055.1| ATP synthase F0, B subunit [Escherichia coli PA25]
gb|EIN96981.1| ATP synthase F0, B subunit [Escherichia coli PA28]
gb|EIO08402.1| ATP synthase F0, B subunit [Escherichia coli PA31]
gb|EIO08904.1| ATP synthase F0, B subunit [Escherichia coli PA32]
gb|EIO12292.1| ATP synthase F0, B subunit [Escherichia coli PA33]
gb|EIO25594.1| ATP synthase F0, B subunit [Escherichia coli PA40]
gb|EIO28150.1| ATP synthase F0, B subunit [Escherichia coli PA39]
gb|EIO31396.1| ATP synthase F0, B subunit [Escherichia coli PA41]
gb|EIO34395.1| ATP synthase F0, B subunit [Escherichia coli PA42]
gb|EIO47414.1| ATP synthase F0, B subunit [Escherichia coli TW06591]
gb|EIO53758.1| ATP synthase F0, B subunit [Escherichia coli TW07945]
gb|EIO54629.1| ATP synthase F0, B subunit [Escherichia coli TW10246]
gb|EIO60569.1| ATP synthase F0, B subunit [Escherichia coli TW11039]
gb|EIO67282.1| ATP synthase F0, B subunit [Escherichia coli TW09098]
gb|EIO72166.1| ATP synthase F0, B subunit [Escherichia coli TW09109]
gb|EIO80442.1| ATP synthase F0, B subunit [Escherichia coli TW10119]
gb|EIO88249.1| ATP synthase F0, B subunit [Escherichia coli TW09195]
gb|EIO88686.1| ATP synthase F0, B subunit [Escherichia coli EC4203]
gb|EIO93428.1| ATP synthase F0, B subunit [Escherichia coli EC4196]
gb|EIP04839.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14313]
gb|EIP11364.1| ATP synthase F0, B subunit [Escherichia coli EC4421]
gb|EIP20719.1| ATP synthase F0, B subunit [Escherichia coli EC4422]
gb|EIP25007.1| ATP synthase F0, B subunit [Escherichia coli EC4013]
gb|EIP28673.1| ATP synthase F0, B subunit [Escherichia coli EC4402]
gb|EIP36248.1| ATP synthase F0, B subunit [Escherichia coli EC4439]
gb|EIP41049.1| ATP synthase F0, B subunit [Escherichia coli EC4436]
gb|EIP49962.1| ATP synthase F0, B subunit [Escherichia coli EC4437]
gb|EIP51407.1| ATP synthase F0, B subunit [Escherichia coli EC4448]
gb|EIP57354.1| ATP synthase F0, B subunit [Escherichia coli EC1738]
gb|EIP64957.1| ATP synthase F0, B subunit [Escherichia coli EC1734]
gb|EIP74365.1| ATP synthase F0, B subunit [Escherichia coli EC1845]
gb|EIP74442.1| ATP synthase F0, B subunit [Escherichia coli EC1863]
gb|EIQ03985.1| ATP synthase F0, B subunit [Shigella flexneri 2850-71]
gb|EIQ04860.1| ATP synthase F0, B subunit [Shigella flexneri CCH060]
gb|EIQ21186.1| ATP synthase F0, B subunit [Shigella flexneri K-404]
gb|EIQ24372.1| ATP synthase F0, B subunit [Shigella boydii 965-58]
gb|EIQ31709.1| ATP synthase F0, B subunit [Shigella boydii 4444-74]
gb|EIQ36407.1| ATP synthase F0, B subunit [Shigella sonnei 3226-85]
gb|EIQ39525.1| ATP synthase F0, B subunit [Shigella sonnei 3233-85]
gb|EIQ50164.1| ATP synthase F0, B subunit [Shigella sonnei 4822-66]
gb|EIQ55929.1| ATP synthase F0, B subunit [Shigella dysenteriae 225-75]
gb|EIQ58689.1| ATP synthase F0, B subunit [Shigella flexneri 1235-66]
gb|EIQ59386.1| ATP synthase F0, B subunit [Escherichia coli EPECa12]
gb|EIQ67623.1| ATP synthase F0, B subunit [Escherichia coli EPEC C342-62]
gb|EJE60578.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H8 str. CVM9634]
gb|EJE61213.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H8 str. CVM9602]
gb|EJE71948.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str.
CVM10224]
gb|EJE88371.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str.
CVM10021]
gb|EJE89012.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str.
CVM10030]
gb|EJE89445.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H11 str.
CVM9553]
gb|EJE92033.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H11 str.
CVM9455]
gb|EJE93507.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str. CVM9952]
gb|EJK94021.1| ATP synthase F0, B subunit [Escherichia coli STEC_O31]
gb|EJL10801.1| ATP synthase F0, B subunit [Shigella flexneri 6603-63]
gb|EJL11629.1| ATP synthase F0, B subunit [Shigella sonnei str. Moseley]
gb|EJZ61770.1| ATP synthase F0, B subunit [Shigella flexneri 1485-80]
gb|AFS59656.1| F0F1 ATP synthase subunit B [Escherichia coli O104:H4 str.
2009EL-2050]
gb|AFS76872.1| F0F1 ATP synthase subunit B [Escherichia coli O104:H4 str.
2011C-3493]
gb|AFS83833.1| F0F1 ATP synthase subunit B [Escherichia coli O104:H4 str.
2009EL-2071]
gb|EKG96128.1| ATP synthase F0, B subunit [Escherichia coli PA7]
gb|EKG96605.1| ATP synthase F0, B subunit [Escherichia coli FRIK920]
gb|EKG99966.1| ATP synthase F0, B subunit [Escherichia coli PA34]
gb|EKH10207.1| ATP synthase F0, B subunit [Escherichia coli FDA506]
gb|EKH14527.1| ATP synthase F0, B subunit [Escherichia coli FDA507]
gb|EKH27774.1| ATP synthase F0, B subunit [Escherichia coli FRIK1999]
gb|EKH33468.1| ATP synthase F0, B subunit [Escherichia coli FRIK1997]
gb|EKH38109.1| ATP synthase F0, B subunit [Escherichia coli NE1487]
gb|EKH44253.1| ATP synthase F0, B subunit [Escherichia coli NE037]
gb|EKH50099.1| ATP synthase F0, B subunit [Escherichia coli FRIK2001]
gb|EKH55751.1| ATP synthase F0, B subunit [Escherichia coli PA4]
gb|EKH64769.1| ATP synthase F0, B subunit [Escherichia coli PA23]
gb|EKH66751.1| ATP synthase F0, B subunit [Escherichia coli PA49]
gb|EKH73208.1| ATP synthase F0, B subunit [Escherichia coli PA45]
gb|EKH80818.1| ATP synthase F0, B subunit [Escherichia coli TT12B]
gb|EKH85540.1| ATP synthase F0, B subunit [Escherichia coli MA6]
gb|EKH89436.1| ATP synthase F0, B subunit [Escherichia coli 5905]
gb|EKH97631.1| ATP synthase F0, B subunit [Escherichia coli CB7326]
gb|EKI04159.1| ATP synthase F0, B subunit [Escherichia coli EC96038]
gb|EKI06975.1| ATP synthase F0, B subunit [Escherichia coli 5412]
gb|EKI15480.1| ATP synthase F0, B subunit [Escherichia coli TW15901]
gb|EKI22792.1| ATP synthase F0, B subunit [Escherichia coli ARS4.2123]
gb|EKI23267.1| ATP synthase F0, B subunit [Escherichia coli TW00353]
gb|EKI33591.1| ATP synthase F0, B subunit [Escherichia coli 3006]
gb|EKI35203.1| ATP synthase F0, B subunit [Escherichia coli 07798]
gb|EKI36260.1| ATP synthase F0, B subunit [Escherichia coli PA38]
gb|EKI47341.1| ATP synthase F0, B subunit [Escherichia coli EC1735]
gb|EKI48751.1| ATP synthase F0, B subunit [Escherichia coli N1]
gb|EKI58056.1| ATP synthase F0, B subunit [Escherichia coli EC1736]
gb|EKI60725.1| ATP synthase F0, B subunit [Escherichia coli EC1737]
gb|EKI65581.1| ATP synthase F0, B subunit [Escherichia coli EC1846]
gb|EKI73724.1| ATP synthase F0, B subunit [Escherichia coli EC1847]
gb|EKI77760.1| ATP synthase F0, B subunit [Escherichia coli EC1848]
gb|EKI83784.1| ATP synthase F0, B subunit [Escherichia coli EC1849]
gb|EKI91260.1| ATP synthase F0, B subunit [Escherichia coli EC1850]
gb|EKI94417.1| ATP synthase F0, B subunit [Escherichia coli EC1856]
gb|EKJ01545.1| ATP synthase F0, B subunit [Escherichia coli EC1862]
gb|EKJ07557.1| ATP synthase F0, B subunit [Escherichia coli EC1864]
gb|EKJ11713.1| ATP synthase F0, B subunit [Escherichia coli EC1865]
gb|EKJ21268.1| ATP synthase F0, B subunit [Escherichia coli EC1868]
gb|EKJ22187.1| ATP synthase F0, B subunit [Escherichia coli EC1866]
gb|EKJ32526.1| ATP synthase F0, B subunit [Escherichia coli EC1869]
gb|EKJ37527.1| ATP synthase F0, B subunit [Escherichia coli EC1870]
gb|EKJ39150.1| ATP synthase F0, B subunit [Escherichia coli NE098]
gb|EKJ49010.1| ATP synthase F0, B subunit [Escherichia coli FRIK523]
gb|EKJ55361.1| ATP synthase F0, B subunit [Escherichia coli 0.1288]
gb|EKJ56785.1| ATP synthase F0, B subunit [Escherichia coli 0.1304]
gb|EKJ81572.1| F0F1 ATP synthase subunit B [Escherichia coli AD30]
gb|EKK22657.1| ATP synthase F0, B subunit [Escherichia coli 5.2239]
gb|EKK23041.1| ATP synthase F0, B subunit [Escherichia coli 3.4870]
gb|EKK23853.1| ATP synthase F0, B subunit [Escherichia coli 6.0172]
gb|EKK39866.1| ATP synthase F0, B subunit [Escherichia coli 8.0566]
gb|EKK39955.1| ATP synthase F0, B subunit [Escherichia coli 8.0586]
gb|EKK40931.1| ATP synthase F0, B subunit [Escherichia coli 8.0569]
gb|EKK51534.1| ATP synthase F0, B subunit [Escherichia coli 10.0833]
gb|EKK54176.1| ATP synthase F0, B subunit [Escherichia coli 8.2524]
gb|EKK67840.1| ATP synthase F0, B subunit [Escherichia coli 88.0221]
gb|EKK73081.1| ATP synthase F0, B subunit [Escherichia coli 8.0416]
gb|EKK82854.1| ATP synthase F0, B subunit [Escherichia coli 10.0821]
emb|CCK49053.1| membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
chi7122]
emb|CCJ46372.1| membrane-bound ATP synthase, F0 sector, subunit b [Escherichia
coli]
gb|EKT94093.1| F0F1 ATP synthase subunit B [Escherichia coli O26:H11 str.
CFSAN001629]
gb|EKT99285.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H8 str.
CFSAN001632]
gb|EKU05101.1| F0F1 ATP synthase subunit B [Escherichia coli O111:H11 str.
CFSAN001630]
gb|EKV71945.1| ATP synthase F0, B subunit [Escherichia coli 88.1042]
gb|EKV72150.1| ATP synthase F0, B subunit [Escherichia coli 89.0511]
gb|EKV75221.1| ATP synthase F0, B subunit [Escherichia coli 88.1467]
gb|EKV86910.1| ATP synthase F0, B subunit [Escherichia coli 90.0091]
gb|EKV90223.1| ATP synthase F0, B subunit [Escherichia coli 90.2281]
gb|EKV93203.1| ATP synthase F0, B subunit [Escherichia coli 90.0039]
gb|EKW06027.1| ATP synthase F0, B subunit [Escherichia coli 93.0056]
gb|EKW06158.1| ATP synthase F0, B subunit [Escherichia coli 93.0055]
gb|EKW10397.1| ATP synthase F0, B subunit [Escherichia coli 94.0618]
gb|EKW22130.1| ATP synthase F0, B subunit [Escherichia coli 95.0183]
gb|EKW23805.1| ATP synthase F0, B subunit [Escherichia coli 95.0943]
gb|EKW24337.1| ATP synthase F0, B subunit [Escherichia coli 95.1288]
gb|EKW38008.1| ATP synthase F0, B subunit [Escherichia coli 96.0428]
gb|EKW39746.1| ATP synthase F0, B subunit [Escherichia coli 96.0427]
gb|EKW45083.1| ATP synthase F0, B subunit [Escherichia coli 96.0939]
gb|EKW58959.1| ATP synthase F0, B subunit [Escherichia coli 96.0107]
gb|EKW61171.1| ATP synthase F0, B subunit [Escherichia coli 97.0003]
gb|EKW70448.1| ATP synthase F0, B subunit [Escherichia coli 97.1742]
gb|EKW73326.1| ATP synthase F0, B subunit [Escherichia coli 97.0007]
gb|EKW77691.1| ATP synthase F0, B subunit [Escherichia coli 99.0672]
gb|EKW86760.1| ATP synthase F0, B subunit [Escherichia coli 99.0678]
gb|EKW88035.1| ATP synthase F0, B subunit [Escherichia coli 99.0713]
gb|EKY35484.1| ATP synthase F0, B subunit [Escherichia coli 96.0109]
gb|EKY35937.1| ATP synthase F0, B subunit [Escherichia coli 97.0010]
gb|EKY92594.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02030]
gb|EKY92944.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02033-1]
gb|EKY94627.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02092]
gb|EKZ07882.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02093]
gb|EKZ09874.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02281]
gb|EKZ12610.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02318]
gb|EKZ24093.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-02913]
gb|EKZ26831.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-03439]
gb|EKZ27276.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-03943]
gb|EKZ37582.1| ATP synthase subunit B [Escherichia coli O104:H4 str. 11-04080]
gb|EKZ38796.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-9990]
gb|EKZ41107.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-9450]
gb|EKZ49918.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-4984]
gb|EKZ51931.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-4986]
gb|EKZ60204.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-4987]
gb|EKZ63710.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-4988]
gb|EKZ68622.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-5603]
gb|EKZ75861.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-5604]
gb|EKZ79994.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec12-0465]
gb|EKZ84448.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-6006]
gb|EKZ90147.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec12-0466]
gb|EKZ94486.1| ATP synthase subunit B [Escherichia coli O104:H4 str. Ec11-9941]
gb|ELB95815.1| ATP synthase subunit B [Escherichia coli KTE2]
gb|ELB96910.1| ATP synthase subunit B [Escherichia coli KTE4]
gb|ELC06295.1| ATP synthase subunit B [Escherichia coli KTE5]
gb|ELC13585.1| ATP synthase subunit B [Escherichia coli KTE10]
gb|ELC16054.1| ATP synthase subunit B [Escherichia sp. KTE11]
gb|ELC18182.1| ATP synthase subunit B [Escherichia coli KTE12]
gb|ELC25280.1| ATP synthase subunit B [Escherichia coli KTE16]
gb|ELC25765.1| ATP synthase subunit B [Escherichia coli KTE15]
gb|ELC34028.1| ATP synthase subunit B [Escherichia coli KTE25]
gb|ELC35237.1| ATP synthase subunit B [Escherichia coli KTE21]
gb|ELC43402.1| ATP synthase subunit B [Escherichia coli KTE26]
gb|ELC46779.1| ATP synthase subunit B [Escherichia coli KTE28]
gb|ELC53456.1| ATP synthase subunit B [Escherichia coli KTE39]
gb|ELC56421.1| ATP synthase subunit B [Escherichia coli KTE44]
gb|ELC61922.1| ATP synthase subunit B [Escherichia coli KTE178]
gb|ELC69630.1| ATP synthase subunit B [Escherichia coli KTE187]
gb|ELC69875.1| ATP synthase subunit B [Escherichia coli KTE181]
gb|ELC78097.1| ATP synthase subunit B [Escherichia coli KTE188]
gb|ELC80753.1| ATP synthase subunit B [Escherichia coli KTE189]
gb|ELC87854.1| ATP synthase subunit B [Escherichia coli KTE191]
gb|ELC94010.1| ATP synthase subunit B [Escherichia coli KTE193]
gb|ELC96200.1| ATP synthase subunit B [Escherichia coli KTE201]
gb|ELD02101.1| ATP synthase subunit B [Escherichia coli KTE204]
gb|ELD07443.1| ATP synthase subunit B [Escherichia coli KTE205]
gb|ELD11841.1| ATP synthase subunit B [Escherichia coli KTE206]
gb|ELD17540.1| ATP synthase subunit B [Escherichia coli KTE208]
gb|ELD18950.1| ATP synthase subunit B [Escherichia coli KTE210]
gb|ELD27069.1| ATP synthase subunit B [Escherichia coli KTE212]
gb|ELD30799.1| ATP synthase subunit B [Escherichia coli KTE213]
gb|ELD34227.1| ATP synthase subunit B [Escherichia coli KTE214]
gb|ELD39057.1| ATP synthase subunit B [Escherichia coli KTE216]
gb|ELD46850.1| ATP synthase subunit B [Escherichia coli KTE220]
gb|ELD49727.1| ATP synthase subunit B [Escherichia coli KTE224]
gb|ELD57564.1| ATP synthase subunit B [Escherichia coli KTE230]
gb|ELD58202.1| ATP synthase subunit B [Escherichia coli KTE228]
gb|ELD66328.1| ATP synthase subunit B [Escherichia coli KTE234]
gb|ELD69069.1| ATP synthase subunit B [Escherichia coli KTE233]
gb|ELD75249.1| ATP synthase subunit B [Escherichia coli KTE235]
gb|ELD79018.1| ATP synthase subunit B [Escherichia coli KTE236]
gb|ELD83683.1| ATP synthase subunit B [Escherichia coli KTE237]
gb|ELD87738.1| ATP synthase subunit B [Escherichia coli KTE47]
gb|ELD94387.1| ATP synthase subunit B [Escherichia coli KTE49]
gb|ELD95501.1| ATP synthase subunit B [Escherichia coli KTE51]
gb|ELE02637.1| ATP synthase subunit B [Escherichia coli KTE53]
gb|ELE09136.1| ATP synthase subunit B [Escherichia coli KTE55]
gb|ELE15874.1| ATP synthase subunit B [Escherichia coli KTE56]
gb|ELE18702.1| ATP synthase subunit B [Escherichia coli KTE57]
gb|ELE20941.1| ATP synthase subunit B [Escherichia coli KTE58]
gb|ELE28259.1| ATP synthase subunit B [Escherichia coli KTE60]
gb|ELE30173.1| ATP synthase subunit B [Escherichia coli KTE62]
gb|ELE38904.1| ATP synthase subunit B [Escherichia coli KTE66]
gb|ELE45915.1| ATP synthase subunit B [Escherichia coli KTE67]
gb|ELE48208.1| ATP synthase subunit B [Escherichia coli KTE72]
gb|ELE51627.1| ATP synthase subunit B [Escherichia coli KTE75]
gb|ELE56395.1| ATP synthase subunit B [Escherichia coli KTE76]
gb|ELE60821.1| ATP synthase subunit B [Escherichia coli KTE77]
gb|ELE67381.1| ATP synthase subunit B [Escherichia coli KTE80]
gb|ELE68689.1| ATP synthase subunit B [Escherichia coli KTE81]
gb|ELE77134.1| ATP synthase subunit B [Escherichia coli KTE83]
gb|ELE78304.1| ATP synthase subunit B [Escherichia coli KTE86]
gb|ELE86060.1| ATP synthase subunit B [Escherichia coli KTE87]
gb|ELE87594.1| ATP synthase subunit B [Escherichia coli KTE93]
gb|ELE95606.1| ATP synthase subunit B [Escherichia coli KTE111]
gb|ELE96241.1| ATP synthase subunit B [Escherichia coli KTE116]
gb|ELF05798.1| ATP synthase subunit B [Escherichia coli KTE119]
gb|ELF08126.1| ATP synthase subunit B [Escherichia coli KTE142]
gb|ELF14698.1| ATP synthase subunit B [Escherichia coli KTE143]
gb|ELF16647.1| ATP synthase subunit B [Escherichia coli KTE156]
gb|ELF27025.1| ATP synthase subunit B [Escherichia coli KTE162]
gb|ELF29944.1| ATP synthase subunit B [Escherichia coli KTE161]
gb|ELF34835.1| ATP synthase subunit B [Escherichia coli KTE169]
gb|ELF35121.1| ATP synthase subunit B [Escherichia coli KTE171]
gb|ELF45869.1| ATP synthase subunit B [Escherichia coli KTE8]
gb|ELF47855.1| ATP synthase subunit B [Escherichia coli KTE6]
gb|ELF51285.1| ATP synthase subunit B [Escherichia coli KTE9]
gb|ELF54421.1| ATP synthase subunit B [Escherichia coli KTE17]
gb|ELF62104.1| ATP synthase subunit B [Escherichia coli KTE18]
gb|ELF62257.1| ATP synthase subunit B [Escherichia coli KTE45]
gb|ELF70314.1| ATP synthase subunit B [Escherichia coli KTE42]
gb|ELF72569.1| ATP synthase subunit B [Escherichia coli KTE23]
gb|ELF80363.1| ATP synthase subunit B [Escherichia coli KTE43]
gb|ELF83512.1| ATP synthase subunit B [Escherichia coli KTE29]
gb|ELF89164.1| ATP synthase subunit B [Escherichia coli KTE22]
gb|ELF93846.1| ATP synthase subunit B [Escherichia coli KTE46]
gb|ELF95476.1| ATP synthase subunit B [Escherichia coli KTE48]
gb|ELG08989.1| ATP synthase subunit B [Escherichia coli KTE50]
gb|ELG10909.1| ATP synthase subunit B [Escherichia coli KTE54]
gb|ELG12075.1| ATP synthase subunit B [Escherichia coli KTE59]
gb|ELG13419.1| ATP synthase subunit B [Escherichia coli KTE63]
gb|ELG22087.1| ATP synthase subunit B [Escherichia coli KTE65]
gb|ELG22728.1| ATP synthase subunit B [Escherichia coli KTE78]
gb|ELG32383.1| ATP synthase subunit B [Escherichia coli KTE84]
gb|ELG34929.1| ATP synthase subunit B [Escherichia coli KTE79]
gb|ELG39615.1| ATP synthase subunit B [Escherichia coli KTE91]
gb|ELG46575.1| ATP synthase subunit B [Escherichia coli KTE101]
gb|ELG46754.1| ATP synthase subunit B [Escherichia coli KTE115]
gb|ELG51933.1| ATP synthase subunit B [Escherichia coli KTE118]
gb|ELG62738.1| ATP synthase subunit B [Escherichia coli KTE123]
gb|ELG66112.1| ATP synthase subunit B [Escherichia coli KTE136]
gb|ELG66647.1| ATP synthase subunit B [Escherichia coli KTE135]
gb|ELG69821.1| ATP synthase subunit B [Escherichia coli KTE140]
gb|ELG76009.1| ATP synthase subunit B [Escherichia coli KTE141]
gb|ELG80500.1| ATP synthase subunit B [Escherichia coli KTE144]
gb|ELG84399.1| ATP synthase subunit B [Escherichia coli KTE146]
gb|ELG91041.1| ATP synthase subunit B [Escherichia coli KTE147]
gb|ELG96156.1| ATP synthase subunit B [Escherichia coli KTE158]
gb|ELG99818.1| ATP synthase subunit B [Escherichia coli KTE154]
gb|ELH04540.1| ATP synthase subunit B [Escherichia coli KTE192]
gb|ELH09391.1| ATP synthase subunit B [Escherichia coli KTE194]
gb|ELH12252.1| ATP synthase subunit B [Escherichia coli KTE165]
gb|ELH16536.1| ATP synthase subunit B [Escherichia coli KTE173]
gb|ELH16634.1| ATP synthase subunit B [Escherichia coli KTE190]
gb|ELH22347.1| ATP synthase subunit B [Escherichia coli KTE175]
gb|ELH32979.1| ATP synthase subunit B [Escherichia coli KTE196]
gb|ELH39909.1| ATP synthase subunit B [Escherichia coli KTE184]
gb|ELH40737.1| ATP synthase subunit B [Escherichia coli KTE183]
gb|ELH43770.1| ATP synthase subunit B [Escherichia coli KTE197]
gb|ELH47567.1| ATP synthase subunit B [Escherichia coli KTE202]
gb|ELH56784.1| ATP synthase subunit B [Escherichia coli KTE203]
gb|ELH59110.1| ATP synthase subunit B [Escherichia coli KTE207]
gb|ELH67750.1| ATP synthase subunit B [Escherichia coli KTE211]
gb|ELH70258.1| ATP synthase subunit B [Escherichia coli KTE217]
gb|ELH73940.1| ATP synthase subunit B [Escherichia coli KTE215]
gb|ELH81115.1| ATP synthase subunit B [Escherichia coli KTE218]
gb|ELH83025.1| ATP synthase subunit B [Escherichia coli KTE223]
gb|ELH98579.1| ATP synthase subunit B [Escherichia coli KTE229]
gb|ELH99179.1| ATP synthase subunit B [Escherichia coli KTE227]
gb|ELI03125.1| ATP synthase subunit B [Escherichia coli KTE104]
gb|ELI03447.1| ATP synthase subunit B [Escherichia coli KTE105]
gb|ELI07427.1| ATP synthase subunit B [Escherichia coli KTE106]
gb|ELI15949.1| ATP synthase subunit B [Escherichia coli KTE109]
gb|ELI20788.1| ATP synthase subunit B [Escherichia coli KTE112]
gb|ELI22378.1| ATP synthase subunit B [Escherichia coli KTE113]
gb|ELI26443.1| ATP synthase subunit B [Escherichia coli KTE117]
gb|ELI35197.1| ATP synthase subunit B [Escherichia coli KTE120]
gb|ELI38538.1| ATP synthase subunit B [Escherichia coli KTE122]
gb|ELI38952.1| ATP synthase subunit B [Escherichia coli KTE124]
gb|ELI50554.1| ATP synthase subunit B [Escherichia coli KTE125]
gb|ELI51073.1| ATP synthase subunit B [Escherichia coli KTE128]
gb|ELI55321.1| ATP synthase subunit B [Escherichia coli KTE129]
gb|ELI64286.1| ATP synthase subunit B [Escherichia coli KTE131]
gb|ELI67979.1| ATP synthase subunit B [Escherichia coli KTE133]
gb|ELI76237.1| ATP synthase subunit B [Escherichia coli KTE138]
gb|ELI81434.1| ATP synthase subunit B [Escherichia coli KTE139]
gb|ELI85176.1| ATP synthase subunit B [Escherichia coli KTE145]
gb|ELI92530.1| ATP synthase subunit B [Escherichia coli KTE148]
gb|ELI93379.1| ATP synthase subunit B [Escherichia coli KTE150]
gb|ELI98968.1| ATP synthase subunit B [Escherichia coli KTE153]
gb|ELJ06760.1| ATP synthase subunit B [Escherichia coli KTE157]
gb|ELJ08018.1| ATP synthase subunit B [Escherichia coli KTE160]
gb|ELJ10404.1| ATP synthase subunit B [Escherichia coli KTE163]
gb|ELJ20310.1| ATP synthase subunit B [Escherichia coli KTE166]
gb|ELJ22908.1| ATP synthase subunit B [Escherichia coli KTE167]
gb|ELJ24533.1| ATP synthase subunit B [Escherichia coli KTE168]
gb|ELJ33790.1| ATP synthase subunit B [Escherichia coli KTE174]
gb|ELJ36446.1| ATP synthase subunit B [Escherichia coli KTE176]
gb|ELJ39528.1| ATP synthase subunit B [Escherichia coli KTE177]
gb|ELJ49290.1| ATP synthase subunit B [Escherichia coli KTE179]
gb|ELJ49707.1| ATP synthase subunit B [Escherichia coli KTE180]
gb|ELJ53321.1| ATP synthase subunit B [Escherichia coli KTE232]
gb|ELJ62820.1| ATP synthase subunit B [Escherichia coli KTE82]
gb|ELJ66994.1| ATP synthase subunit B [Escherichia coli KTE88]
gb|ELJ67256.1| ATP synthase subunit B [Escherichia coli KTE85]
gb|ELJ77333.1| ATP synthase subunit B [Escherichia coli KTE90]
gb|ELJ80100.1| ATP synthase subunit B [Escherichia coli KTE95]
gb|ELJ91898.1| ATP synthase subunit B [Escherichia coli KTE97]
gb|ELJ94952.1| ATP synthase subunit B [Escherichia coli KTE99]
gb|ELL43874.1| F0F1 ATP synthase subunit B [Escherichia coli J96]
emb|CCP98566.1| ATP synthase B chain [Escherichia coli O10:K5(L):H4 str. ATCC
23506]
emb|CCP99892.1| ATP synthase B chain [Escherichia coli O5:K4(L):H4 str. ATCC 23502]
emb|CCQ06579.1| ATP synthase B chain [Escherichia coli Nissle 1917]
gb|AGC89231.1| F0F1 ATP synthase subunit B [Escherichia coli APEC O78]
gb|ELV15159.1| ATP synthase F0, B subunit [Escherichia coli 99.0814]
gb|ELV16717.1| ATP synthase F0, B subunit [Escherichia coli 09BKT078844]
gb|ELV24229.1| ATP synthase F0, B subunit [Escherichia coli 99.0815]
gb|ELV32079.1| ATP synthase F0, B subunit [Escherichia coli 99.0816]
gb|ELV32213.1| ATP synthase F0, B subunit [Escherichia coli 99.0839]
gb|ELV36583.1| ATP synthase F0, B subunit [Escherichia coli 99.0848]
gb|ELV45640.1| ATP synthase F0, B subunit [Escherichia coli 99.1753]
gb|ELV48815.1| ATP synthase F0, B subunit [Escherichia coli 99.1775]
gb|ELV52339.1| ATP synthase F0, B subunit [Escherichia coli 99.1793]
gb|ELV63519.1| ATP synthase F0, B subunit [Escherichia coli 99.1805]
gb|ELV64721.1| ATP synthase F0, B subunit [Escherichia coli ATCC 700728]
gb|ELV65086.1| ATP synthase F0, B subunit [Escherichia coli PA11]
gb|ELV78347.1| ATP synthase F0, B subunit [Escherichia coli PA13]
gb|ELV78525.1| ATP synthase F0, B subunit [Escherichia coli PA19]
gb|ELV86986.1| ATP synthase F0, B subunit [Escherichia coli PA2]
gb|ELV93353.1| ATP synthase F0, B subunit [Escherichia coli PA47]
gb|ELV94748.1| ATP synthase F0, B subunit [Escherichia coli PA48]
gb|ELW00996.1| ATP synthase F0, B subunit [Escherichia coli PA8]
gb|ELW10928.1| ATP synthase F0, B subunit [Escherichia coli 99.1781]
gb|ELW15558.1| ATP synthase F0, B subunit [Escherichia coli 99.1762]
gb|ELW24731.1| ATP synthase F0, B subunit [Escherichia coli PA35]
gb|ELW29701.1| ATP synthase F0, B subunit [Escherichia coli 3.4880]
gb|ELW32383.1| ATP synthase F0, B subunit [Escherichia coli 95.0083]
gb|ELW39132.1| ATP synthase F0, B subunit [Escherichia coli 99.0670]
gb|EMD03919.1| F0F1 ATP synthase subunit B [Escherichia coli O08]
gb|EMD04564.1| F0F1 ATP synthase subunit B [Escherichia coli S17]
gb|EMD06571.1| F0F1 ATP synthase subunit B [Escherichia coli SEPT362]
gb|EMR92706.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli ONT:H33 str. C48/93]
gb|EMR96213.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O104:H4 str. E92/11]
gb|EMR98133.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O104:H4 str. E112/10]
gb|EMS05125.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O127:H27 str. C43/90]
gb|EMU57700.1| ATP synthase F0, B subunit [Escherichia coli MP021552.11]
gb|EMU57842.1| ATP synthase F0, B subunit [Escherichia coli MP021552.7]
gb|EMU66874.1| ATP synthase F0, B subunit [Escherichia coli MP021552.12]
gb|EMU73926.1| ATP synthase F0, B subunit [Escherichia coli MP021017.9]
gb|EMU75556.1| ATP synthase F0, B subunit [Escherichia coli MP021017.6]
gb|EMU78028.1| ATP synthase F0, B subunit [Escherichia coli MP021017.5]
gb|EMU89028.1| ATP synthase F0, B subunit [Escherichia coli MP021017.4]
gb|EMU89952.1| ATP synthase F0, B subunit [Escherichia coli MP021017.3]
gb|EMU92417.1| ATP synthase F0, B subunit [Escherichia coli MP021017.2]
gb|EMV04057.1| ATP synthase F0, B subunit [Escherichia coli MP021017.10]
gb|EMV07643.1| ATP synthase F0, B subunit [Escherichia coli MP021017.11]
gb|EMV13660.1| ATP synthase F0, B subunit [Escherichia coli MP021017.12]
gb|EMV16063.1| ATP synthase F0, B subunit [Escherichia coli C-34666]
gb|EMV17616.1| ATP synthase F0, B subunit [Escherichia coli BCE034_MS-14]
gb|EMV30147.1| ATP synthase F0, B subunit [Escherichia coli BCE002_MS12]
gb|EMV35039.1| ATP synthase F0, B subunit [Escherichia coli 2875000]
gb|EMV43369.1| ATP synthase F0, B subunit [Escherichia coli 2872800]
gb|EMV52153.1| ATP synthase F0, B subunit [Escherichia coli 2872000]
gb|EMV54789.1| ATP synthase F0, B subunit [Escherichia coli 2867750]
gb|EMV67063.1| ATP synthase F0, B subunit [Escherichia coli 2866550]
gb|EMV68384.1| ATP synthase F0, B subunit [Escherichia coli 2866450]
gb|EMV70837.1| ATP synthase F0, B subunit [Escherichia coli 2866750]
gb|EMV82454.1| ATP synthase F0, B subunit [Escherichia coli 2861200]
gb|EMV86712.1| ATP synthase F0, B subunit [Escherichia coli 2865200]
gb|EMV89037.1| ATP synthase F0, B subunit [Escherichia coli 2860050]
gb|EMV98060.1| ATP synthase F0, B subunit [Escherichia coli 2853500]
gb|EMW03385.1| ATP synthase F0, B subunit [Escherichia coli 2850750]
gb|EMW14776.1| ATP synthase F0, B subunit [Escherichia coli 2850400]
gb|EMW15468.1| ATP synthase F0, B subunit [Escherichia coli 2845650]
gb|EMW17842.1| ATP synthase F0, B subunit [Escherichia coli 2848050]
gb|EMW28042.1| ATP synthase F0, B subunit [Escherichia coli 2845350]
gb|EMW32385.1| ATP synthase F0, B subunit [Escherichia coli 2785200]
gb|EMW39592.1| ATP synthase F0, B subunit [Escherichia coli 2788150]
gb|EMW45997.1| ATP synthase F0, B subunit [Escherichia coli 2780750]
gb|EMW52913.1| ATP synthase F0, B subunit [Escherichia coli 2762100]
gb|EMW57012.1| ATP synthase F0, B subunit [Escherichia coli 2756500]
gb|EMW65605.1| ATP synthase F0, B subunit [Escherichia coli 2749250]
gb|EMW70960.1| ATP synthase F0, B subunit [Escherichia coli 2747800]
gb|EMW73088.1| ATP synthase F0, B subunit [Escherichia coli 2731150]
gb|EMW76379.1| ATP synthase F0, B subunit [Escherichia coli 180600]
gb|EMW84006.1| ATP synthase F0, B subunit [Escherichia coli 180050]
gb|EMW92053.1| ATP synthase F0, B subunit [Escherichia coli 174750]
gb|EMW93375.1| ATP synthase F0, B subunit [Escherichia coli ThroopD]
gb|EMW97362.1| ATP synthase F0, B subunit [Escherichia coli P0304777.1]
gb|EMX10521.1| ATP synthase F0, B subunit [Escherichia coli P0302308.1]
gb|EMX12062.1| ATP synthase F0, B subunit [Escherichia coli P0302293.2]
gb|EMX17080.1| ATP synthase F0, B subunit [Escherichia coli P0301867.1]
gb|EMX20793.1| ATP synthase F0, B subunit [Escherichia coli MP021566.1]
gb|EMX28706.1| ATP synthase F0, B subunit [Escherichia coli MP021561.2]
gb|EMX35162.1| ATP synthase F0, B subunit [Escherichia coli MP021552.8]
gb|EMX44262.1| ATP synthase F0, B subunit [Escherichia coli MP021017.1]
gb|EMX46110.1| ATP synthase F0, B subunit [Escherichia coli MP020980.2]
gb|EMX46693.1| ATP synthase F0, B subunit [Escherichia coli Jurua 20/10]
gb|EMX50322.1| ATP synthase F0, B subunit [Escherichia coli MP020940.1]
gb|EMX60290.1| ATP synthase F0, B subunit [Escherichia coli Jurua 18/11]
gb|EMX65073.1| ATP synthase F0, B subunit [Escherichia coli Envira 10/1]
gb|EMX65194.1| ATP synthase F0, B subunit [Escherichia coli Envira 8/11]
gb|EMX72793.1| ATP synthase F0, B subunit [Escherichia coli 2726800]
gb|EMX82721.1| ATP synthase F0, B subunit [Escherichia coli 2719100]
gb|EMX85547.1| ATP synthase F0, B subunit [Escherichia coli BCE001_MS16]
gb|EMZ40869.1| ATP synthase subunit B [Escherichia coli SWW33]
gb|EMZ60967.1| ATP synthase F0, B subunit [Escherichia coli 174900]
gb|EMZ62134.1| ATP synthase F0, B subunit [Escherichia coli 2846750]
gb|EMZ63613.1| ATP synthase F0, B subunit [Escherichia coli 2735000]
gb|EMZ75294.1| ATP synthase F0, B subunit [Escherichia coli 199900.1]
gb|EMZ75811.1| ATP synthase F0, B subunit [Escherichia coli 2722950]
gb|EMZ80757.1| ATP synthase F0, B subunit [Escherichia coli p0305293.1]
gb|EMZ90572.1| ATP synthase F0, B subunit [Escherichia coli P0305260.1]
gb|EMZ94223.1| ATP synthase F0, B subunit [Escherichia coli P0304816.1]
gb|ENA01397.1| ATP synthase F0, B subunit [Escherichia coli P0299438.2]
gb|ENA02636.1| ATP synthase F0, B subunit [Escherichia coli P0299917.1]
gb|ENA11273.1| ATP synthase F0, B subunit [Escherichia coli P0298942.1]
gb|ENA13615.1| ATP synthase F0, B subunit [Escherichia coli BCE008_MS-13]
gb|ENA17100.1| ATP synthase F0, B subunit [Escherichia coli 201600.1]
gb|ENA27779.1| ATP synthase F0, B subunit [Escherichia coli BCE007_MS-11]
gb|ENA35390.1| ATP synthase F0, B subunit [Escherichia coli P0301867.4]
gb|ENA42373.1| ATP synthase F0, B subunit [Escherichia coli P0301867.2]
gb|ENA48404.1| ATP synthase F0, B subunit [Escherichia coli 2726950]
gb|ENA48663.1| ATP synthase F0, B subunit [Escherichia coli 2729250]
gb|ENA58025.1| ATP synthase F0, B subunit [Escherichia coli 178900]
gb|ENA59530.1| ATP synthase F0, B subunit [Escherichia coli 179550]
gb|ENA62911.1| ATP synthase F0, B subunit [Escherichia coli 180200]
gb|ENA74249.1| ATP synthase F0, B subunit [Escherichia coli 2730450]
gb|ENA75829.1| ATP synthase F0, B subunit [Escherichia coli 2741950]
gb|ENA76642.1| ATP synthase F0, B subunit [Escherichia coli 2730350]
gb|ENA89318.1| ATP synthase F0, B subunit [Escherichia coli 2860650]
gb|ENA90785.1| ATP synthase F0, B subunit [Escherichia coli 2862600]
gb|ENA91707.1| ATP synthase F0, B subunit [Escherichia coli 2864350]
gb|ENB04560.1| ATP synthase F0, B subunit [Escherichia coli 2866350]
gb|ENB08216.1| ATP synthase F0, B subunit [Escherichia coli 2875150]
gb|ENB09317.1| ATP synthase F0, B subunit [Escherichia coli BCE008_MS-01]
gb|ENB18785.1| ATP synthase F0, B subunit [Escherichia coli BCE011_MS-01]
gb|ENB24820.1| ATP synthase F0, B subunit [Escherichia coli BCE030_MS-09]
gb|ENB30331.1| ATP synthase F0, B subunit [Escherichia coli BCE032_MS-12]
gb|ENB32538.1| ATP synthase F0, B subunit [Escherichia coli MP021561.3]
gb|ENB35811.1| ATP synthase F0, B subunit [Escherichia coli P0298942.10]
gb|ENB45128.1| ATP synthase F0, B subunit [Escherichia coli P0298942.11]
gb|ENB51282.1| ATP synthase F0, B subunit [Escherichia coli P0298942.14]
gb|ENB54030.1| ATP synthase F0, B subunit [Escherichia coli P0298942.12]
gb|ENB57601.1| ATP synthase F0, B subunit [Escherichia coli P0298942.15]
gb|ENB57776.1| ATP synthase F0, B subunit [Escherichia coli P0298942.6]
gb|ENB58445.1| ATP synthase F0, B subunit [Escherichia coli P0298942.2]
gb|ENB72309.1| ATP synthase F0, B subunit [Escherichia coli P0298942.8]
gb|ENB73565.1| ATP synthase F0, B subunit [Escherichia coli P0298942.9]
gb|ENB74776.1| ATP synthase F0, B subunit [Escherichia coli P0298942.7]
gb|ENB85514.1| ATP synthase F0, B subunit [Escherichia coli P0299438.10]
gb|ENB92524.1| ATP synthase F0, B subunit [Escherichia coli P0299438.11]
gb|ENB95680.1| ATP synthase F0, B subunit [Escherichia coli P0299438.3]
gb|ENC00276.1| ATP synthase F0, B subunit [Escherichia coli P0299438.4]
gb|ENC07163.1| ATP synthase F0, B subunit [Escherichia coli P0299438.5]
gb|ENC11364.1| ATP synthase F0, B subunit [Escherichia coli P0299438.6]
gb|ENC12680.1| ATP synthase F0, B subunit [Escherichia coli P0299438.7]
gb|ENC21295.1| ATP synthase F0, B subunit [Escherichia coli P0299438.8]
gb|ENC28249.1| ATP synthase F0, B subunit [Escherichia coli P0299438.9]
gb|ENC29175.1| ATP synthase F0, B subunit [Escherichia coli P02997067.6]
gb|ENC37254.1| ATP synthase F0, B subunit [Escherichia coli P0299917.10]
gb|ENC44333.1| ATP synthase F0, B subunit [Escherichia coli P0299917.2]
gb|ENC50723.1| ATP synthase F0, B subunit [Escherichia coli P0299917.3]
gb|ENC52721.1| ATP synthase F0, B subunit [Escherichia coli P0299917.4]
gb|ENC57995.1| ATP synthase F0, B subunit [Escherichia coli P0299917.5]
gb|ENC67594.1| ATP synthase F0, B subunit [Escherichia coli P0299917.6]
gb|ENC67807.1| ATP synthase F0, B subunit [Escherichia coli P0299917.8]
gb|ENC75281.1| ATP synthase F0, B subunit [Escherichia coli P0299917.7]
gb|ENC80378.1| ATP synthase F0, B subunit [Escherichia coli P0299917.9]
gb|ENC88668.1| ATP synthase F0, B subunit [Escherichia coli P0301867.8]
gb|ENC88785.1| ATP synthase F0, B subunit [Escherichia coli P0301867.11]
gb|ENC96321.1| ATP synthase F0, B subunit [Escherichia coli P0302308.10]
gb|ENC99639.1| ATP synthase F0, B subunit [Escherichia coli P0302308.11]
gb|END08235.1| ATP synthase F0, B subunit [Escherichia coli P0302308.3]
gb|END11102.1| ATP synthase F0, B subunit [Escherichia coli P0302308.2]
gb|END19808.1| ATP synthase F0, B subunit [Escherichia coli P0302308.5]
gb|END20020.1| ATP synthase F0, B subunit [Escherichia coli P0302308.4]
gb|END30371.1| ATP synthase F0, B subunit [Escherichia coli 179100]
gb|END34827.1| ATP synthase F0, B subunit [Escherichia coli p0305293.13]
gb|END37930.1| ATP synthase F0, B subunit [Escherichia coli 2733950]
gb|END37962.1| ATP synthase F0, B subunit [Escherichia coli 2854350]
gb|END49836.1| ATP synthase F0, B subunit [Escherichia coli MP020980.1]
gb|END53723.1| ATP synthase F0, B subunit [Escherichia coli BCE006_MS-23]
gb|END62571.1| ATP synthase F0, B subunit [Escherichia coli P0298942.4]
gb|END63034.1| ATP synthase F0, B subunit [Escherichia coli P0298942.3]
gb|END65283.1| ATP synthase F0, B subunit [Escherichia coli P0299483.1]
gb|END76708.1| ATP synthase F0, B subunit [Escherichia coli P0299483.2]
gb|END78685.1| ATP synthase F0, B subunit [Escherichia coli P0299483.3]
gb|END87665.1| ATP synthase F0, B subunit [Escherichia coli P0301867.13]
gb|END88742.1| ATP synthase F0, B subunit [Escherichia coli P0301904.3]
gb|END95400.1| ATP synthase F0, B subunit [Escherichia coli P0302293.7]
gb|ENE02094.1| ATP synthase F0, B subunit [Escherichia coli P0304799.3]
gb|ENE04644.1| ATP synthase F0, B subunit [Escherichia coli P0305260.2]
gb|ENE06411.1| ATP synthase F0, B subunit [Escherichia coli p0305293.14]
gb|ENE17892.1| ATP synthase F0, B subunit [Escherichia coli P0302293.10]
gb|ENE20131.1| ATP synthase F0, B subunit [Escherichia coli P0302293.3]
gb|ENE27524.1| ATP synthase F0, B subunit [Escherichia coli P0302293.4]
gb|ENE33857.1| ATP synthase F0, B subunit [Escherichia coli P0302293.6]
gb|ENE38627.1| ATP synthase F0, B subunit [Escherichia coli P0302293.8]
gb|ENE43108.1| ATP synthase F0, B subunit [Escherichia coli P0304777.10]
gb|ENE47974.1| ATP synthase F0, B subunit [Escherichia coli P0302293.9]
gb|ENE54051.1| ATP synthase F0, B subunit [Escherichia coli P0304777.11]
gb|ENE60940.1| ATP synthase F0, B subunit [Escherichia coli P0304777.12]
gb|ENE62605.1| ATP synthase F0, B subunit [Escherichia coli P0304777.13]
gb|ENE67784.1| ATP synthase F0, B subunit [Escherichia coli P0304777.14]
gb|ENE74086.1| ATP synthase F0, B subunit [Escherichia coli P0304777.15]
gb|ENE77903.1| ATP synthase F0, B subunit [Escherichia coli P0304777.2]
gb|ENE84207.1| ATP synthase F0, B subunit [Escherichia coli P0304777.3]
gb|ENE91504.1| ATP synthase F0, B subunit [Escherichia coli P0304777.4]
gb|ENE94691.1| ATP synthase F0, B subunit [Escherichia coli P0304777.5]
gb|ENE98166.1| ATP synthase F0, B subunit [Escherichia coli P0304777.7]
gb|ENF06022.1| ATP synthase F0, B subunit [Escherichia coli P0304777.8]
gb|ENF09327.1| ATP synthase F0, B subunit [Escherichia coli P0304777.9]
gb|ENF17304.1| ATP synthase F0, B subunit [Escherichia coli P0304816.11]
gb|ENF21252.1| ATP synthase F0, B subunit [Escherichia coli P0304816.10]
gb|ENF28238.1| ATP synthase F0, B subunit [Escherichia coli P0304816.12]
gb|ENF31651.1| ATP synthase F0, B subunit [Escherichia coli P0304816.14]
gb|ENF37586.1| ATP synthase F0, B subunit [Escherichia coli P0304816.13]
gb|ENF43930.1| ATP synthase F0, B subunit [Escherichia coli P0304816.15]
gb|ENF47570.1| ATP synthase F0, B subunit [Escherichia coli P0304816.2]
gb|ENF47898.1| ATP synthase F0, B subunit [Escherichia coli P0304816.6]
gb|ENF59980.1| ATP synthase F0, B subunit [Escherichia coli P0304816.7]
gb|ENF65728.1| ATP synthase F0, B subunit [Escherichia coli P0304816.8]
gb|ENF68185.1| ATP synthase F0, B subunit [Escherichia coli P0304816.9]
gb|ENF71904.1| ATP synthase F0, B subunit [Escherichia coli P0305260.10]
gb|ENF80180.1| ATP synthase F0, B subunit [Escherichia coli P0305260.11]
gb|ENF82325.1| ATP synthase F0, B subunit [Escherichia coli P0305260.12]
gb|ENF86905.1| ATP synthase F0, B subunit [Escherichia coli P0305260.13]
gb|ENF94360.1| ATP synthase F0, B subunit [Escherichia coli P0305260.15]
gb|ENF99147.1| ATP synthase F0, B subunit [Escherichia coli P0305260.3]
gb|ENG00762.1| ATP synthase F0, B subunit [Escherichia coli P0305260.4]
gb|ENG09577.1| ATP synthase F0, B subunit [Escherichia coli P0305260.5]
gb|ENG12197.1| ATP synthase F0, B subunit [Escherichia coli P0305260.6]
gb|ENG13183.1| ATP synthase F0, B subunit [Escherichia coli P0305260.7]
gb|ENG22748.1| ATP synthase F0, B subunit [Escherichia coli P0305260.8]
gb|ENG26813.1| ATP synthase F0, B subunit [Escherichia coli p0305293.10]
gb|ENG30232.1| ATP synthase F0, B subunit [Escherichia coli P0305260.9]
gb|ENG38151.1| ATP synthase F0, B subunit [Escherichia coli p0305293.11]
gb|ENG40048.1| ATP synthase F0, B subunit [Escherichia coli p0305293.12]
gb|ENG48867.1| ATP synthase F0, B subunit [Escherichia coli p0305293.15]
gb|ENG52599.1| ATP synthase F0, B subunit [Escherichia coli p0305293.2]
gb|ENG58157.1| ATP synthase F0, B subunit [Escherichia coli p0305293.3]
gb|ENG60589.1| ATP synthase F0, B subunit [Escherichia coli p0305293.4]
gb|ENG68523.1| ATP synthase F0, B subunit [Escherichia coli p0305293.8]
gb|ENG75167.1| ATP synthase F0, B subunit [Escherichia coli p0305293.9]
gb|ENG80591.1| ATP synthase F0, B subunit [Escherichia coli 178200]
gb|ENG87282.1| ATP synthase F0, B subunit [Escherichia coli 178850]
gb|ENG94283.1| ATP synthase F0, B subunit [Escherichia coli P0301867.3]
gb|ENG98996.1| ATP synthase F0, B subunit [Escherichia coli P0301867.5]
gb|ENH06309.1| ATP synthase F0, B subunit [Escherichia coli P0301867.7]
gb|ENH14532.1| ATP synthase F0, B subunit [Escherichia coli P0302308.12]
gb|ENH16816.1| ATP synthase F0, B subunit [Escherichia coli P0302308.14]
gb|ENH26999.1| ATP synthase F0, B subunit [Escherichia coli P0302308.13]
gb|ENH29231.1| ATP synthase F0, B subunit [Escherichia coli P0304816.3]
gb|ENH29404.1| ATP synthase F0, B subunit [Escherichia coli P0304816.4]
gb|ENH36407.1| ATP synthase F0, B subunit [Escherichia coli P0304816.5]
gb|ENH42385.1| ATP synthase F0, B subunit [Escherichia coli p0305293.5]
gb|ENH49230.1| ATP synthase F0, B subunit [Escherichia coli p0305293.7]
gb|ENH53246.1| ATP synthase F0, B subunit [Escherichia coli p0305293.6]
gb|ENO08378.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O157:H43 str. T22]
gb|EOQ49021.1| ATP synthase subunit B [Escherichia coli KTE33]
gb|EOR54398.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli ATCC 25922]
gb|EOU28346.1| ATP synthase subunit B [Escherichia coli KTE7]
gb|EOU29355.1| ATP synthase subunit B [Escherichia coli KTE13]
gb|EOU29569.1| ATP synthase subunit B [Escherichia coli KTE3]
gb|EOU41678.1| ATP synthase subunit B [Escherichia coli KTE35]
gb|EOU46753.1| ATP synthase subunit B [Escherichia sp. KTE114]
gb|EOU47641.1| ATP synthase subunit B [Escherichia coli KTE231]
gb|EOU55877.1| ATP synthase subunit B [Escherichia coli KTE14]
gb|EOU60390.1| ATP synthase subunit B [Escherichia coli KTE19]
gb|EOU62326.1| ATP synthase subunit B [Escherichia coli KTE20]
gb|EOU73801.1| ATP synthase subunit B [Escherichia coli KTE27]
gb|EOU76544.1| ATP synthase subunit B [Escherichia sp. KTE31]
gb|EOU86422.1| ATP synthase subunit B [Escherichia coli KTE34]
gb|EOU86636.1| ATP synthase subunit B [Escherichia coli KTE36]
gb|EOU87236.1| ATP synthase subunit B [Escherichia coli KTE37]
gb|EOV01083.1| ATP synthase subunit B [Escherichia coli KTE38]
gb|EOV03851.1| ATP synthase subunit B [Escherichia coli KTE195]
gb|EOV03884.1| ATP synthase subunit B [Escherichia coli KTE40]
gb|EOV14827.1| ATP synthase subunit B [Escherichia coli KTE198]
gb|EOV19403.1| ATP synthase subunit B [Escherichia coli KTE200]
gb|EOV20895.1| ATP synthase subunit B [Escherichia coli KTE199]
gb|EOV31252.1| ATP synthase subunit B [Escherichia coli KTE219]
gb|EOV33485.1| ATP synthase subunit B [Escherichia coli KTE221]
gb|EOV41579.1| ATP synthase subunit B [Escherichia coli KTE222]
gb|EOV46368.1| ATP synthase subunit B [Escherichia sp. KTE52]
gb|EOV47571.1| ATP synthase subunit B [Escherichia coli KTE61]
gb|EOV53153.1| ATP synthase subunit B [Escherichia coli KTE64]
gb|EOV57036.1| ATP synthase subunit B [Escherichia coli KTE68]
gb|EOV60474.1| ATP synthase subunit B [Escherichia coli KTE69]
gb|EOV69424.1| ATP synthase subunit B [Escherichia coli KTE70]
gb|EOV71187.1| ATP synthase subunit B [Escherichia coli KTE71]
gb|EOV74461.1| ATP synthase subunit B [Escherichia coli KTE73]
gb|EOV84570.1| ATP synthase subunit B [Escherichia coli KTE74]
gb|EOV87139.1| ATP synthase subunit B [Escherichia coli KTE89]
gb|EOV92599.1| ATP synthase subunit B [Escherichia sp. KTE96]
gb|EOW02065.1| ATP synthase subunit B [Escherichia coli KTE100]
gb|EOW02670.1| ATP synthase subunit B [Escherichia coli KTE98]
gb|EOW09806.1| ATP synthase subunit B [Escherichia coli KTE103]
gb|EOW13970.1| ATP synthase subunit B [Escherichia coli KTE102]
gb|EOW17517.1| ATP synthase subunit B [Escherichia coli KTE107]
gb|EOW26663.1| ATP synthase subunit B [Escherichia coli KTE121]
gb|EOW27135.1| ATP synthase subunit B [Escherichia coli KTE108]
gb|EOW31593.1| ATP synthase subunit B [Escherichia coli KTE127]
gb|EOW33557.1| ATP synthase subunit B [Escherichia coli KTE126]
gb|EOW41209.1| ATP synthase subunit B [Escherichia coli KTE130]
gb|EOW43292.1| ATP synthase subunit B [Escherichia coli KTE132]
gb|EOW56366.1| ATP synthase subunit B [Escherichia coli KTE155]
gb|EOW58850.1| ATP synthase subunit B [Escherichia coli KTE134]
gb|EOW59240.1| ATP synthase subunit B [Escherichia sp. KTE159]
gb|EOW63558.1| ATP synthase subunit B [Escherichia coli KTE170]
gb|EOW72577.1| ATP synthase subunit B [Escherichia sp. KTE172]
gb|EOW88409.1| ATP synthase subunit B [Escherichia coli KTE1]
gb|EOW88545.1| ATP synthase subunit B [Escherichia coli KTE41]
gb|EOW93706.1| ATP synthase subunit B [Escherichia coli KTE182]
gb|EOX05474.1| ATP synthase subunit B [Escherichia coli KTE226]
gb|EOX07903.1| ATP synthase subunit B [Escherichia coli KTE240]
gb|EOX15217.1| ATP synthase subunit B [Escherichia coli KTE225]
gb|EOX28070.1| ATP synthase subunit B [Escherichia coli KTE186]
gb|EPH48126.1| ATP synthase B chain [Escherichia coli E2265]
emb|CDC75662.1| aTP synthase subunit b [Escherichia coli CAG:4]
gb|EQM99599.1| ATP synthase subunit B [Escherichia coli HVH 2 (4-6943160)]
gb|EQN02504.1| ATP synthase subunit B [Escherichia coli HVH 3 (4-7276001)]
gb|EQN04868.1| ATP synthase subunit B [Escherichia coli HVH 1 (4-6876161)]
gb|EQN14430.1| ATP synthase subunit B [Escherichia coli HVH 4 (4-7276109)]
gb|EQN15707.1| ATP synthase subunit B [Escherichia coli HVH 5 (4-7148410)]
gb|EQN22500.1| ATP synthase subunit B [Escherichia coli HVH 6 (3-8296502)]
gb|EQN29524.1| ATP synthase subunit B [Escherichia coli HVH 7 (4-7315031)]
gb|EQN37517.1| ATP synthase subunit B [Escherichia coli HVH 10 (4-6832164)]
gb|EQN43408.1| ATP synthase subunit B [Escherichia coli HVH 13 (4-7634056)]
gb|EQN45345.1| ATP synthase subunit B [Escherichia coli HVH 16 (4-7649002)]
gb|EQN50578.1| ATP synthase subunit B [Escherichia coli HVH 17 (4-7473087)]
gb|EQN59199.1| ATP synthase subunit B [Escherichia coli HVH 20 (4-5865042)]
gb|EQN61109.1| ATP synthase subunit B [Escherichia coli HVH 18 (4-8589585)]
gb|EQN66486.1| ATP synthase subunit B [Escherichia coli HVH 19 (4-7154984)]
gb|EQN72548.1| ATP synthase subunit B [Escherichia coli HVH 21 (4-4517873)]
gb|EQN78747.1| ATP synthase subunit B [Escherichia coli HVH 22 (4-2258986)]
gb|EQN81942.1| ATP synthase subunit B [Escherichia coli HVH 24 (4-5985145)]
gb|EQN88890.1| ATP synthase subunit B [Escherichia coli HVH 25 (4-5851939)]
gb|EQN89936.1| ATP synthase subunit B [Escherichia coli HVH 26 (4-5703913)]
gb|EQN92836.1| ATP synthase subunit B [Escherichia coli HVH 27 (4-7449267)]
gb|EQO04813.1| ATP synthase subunit B [Escherichia coli HVH 29 (4-3418073)]
gb|EQO05376.1| ATP synthase subunit B [Escherichia coli HVH 28 (4-0907367)]
gb|EQO12940.1| ATP synthase subunit B [Escherichia coli HVH 30 (4-2661829)]
gb|EQO13845.1| ATP synthase subunit B [Escherichia coli HVH 31 (4-2602156)]
gb|EQO19735.1| ATP synthase subunit B [Escherichia coli HVH 32 (4-3773988)]
gb|EQO25622.1| ATP synthase subunit B [Escherichia coli HVH 33 (4-2174936)]
gb|EQO28601.1| ATP synthase subunit B [Escherichia coli HVH 35 (4-2962667)]
gb|EQO39089.1| ATP synthase subunit B [Escherichia coli HVH 39 (4-2679949)]
gb|EQO43564.1| ATP synthase subunit B [Escherichia coli HVH 38 (4-2774682)]
gb|EQO55796.1| ATP synthase subunit B [Escherichia coli HVH 41 (4-2677849)]
gb|EQO57761.1| ATP synthase subunit B [Escherichia coli HVH 42 (4-2100061)]
gb|EQO67593.1| ATP synthase subunit B [Escherichia coli HVH 44 (4-2298570)]
gb|EQO70533.1| ATP synthase subunit B [Escherichia coli HVH 43 (4-2173468)]
gb|EQO75931.1| ATP synthase subunit B [Escherichia coli HVH 45 (4-3129918)]
gb|EQO81194.1| ATP synthase subunit B [Escherichia coli HVH 48 (4-2658593)]
gb|EQO82462.1| ATP synthase subunit B [Escherichia coli HVH 46 (4-2758776)]
gb|EQO88853.1| ATP synthase subunit B [Escherichia coli HVH 51 (4-2172526)]
gb|EQO95599.1| ATP synthase subunit B [Escherichia coli HVH 55 (4-2646161)]
gb|EQP04365.1| ATP synthase subunit B [Escherichia coli HVH 56 (4-2153033)]
gb|EQP04977.1| ATP synthase subunit B [Escherichia coli HVH 53 (4-0631051)]
gb|EQP07087.1| ATP synthase subunit B [Escherichia coli HVH 58 (4-2839709)]
gb|EQP14221.1| ATP synthase subunit B [Escherichia coli HVH 59 (4-1119338)]
gb|EQP17267.1| ATP synthase subunit B [Escherichia coli HVH 61 (4-2736020)]
gb|EQP21305.1| ATP synthase subunit B [Escherichia coli HVH 63 (4-2542528)]
gb|EQP30017.1| ATP synthase subunit B [Escherichia coli HVH 65 (4-2262045)]
gb|EQP31128.1| ATP synthase subunit B [Escherichia coli HVH 68 (4-0888028)]
gb|EQP32231.1| ATP synthase subunit B [Escherichia coli HVH 69 (4-2837072)]
gb|EQP44992.1| ATP synthase subunit B [Escherichia coli HVH 70 (4-2963531)]
gb|EQP46941.1| ATP synthase subunit B [Escherichia coli HVH 73 (4-2393174)]
gb|EQP47377.1| ATP synthase subunit B [Escherichia coli HVH 74 (4-1034782)]
gb|EQP59040.1| ATP synthase subunit B [Escherichia coli HVH 76 (4-2538717)]
gb|EQP65386.1| ATP synthase subunit B [Escherichia coli HVH 78 (4-2735946)]
gb|EQP65854.1| ATP synthase subunit B [Escherichia coli HVH 77 (4-2605759)]
gb|EQP67957.1| ATP synthase subunit B [Escherichia coli HVH 79 (4-2512823)]
gb|EQP75996.1| ATP synthase subunit B [Escherichia coli HVH 80 (4-2428830)]
gb|EQP86684.1| ATP synthase subunit B [Escherichia coli HVH 84 (4-1021478)]
gb|EQP89650.1| ATP synthase subunit B [Escherichia coli HVH 85 (4-0792144)]
gb|EQP90732.1| ATP synthase subunit B [Escherichia coli HVH 82 (4-2209276)]
gb|EQP99706.1| ATP synthase subunit B [Escherichia coli HVH 88 (4-5854636)]
gb|EQQ00973.1| ATP synthase subunit B [Escherichia coli HVH 87 (4-5977630)]
gb|EQQ01874.1| ATP synthase subunit B [Escherichia coli HVH 89 (4-5885604)]
gb|EQQ11462.1| ATP synthase subunit B [Escherichia coli HVH 90 (4-3191362)]
gb|EQQ16314.1| ATP synthase subunit B [Escherichia coli HVH 91 (4-4638751)]
gb|EQQ20958.1| ATP synthase subunit B [Escherichia coli HVH 92 (4-5930790)]
gb|EQQ23582.1| ATP synthase subunit B [Escherichia coli HVH 95 (4-6074464)]
gb|EQQ35211.1| ATP synthase subunit B [Escherichia coli HVH 96 (4-5934869)]
gb|EQQ37193.1| ATP synthase subunit B [Escherichia coli HVH 102 (4-6906788)]
gb|EQQ44642.1| ATP synthase subunit B [Escherichia coli HVH 100 (4-2850729)]
gb|EQQ46486.1| ATP synthase subunit B [Escherichia coli HVH 103 (4-5904188)]
gb|EQQ46849.1| ATP synthase subunit B [Escherichia coli HVH 104 (4-6977960)]
gb|EQQ55524.1| ATP synthase subunit B [Escherichia coli HVH 106 (4-6881831)]
gb|EQQ63839.1| ATP synthase subunit B [Escherichia coli HVH 110 (4-6978754)]
gb|EQQ65436.1| ATP synthase subunit B [Escherichia coli HVH 109 (4-6977162)]
gb|EQQ66308.1| ATP synthase subunit B [Escherichia coli HVH 107 (4-5860571)]
gb|EQQ71177.1| ATP synthase subunit B [Escherichia coli HVH 111 (4-7039018)]
gb|EQQ83856.1| ATP synthase subunit B [Escherichia coli HVH 112 (4-5987253)]
gb|EQQ83955.1| ATP synthase subunit B [Escherichia coli HVH 113 (4-7535473)]
gb|EQQ84661.1| ATP synthase subunit B [Escherichia coli HVH 114 (4-7037740)]
gb|EQQ94265.1| ATP synthase subunit B [Escherichia coli HVH 115 (4-4465997)]
gb|EQQ95592.1| ATP synthase subunit B [Escherichia coli HVH 115 (4-4465989)]
gb|EQR04160.1| ATP synthase subunit B [Escherichia coli HVH 116 (4-6879942)]
gb|EQR11965.1| ATP synthase subunit B [Escherichia coli HVH 117 (4-6857191)]
gb|EQR14223.1| ATP synthase subunit B [Escherichia coli HVH 118 (4-7345399)]
gb|EQR17690.1| ATP synthase subunit B [Escherichia coli HVH 119 (4-6879578)]
gb|EQR24946.1| ATP synthase subunit B [Escherichia coli HVH 120 (4-6978681)]
gb|EQR30323.1| ATP synthase subunit B [Escherichia coli HVH 122 (4-6851606)]
gb|EQR33093.1| ATP synthase subunit B [Escherichia coli HVH 121 (4-6877826)]
gb|EQR39701.1| ATP synthase subunit B [Escherichia coli HVH 125 (4-2634716)]
gb|EQR45095.1| ATP synthase subunit B [Escherichia coli HVH 126 (4-6034225)]
gb|EQR50779.1| ATP synthase subunit B [Escherichia coli HVH 127 (4-7303629)]
gb|EQR55919.1| ATP synthase subunit B [Escherichia coli HVH 128 (4-7030436)]
gb|EQR58762.1| ATP synthase subunit B [Escherichia coli HVH 130 (4-7036876)]
gb|EQR62093.1| ATP synthase subunit B [Escherichia coli HVH 132 (4-6876862)]
gb|EQR72775.1| ATP synthase subunit B [Escherichia coli HVH 135 (4-4449320)]
gb|EQR81346.1| ATP synthase subunit B [Escherichia coli HVH 134 (4-6073441)]
gb|EQR83534.1| ATP synthase subunit B [Escherichia coli HVH 133 (4-4466519)]
gb|EQR86153.1| ATP synthase subunit B [Escherichia coli HVH 137 (4-2124971)]
gb|EQR91355.1| ATP synthase subunit B [Escherichia coli HVH 138 (4-6066704)]
gb|EQR92570.1| ATP synthase subunit B [Escherichia coli HVH 139 (4-3192644)]
gb|EQR99676.1| ATP synthase subunit B [Escherichia coli HVH 140 (4-5894387)]
gb|EQS00698.1| ATP synthase subunit B [Escherichia coli HVH 141 (4-5995973)]
gb|EQS10241.1| ATP synthase subunit B [Escherichia coli HVH 143 (4-5674999)]
gb|EQS13914.1| ATP synthase subunit B [Escherichia coli HVH 142 (4-5627451)]
gb|EQS14540.1| ATP synthase subunit B [Escherichia coli HVH 144 (4-4451937)]
gb|EQS27195.1| ATP synthase subunit B [Escherichia coli HVH 145 (4-5672112)]
gb|EQS29908.1| ATP synthase subunit B [Escherichia coli HVH 147 (4-5893887)]
gb|EQS31058.1| ATP synthase subunit B [Escherichia coli HVH 146 (4-3189767)]
gb|EQS35252.1| ATP synthase subunit B [Escherichia coli HVH 149 (4-4451880)]
gb|EQS44032.1| ATP synthase subunit B [Escherichia coli HVH 151 (4-5755573)]
gb|EQS46477.1| ATP synthase subunit B [Escherichia coli HVH 153 (3-9344314)]
gb|EQS50961.1| ATP synthase subunit B [Escherichia coli HVH 150 (4-3258106)]
gb|EQS58839.1| ATP synthase subunit B [Escherichia coli HVH 158 (4-3224287)]
gb|EQS62471.1| ATP synthase subunit B [Escherichia coli HVH 154 (4-5636698)]
gb|EQS71097.1| ATP synthase subunit B [Escherichia coli HVH 161 (4-3119890)]
gb|EQS76702.1| ATP synthase subunit B [Escherichia coli HVH 162 (4-5627982)]
gb|EQS79937.1| ATP synthase subunit B [Escherichia coli HVH 163 (4-4697553)]
gb|EQS82170.1| ATP synthase subunit B [Escherichia coli HVH 164 (4-5953081)]
gb|EQS84758.1| ATP synthase subunit B [Escherichia coli HVH 167 (4-6073565)]
gb|EQS93029.1| ATP synthase subunit B [Escherichia coli HVH 169 (4-1075578)]
gb|EQS95147.1| ATP synthase subunit B [Escherichia coli HVH 171 (4-3191958)]
gb|EQS99582.1| ATP synthase subunit B [Escherichia coli HVH 170 (4-3026949)]
gb|EQT07370.1| ATP synthase subunit B [Escherichia coli HVH 172 (4-3248542)]
gb|EQT09877.1| ATP synthase subunit B [Escherichia coli HVH 173 (3-9175482)]
gb|EQT19073.1| ATP synthase subunit B [Escherichia coli HVH 176 (4-3428664)]
gb|EQT20270.1| ATP synthase subunit B [Escherichia coli HVH 175 (4-3405184)]
gb|EQT24199.1| ATP synthase subunit B [Escherichia coli HVH 180 (4-3051617)]
gb|EQT33531.1| ATP synthase subunit B [Escherichia coli HVH 182 (4-0985554)]
gb|EQT34420.1| ATP synthase subunit B [Escherichia coli HVH 183 (4-3205932)]
gb|EQT41492.1| ATP synthase subunit B [Escherichia coli HVH 184 (4-3343286)]
gb|EQT46342.1| ATP synthase subunit B [Escherichia coli HVH 185 (4-2876639)]
gb|EQT51731.1| ATP synthase subunit B [Escherichia coli HVH 187 (4-4471660)]
gb|EQT53199.1| ATP synthase subunit B [Escherichia coli HVH 186 (4-3405044)]
gb|EQT57940.1| ATP synthase subunit B [Escherichia coli HVH 188 (4-2356988)]
gb|EQT66269.1| ATP synthase subunit B [Escherichia coli HVH 190 (4-3255514)]
gb|EQT73342.1| ATP synthase subunit B [Escherichia coli HVH 189 (4-3220125)]
gb|EQT74093.1| ATP synthase subunit B [Escherichia coli HVH 191 (3-9341900)]
gb|EQT80002.1| ATP synthase subunit B [Escherichia coli HVH 192 (4-3054470)]
gb|EQT86224.1| ATP synthase subunit B [Escherichia coli HVH 193 (4-3331423)]
gb|EQT90569.1| ATP synthase subunit B [Escherichia coli HVH 195 (3-7155360)]
gb|EQT97746.1| ATP synthase subunit B [Escherichia coli HVH 196 (4-4530470)]
gb|EQU00189.1| ATP synthase subunit B [Escherichia coli HVH 194 (4-2356805)]
gb|EQU06952.1| ATP synthase subunit B [Escherichia coli HVH 198 (4-3206106)]
gb|EQU07826.1| ATP synthase subunit B [Escherichia coli HVH 199 (4-5670322)]
gb|EQU09601.1| ATP synthase subunit B [Escherichia coli HVH 197 (4-4466217)]
gb|EQU18786.1| ATP synthase subunit B [Escherichia coli HVH 200 (4-4449924)]
gb|EQU19618.1| ATP synthase subunit B [Escherichia coli HVH 201 (4-4459431)]
gb|EQU29975.1| ATP synthase subunit B [Escherichia coli HVH 202 (4-3163997)]
gb|EQU31314.1| ATP synthase subunit B [Escherichia coli HVH 203 (4-3126218)]
gb|EQU38045.1| ATP synthase subunit B [Escherichia coli HVH 204 (4-3112802)]
gb|EQU43785.1| ATP synthase subunit B [Escherichia coli HVH 205 (4-3094677)]
gb|EQU46749.1| ATP synthase subunit B [Escherichia coli HVH 206 (4-3128229)]
gb|EQU52319.1| ATP synthase subunit B [Escherichia coli HVH 207 (4-3113221)]
gb|EQU57865.1| ATP synthase subunit B [Escherichia coli HVH 208 (4-3112292)]
gb|EQU67303.1| ATP synthase subunit B [Escherichia coli HVH 211 (4-3041891)]
gb|EQU69854.1| ATP synthase subunit B [Escherichia coli HVH 212 (3-9305343)]
gb|EQU74302.1| ATP synthase subunit B [Escherichia coli HVH 209 (4-3062651)]
gb|EQU76457.1| ATP synthase subunit B [Escherichia coli HVH 213 (4-3042928)]
gb|EQU85772.1| ATP synthase subunit B [Escherichia coli HVH 215 (4-3008371)]
gb|EQU89748.1| ATP synthase subunit B [Escherichia coli HVH 217 (4-1022806)]
gb|EQU91444.1| ATP synthase subunit B [Escherichia coli HVH 216 (4-3042952)]
gb|EQU97377.1| ATP synthase subunit B [Escherichia coli HVH 218 (4-4500903)]
gb|EQV04337.1| ATP synthase subunit B [Escherichia coli HVH 221 (4-3136817)]
gb|EQV05170.1| ATP synthase subunit B [Escherichia coli HVH 220 (4-5876842)]
gb|EQV10612.1| ATP synthase subunit B [Escherichia coli HVH 222 (4-2977443)]
gb|EQV18229.1| ATP synthase subunit B [Escherichia coli HVH 223 (4-2976528)]
gb|EQV22336.1| ATP synthase subunit B [Escherichia coli HVH 227 (4-2277670)]
gb|EQV22789.1| ATP synthase subunit B [Escherichia coli HVH 225 (4-1273116)]
gb|EQV29974.1| ATP synthase subunit B [Escherichia coli KOEGE 30 (63a)]
gb|EQV43045.1| ATP synthase subunit B [Escherichia coli KOEGE 33 (68a)]
gb|EQV44786.1| ATP synthase subunit B [Escherichia coli KOEGE 32 (66a)]
gb|EQV51031.1| ATP synthase subunit B [Escherichia coli KOEGE 43 (105a)]
gb|EQV53898.1| ATP synthase subunit B [Escherichia coli KOEGE 40 (102a)]
gb|EQV54369.1| ATP synthase subunit B [Escherichia coli KOEGE 44 (106a)]
gb|EQV62639.1| ATP synthase subunit B [Escherichia coli KOEGE 56 (169a)]
gb|EQV64147.1| ATP synthase subunit B [Escherichia coli KOEGE 61 (174a)]
gb|EQV64246.1| ATP synthase subunit B [Escherichia coli KOEGE 58 (171a)]
gb|EQV76581.1| ATP synthase subunit B [Escherichia coli KOEGE 68 (182a)]
gb|EQV80056.1| ATP synthase subunit B [Escherichia coli KOEGE 70 (185a)]
gb|EQV80912.1| ATP synthase subunit B [Escherichia coli KOEGE 62 (175a)]
gb|EQV87968.1| ATP synthase subunit B [Escherichia coli KOEGE 71 (186a)]
gb|EQV96280.1| ATP synthase subunit B [Escherichia coli KOEGE 77 (202a)]
gb|EQV98382.1| ATP synthase subunit B [Escherichia coli KOEGE 73 (195a)]
gb|EQW09485.1| ATP synthase subunit B [Escherichia coli KOEGE 131 (358a)]
gb|EQW10158.1| ATP synthase subunit B [Escherichia coli KOEGE 118 (317a)]
gb|EQW14335.1| ATP synthase subunit B [Escherichia coli UMEA 3014-1]
gb|EQW15381.1| ATP synthase subunit B [Escherichia coli UMEA 3022-1]
gb|EQW25392.1| ATP synthase subunit B [Escherichia coli UMEA 3033-1]
gb|EQW28034.1| ATP synthase subunit B [Escherichia coli UMEA 3041-1]
gb|EQW28563.1| ATP synthase subunit B [Escherichia coli UMEA 3052-1]
gb|EQW38394.1| ATP synthase subunit B [Escherichia coli UMEA 3053-1]
gb|EQW40437.1| ATP synthase subunit B [Escherichia coli UMEA 3065-1]
gb|EQW48321.1| ATP synthase subunit B [Escherichia coli UMEA 3087-1]
gb|EQW52158.1| ATP synthase subunit B [Escherichia coli UMEA 3097-1]
gb|EQW57126.1| ATP synthase subunit B [Escherichia coli UMEA 3088-1]
gb|EQW63000.1| ATP synthase subunit B [Escherichia coli UMEA 3113-1]
gb|EQW63229.1| ATP synthase subunit B [Escherichia coli UMEA 3108-1]
gb|EQW72122.1| ATP synthase subunit B [Escherichia coli UMEA 3117-1]
gb|EQW74926.1| ATP synthase subunit B [Escherichia coli UMEA 3121-1]
gb|EQW80837.1| ATP synthase subunit B [Escherichia coli UMEA 3122-1]
gb|EQW83482.1| ATP synthase subunit B [Escherichia coli UMEA 3124-1]
gb|EQW88528.1| ATP synthase subunit B [Escherichia coli UMEA 3139-1]
gb|EQW98928.1| ATP synthase subunit B [Escherichia coli UMEA 3152-1]
gb|EQW99465.1| ATP synthase subunit B [Escherichia coli UMEA 3140-1]
gb|EQX07320.1| ATP synthase subunit B [Escherichia coli UMEA 3159-1]
gb|EQX07455.1| ATP synthase subunit B [Escherichia coli UMEA 3155-1]
gb|EQX12629.1| ATP synthase subunit B [Escherichia coli UMEA 3160-1]
gb|EQX15608.1| ATP synthase subunit B [Escherichia coli UMEA 3161-1]
gb|EQX24878.1| ATP synthase subunit B [Escherichia coli UMEA 3162-1]
gb|EQX28635.1| ATP synthase subunit B [Escherichia coli UMEA 3163-1]
gb|EQX29312.1| ATP synthase subunit B [Escherichia coli UMEA 3172-1]
gb|EQX38947.1| ATP synthase subunit B [Escherichia coli UMEA 3173-1]
gb|EQX40222.1| ATP synthase subunit B [Escherichia coli UMEA 3175-1]
gb|EQX48376.1| ATP synthase subunit B [Escherichia coli UMEA 3174-1]
gb|EQX52165.1| ATP synthase subunit B [Escherichia coli UMEA 3176-1]
gb|EQX52810.1| ATP synthase subunit B [Escherichia coli UMEA 3178-1]
gb|EQX62872.1| ATP synthase subunit B [Escherichia coli UMEA 3185-1]
gb|EQX65623.1| ATP synthase subunit B [Escherichia coli UMEA 3180-1]
gb|EQX72331.1| ATP synthase subunit B [Escherichia coli UMEA 3193-1]
gb|EQX75392.1| ATP synthase subunit B [Escherichia coli UMEA 3190-1]
gb|EQX81004.1| ATP synthase subunit B [Escherichia coli UMEA 3199-1]
gb|EQX83523.1| ATP synthase subunit B [Escherichia coli UMEA 3200-1]
gb|EQX92287.1| ATP synthase subunit B [Escherichia coli UMEA 3201-1]
gb|EQX96689.1| ATP synthase subunit B [Escherichia coli UMEA 3203-1]
gb|EQX97088.1| ATP synthase subunit B [Escherichia coli UMEA 3206-1]
gb|EQY08016.1| ATP synthase subunit B [Escherichia coli UMEA 3208-1]
gb|EQY10414.1| ATP synthase subunit B [Escherichia coli UMEA 3215-1]
gb|EQY14045.1| ATP synthase subunit B [Escherichia coli UMEA 3212-1]
gb|EQY19397.1| ATP synthase subunit B [Escherichia coli UMEA 3216-1]
gb|EQY25421.1| ATP synthase subunit B [Escherichia coli UMEA 3217-1]
gb|EQY29262.1| ATP synthase subunit B [Escherichia coli UMEA 3220-1]
gb|EQY36731.1| ATP synthase subunit B [Escherichia coli UMEA 3221-1]
gb|EQY38700.1| ATP synthase subunit B [Escherichia coli UMEA 3222-1]
gb|EQY40027.1| ATP synthase subunit B [Escherichia coli UMEA 3230-1]
gb|EQY51884.1| ATP synthase subunit B [Escherichia coli UMEA 3244-1]
gb|EQY52082.1| ATP synthase subunit B [Escherichia coli UMEA 3233-1]
gb|EQY54126.1| ATP synthase subunit B [Escherichia coli UMEA 3240-1]
gb|EQY64516.1| ATP synthase subunit B [Escherichia coli UMEA 3264-1]
gb|EQY67444.1| ATP synthase subunit B [Escherichia coli UMEA 3257-1]
gb|EQY72969.1| ATP synthase subunit B [Escherichia coli UMEA 3268-1]
gb|EQY80535.1| ATP synthase subunit B [Escherichia coli UMEA 3304-1]
gb|EQY83871.1| ATP synthase subunit B [Escherichia coli UMEA 3314-1]
gb|EQY90358.1| ATP synthase subunit B [Escherichia coli UMEA 3317-1]
gb|EQY94696.1| ATP synthase subunit B [Escherichia coli UMEA 3329-1]
gb|EQY95700.1| ATP synthase subunit B [Escherichia coli UMEA 3318-1]
gb|EQY97094.1| ATP synthase subunit B [Escherichia coli UMEA 3337-1]
gb|EQZ08413.1| ATP synthase subunit B [Escherichia coli UMEA 3341-1]
gb|EQZ09571.1| ATP synthase subunit B [Escherichia coli UMEA 3355-1]
gb|EQZ15096.1| ATP synthase subunit B [Escherichia coli UMEA 3391-1]
gb|EQZ20782.1| ATP synthase subunit B [Escherichia coli UMEA 3490-1]
gb|EQZ29941.1| ATP synthase subunit B [Escherichia coli UMEA 3592-1]
gb|EQZ30385.1| ATP synthase subunit B [Escherichia coli UMEA 3585-1]
gb|EQZ35335.1| ATP synthase subunit B [Escherichia coli UMEA 3617-1]
gb|EQZ35672.1| ATP synthase subunit B [Escherichia coli UMEA 3609-1]
gb|EQZ47711.1| ATP synthase subunit B [Escherichia coli UMEA 3632-1]
gb|EQZ50041.1| ATP synthase subunit B [Escherichia coli UMEA 3656-1]
gb|EQZ52552.1| ATP synthase subunit B [Escherichia coli UMEA 3662-1]
gb|EQZ61646.1| ATP synthase subunit B [Escherichia coli UMEA 3682-1]
gb|EQZ61976.1| ATP synthase subunit B [Escherichia coli UMEA 3671-1]
gb|EQZ62115.1| ATP synthase subunit B [Escherichia coli UMEA 3687-1]
gb|EQZ72468.1| ATP synthase subunit B [Escherichia coli UMEA 3694-1]
gb|EQZ75006.1| ATP synthase subunit B [Escherichia coli UMEA 3702-1]
gb|EQZ86278.1| ATP synthase subunit B [Escherichia coli UMEA 3707-1]
gb|EQZ87301.1| ATP synthase subunit B [Escherichia coli UMEA 3703-1]
gb|EQZ88235.1| ATP synthase subunit B [Escherichia coli UMEA 3705-1]
gb|EQZ96985.1| ATP synthase subunit B [Escherichia coli UMEA 3718-1]
gb|ERA02501.1| ATP synthase subunit B [Escherichia coli UMEA 3805-1]
gb|ERA05107.1| ATP synthase subunit B [Escherichia coli UMEA 3821-1]
gb|ERA14238.1| ATP synthase subunit B [Escherichia coli UMEA 3889-1]
gb|ERA16582.1| ATP synthase subunit B [Escherichia coli UMEA 3834-1]
gb|ERA17247.1| ATP synthase subunit B [Escherichia coli UMEA 3893-1]
gb|ERA30732.1| ATP synthase subunit B [Escherichia coli UMEA 3955-1]
gb|ERA31032.1| ATP synthase subunit B [Escherichia coli UMEA 4075-1]
gb|ERA35986.1| ATP synthase subunit B [Escherichia coli UMEA 3899-1]
gb|ERA42832.1| ATP synthase subunit B [Escherichia coli UMEA 4207-1]
gb|ERA45975.1| ATP synthase subunit B [Escherichia coli UMEA 4076-1]
gb|ERA56787.1| F0F1 ATP synthase subunit B [Escherichia coli 95NR1]
gb|ERA64521.1| ATP synthase subunit B [Escherichia coli HVH 155 (4-4509048)]
gb|ERA68995.1| ATP synthase subunit B [Escherichia coli HVH 156 (4-3206505)]
gb|ERA69501.1| ATP synthase subunit B [Escherichia coli HVH 157 (4-3406229)]
gb|ERA74331.1| ATP synthase subunit B [Escherichia coli HVH 159 (4-5818141)]
gb|ERA82657.1| ATP synthase subunit B [Escherichia coli HVH 160 (4-5695937)]
gb|ERA86337.1| ATP synthase subunit B [Escherichia coli HVH 210 (4-3042480)]
gb|ERA89477.1| ATP synthase subunit B [Escherichia coli HVH 228 (4-7787030)]
gb|ERA97875.1| ATP synthase subunit B [Escherichia coli KOEGE 3 (4a)]
gb|ERB00663.1| ATP synthase subunit B [Escherichia coli KOEGE 7 (16a)]
gb|ERB02429.1| ATP synthase subunit B [Escherichia coli KOEGE 10 (25a)]
gb|ERB11655.1| ATP synthase subunit B [Escherichia coli UMEA 3144-1]
gb|ERB15313.1| ATP synthase subunit B [Escherichia coli UMEA 3151-1]
gb|ERB22809.1| ATP synthase subunit B [Escherichia coli UMEA 3150-1]
gb|ERB24716.1| ATP synthase subunit B [Escherichia coli UMEA 3271-1]
gb|ERB30992.1| ATP synthase subunit B [Escherichia coli UMEA 3298-1]
gb|ERB32097.1| ATP synthase subunit B [Escherichia coli UMEA 3292-1]
gb|ERB68732.1| ATP synthase F0, B subunit [Escherichia coli B107]
gb|ERB69324.1| ATP synthase F0, B subunit [Escherichia coli B102]
gb|ERB70036.1| ATP synthase F0, B subunit [Escherichia coli 09BKT076207]
gb|ERB82538.1| ATP synthase F0, B subunit [Escherichia coli B26-1]
gb|ERB86391.1| ATP synthase F0, B subunit [Escherichia coli B26-2]
gb|ERB93616.1| ATP synthase F0, B subunit [Escherichia coli B28-1]
gb|ERB94257.1| ATP synthase F0, B subunit [Escherichia coli B28-2]
gb|ERC03019.1| ATP synthase F0, B subunit [Escherichia coli B29-1]
gb|ERC10282.1| ATP synthase F0, B subunit [Escherichia coli B29-2]
gb|ERC14551.1| ATP synthase F0, B subunit [Escherichia coli B36-1]
gb|ERC18429.1| ATP synthase F0, B subunit [Escherichia coli B36-2]
gb|ERC26473.1| ATP synthase F0, B subunit [Escherichia coli B7-1]
gb|ERC31427.1| ATP synthase F0, B subunit [Escherichia coli B7-2]
gb|ERC35845.1| ATP synthase F0, B subunit [Escherichia coli B93]
gb|ERC41236.1| ATP synthase F0, B subunit [Escherichia coli B94]
gb|ERC49038.1| ATP synthase F0, B subunit [Escherichia coli B95]
gb|ERC53413.1| ATP synthase F0, B subunit [Escherichia coli TW07509]
gb|ERC55813.1| ATP synthase F0, B subunit [Escherichia coli 08BKT055439]
gb|ERC63107.1| ATP synthase F0, B subunit [Escherichia coli Bd5610_99]
gb|ERC67446.1| ATP synthase F0, B subunit [Escherichia coli T1840_97]
gb|ERC75598.1| ATP synthase F0, B subunit [Escherichia coli T234_00]
gb|ERC79358.1| ATP synthase F0, B subunit [Escherichia coli 14A]
gb|ERC82073.1| ATP synthase F0, B subunit [Escherichia coli T924_01]
gb|ERC92345.1| ATP synthase F0, B subunit [Escherichia coli 2886-75]
gb|ERC95409.1| ATP synthase F0, B subunit [Escherichia coli B103]
gb|ERC95914.1| ATP synthase F0, B subunit [Escherichia coli B104]
gb|ERD07231.1| ATP synthase F0, B subunit [Escherichia coli B105]
gb|ERD11272.1| ATP synthase F0, B subunit [Escherichia coli B106]
gb|ERD11647.1| ATP synthase F0, B subunit [Escherichia coli B108]
gb|ERD23626.1| ATP synthase F0, B subunit [Escherichia coli B109]
gb|ERD25782.1| ATP synthase F0, B subunit [Escherichia coli B112]
gb|ERD29356.1| ATP synthase F0, B subunit [Escherichia coli B113]
gb|ERD38393.1| ATP synthase F0, B subunit [Escherichia coli B114]
gb|ERD41919.1| ATP synthase F0, B subunit [Escherichia coli B15]
gb|ERD46682.1| ATP synthase F0, B subunit [Escherichia coli B17]
gb|ERD56698.1| ATP synthase F0, B subunit [Escherichia coli B40-2]
gb|ERD58006.1| ATP synthase F0, B subunit [Escherichia coli B40-1]
gb|ERD60664.1| ATP synthase F0, B subunit [Escherichia coli B49-2]
gb|ERD69792.1| ATP synthase F0, B subunit [Escherichia coli B5-2]
gb|ERD74678.1| ATP synthase F0, B subunit [Escherichia coli B83]
gb|ERD78084.1| ATP synthase F0, B subunit [Escherichia coli B84]
gb|ERD85145.1| ATP synthase F0, B subunit [Escherichia coli B85]
gb|ERD89538.1| ATP synthase F0, B subunit [Escherichia coli B86]
gb|ERE01358.1| ATP synthase F0, B subunit [Escherichia coli 08BKT77219]
gb|ERE01830.1| F0F1 ATP synthase subunit B [Escherichia coli 95JB1]
gb|ERE12057.1| ATP synthase F0, B subunit [Escherichia coli 09BKT024447]
gb|ERE15419.1| ATP synthase F0, B subunit [Escherichia coli T1282_01]
gb|ERE23616.1| ATP synthase F0, B subunit [Escherichia coli B89]
gb|ERE25586.1| ATP synthase F0, B subunit [Escherichia coli B90]
gb|ERE38568.1| ATP synthase F0, B subunit [Escherichia coli Tx3800]
gb|AGW10796.1| F0F1 ATP synthase subunit B [Escherichia coli LY180]
emb|CDH67401.1| F-type ATPase subunit b [Escherichia coli PMV-1]
gb|AGX35686.1| F0 sector of membrane-bound ATP synthase, subunit b [synthetic
Escherichia coli C321.deltaA]
gb|ERO92872.1| ATP synthase subunit B [Escherichia coli BWH 24]
gb|ERO98751.1| ATP synthase subunit B [Escherichia coli BIDMC 19C]
gb|ESA60739.1| ATP synthase F0, B subunit [Escherichia coli 110957]
gb|ESA63241.1| ATP synthase F0, B subunit [Escherichia coli 113303]
gb|ESA71778.1| ATP synthase F0, B subunit [Escherichia coli 907357]
gb|ESA74907.1| ATP synthase F0, B subunit [Escherichia coli 113290]
gb|ESA93116.1| ATP synthase F0, B subunit [Escherichia coli 907779]
gb|ESA95602.1| ATP synthase F0, B subunit [Escherichia coli 907713]
gb|ESA98383.1| ATP synthase F0, B subunit [Escherichia coli 909945-2]
gb|ESC93513.1| ATP synthase F0, B subunit [Escherichia coli 907446]
gb|ESC94573.1| ATP synthase F0, B subunit [Escherichia coli 113302]
gb|ESD01969.1| ATP synthase F0, B subunit [Escherichia coli 907391]
gb|ESD12445.1| ATP synthase F0, B subunit [Escherichia coli 907672]
gb|ESD15300.1| ATP synthase F0, B subunit [Escherichia coli 907701]
gb|ESD16486.1| ATP synthase F0, B subunit [Escherichia coli 907700]
gb|ESD16572.1| ATP synthase F0, B subunit [Escherichia coli 907710]
gb|ESD29708.1| ATP synthase F0, B subunit [Escherichia coli 907889]
gb|ESD31330.1| ATP synthase F0, B subunit [Escherichia coli 907715]
gb|ESD39539.1| ATP synthase F0, B subunit [Escherichia coli 908519]
gb|ESD43321.1| ATP synthase F0, B subunit [Escherichia coli 907892]
gb|ESD58462.1| ATP synthase F0, B subunit [Escherichia coli 908524]
gb|ESD58782.1| ATP synthase F0, B subunit [Escherichia coli 908522]
gb|ESD59394.1| ATP synthase F0, B subunit [Escherichia coli 908521]
gb|ESD64540.1| ATP synthase F0, B subunit [Escherichia coli 908555]
gb|ESD68393.1| ATP synthase F0, B subunit [Escherichia coli 908525]
gb|ESD70268.1| ATP synthase F0, B subunit [Escherichia coli 908541]
gb|ESD85972.1| ATP synthase F0, B subunit [Escherichia coli 908585]
gb|ESD87408.1| ATP synthase F0, B subunit [Escherichia coli 908616]
gb|ESD90175.1| ATP synthase F0, B subunit [Escherichia coli 908573]
gb|ESD96708.1| ATP synthase F0, B subunit [Escherichia coli 908624]
gb|ESE10986.1| ATP synthase F0, B subunit [Escherichia coli 908658]
gb|ESE11526.1| ATP synthase F0, B subunit [Escherichia coli 908632]
gb|ESE18498.1| ATP synthase F0, B subunit [Escherichia coli 908691]
gb|ESE19750.1| ATP synthase F0, B subunit [Escherichia coli 908675]
gb|ESE25325.1| ATP synthase F0, B subunit [Escherichia coli 910096-2]
gb|ESE29268.1| ATP synthase F0, B subunit [Escherichia coli A25922R]
gb|ESE37268.1| ATP synthase F0, B subunit [Escherichia coli A35218R]
gb|AGY86405.1| F0F1 ATP synthase subunit B [Escherichia coli JJ1886]
gb|ESK00649.1| ATP synthase subunit B [Escherichia coli HVH 98 (4-5799287)]
gb|ESK03378.1| ATP synthase subunit B [Escherichia coli UMEA 3336-1]
gb|ESK12116.1| ATP synthase subunit B [Escherichia coli UMEA 3426-1]
gb|ESK14183.1| ATP synthase subunit B [Escherichia coli UMEA 3290-1]
gb|ESK17655.1| ATP synthase subunit B [Escherichia coli HVH 50 (4-2593475)]
gb|ESK25137.1| ATP synthase subunit B [Escherichia coli UMEA 3693-1]
gb|ESK25959.1| ATP synthase subunit B [Escherichia coli UMEA 3342-1]
gb|ESK31843.1| ATP synthase subunit B [Escherichia coli UMEA 3323-1]
gb|ESL18425.1| ATP synthase subunit B [Escherichia coli BIDMC 39]
gb|ESL32187.1| ATP synthase subunit B [Escherichia coli BIDMC 38]
gb|ESL32748.1| ATP synthase subunit B [Escherichia coli BIDMC 37]
gb|ESM31546.1| ATP synthase subunit B [Escherichia coli BWH 32]
gb|ESP06686.1| ATP synthase subunit B [Escherichia coli HVH 36 (4-5675286)]
gb|ESP13136.1| ATP synthase subunit B [Escherichia coli HVH 136 (4-5970458)]
gb|ESP14883.1| ATP synthase subunit B [Escherichia coli HVH 12 (4-7653042)]
gb|ESP16409.1| ATP synthase subunit B [Escherichia coli HVH 86 (4-7026218)]
gb|ESP29200.1| ATP synthase subunit B [Escherichia coli HVH 178 (4-3189163)]
gb|ESP32327.1| ATP synthase subunit B [Escherichia coli HVH 152 (4-3447545)]
gb|ESP37056.1| ATP synthase subunit B [Escherichia coli HVH 148 (4-3192490)]
gb|ESP41553.1| ATP synthase subunit B [Escherichia coli HVH 108 (4-6924867)]
gb|ESP41780.1| ATP synthase subunit B [Escherichia coli UMEA 3148-1]
emb|CDJ73138.1| F0F1 ATP synthase subunit B [Escherichia coli str. K-12 substr.
MC4100]
gb|ESS94591.1| ATP synthase B chain [Escherichia coli CE516]
gb|ESS98054.1| ATP synthase B chain [Escherichia coli CE549]
gb|ESS99773.1| ATP synthase B chain [Escherichia coli CE418]
gb|AHA68077.1| ATP synthase B chain [Shigella dysenteriae 1617]
gb|EST64089.1| F0F1 ATP synthase subunit B [Escherichia coli P4-96]
gb|EST66429.1| F0F1 ATP synthase subunit B [Escherichia coli P4-NR]
gb|EST75375.1| F0F1 ATP synthase subunit B [Escherichia coli ECA-727]
gb|EST85699.1| F0F1 ATP synthase subunit B [Escherichia coli ECC-1470]
gb|EST88712.1| F0F1 ATP synthase subunit B [Escherichia coli ECA-0157]
gb|ETD47063.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2215]
gb|ETD63429.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2209]
gb|ETE09774.1| F0F1 ATP synthase subunit B [Escherichia coli LAU-EC8]
gb|ETE14206.1| F0F1 ATP synthase subunit B [Escherichia coli LAU-EC6]
gb|ETE24903.1| F0F1 ATP synthase subunit B [Escherichia coli LAU-EC10]
gb|ETE28208.1| F0F1 ATP synthase subunit B [Escherichia coli LAU-EC7]
gb|ETE38384.1| F0F1 ATP synthase subunit B [Escherichia coli LAU-EC9]
gb|ETF15877.1| ATP synthase subunit B [Escherichia coli HVH 177 (4-2876612)]
gb|ETF21241.1| ATP synthase subunit B [Escherichia coli HVH 23 (4-6066488)]
gb|ETF26893.1| ATP synthase subunit B [Escherichia coli HVH 83 (4-2051087)]
gb|ETF29718.1| ATP synthase subunit B [Escherichia coli HVH 214 (4-3062198)]
gb|ETF34120.1| ATP synthase subunit B [Escherichia coli UMEA 3489-1]
gb|ETI71182.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2219]
gb|ETI72545.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2196]
gb|ETJ57593.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2193]
gb|ETJ70958.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC 35150]
gb|ETJ81125.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC BAA-2192]
emb|CDK44954.1| ATP synthase B chain [Escherichia coli IS1]
emb|CDK50493.1| ATP synthase B chain [Escherichia coli IS5]
emb|CDK80085.1| ATP synthase B chain [Escherichia coli IS25]
emb|CDL28402.1| ATP synthase B chain [Escherichia coli ISC7]
emb|CDK69935.1| ATP synthase B chain [Klebsiella pneumoniae IS22]
emb|CDK58110.1| ATP synthase B chain [Escherichia coli IS9]
emb|CDK89733.1| ATP synthase B chain [Escherichia coli IS29]
gb|ETS28500.1| F0F1 ATP synthase subunit B [Escherichia coli O6:H16:CFA/II str.
B2C]
gb|AHG17196.1| ATP synthase B chain [Escherichia coli O145:H28 str. RM13516]
gb|AHG11447.1| ATP synthase B chain [Escherichia coli O145:H28 str. RM13514]
gb|ETX77687.1| ATP synthase subunit B [Escherichia coli BIDMC 43b]
gb|ETX86491.1| ATP synthase subunit B [Escherichia coli BIDMC 43a]
gb|ETX88322.1| ATP synthase subunit B [Escherichia coli BIDMC 20B]
gb|ETX92001.1| ATP synthase subunit B [Escherichia coli BIDMC 20A]
gb|ETX99693.1| ATP synthase subunit B [Escherichia coli BIDMC 19B]
gb|ETY06334.1| ATP synthase subunit B [Escherichia coli BIDMC 19A]
gb|ETY13102.1| ATP synthase subunit B [Escherichia coli BIDMC 17B]
gb|ETY17900.1| ATP synthase subunit B [Escherichia coli BIDMC 17A]
gb|ETY22899.1| ATP synthase subunit B [Escherichia coli BIDMC 15]
gb|ETY28732.1| ATP synthase subunit B [Escherichia coli BIDMC 9]
gb|ETY31363.1| ATP synthase subunit B [Escherichia coli BIDMC 3]
gb|ETY37117.1| ATP synthase subunit B [Escherichia coli BIDMC 2B]
gb|ETY40552.1| ATP synthase subunit B [Escherichia coli BWH 40]
gb|ETY47229.1| ATP synthase subunit B [Escherichia coli BWH 34]
gb|ETY54405.1| ATP synthase subunit B [Escherichia coli BIDMC 49b]
gb|ETY57859.1| ATP synthase subunit B [Escherichia coli BIDMC 49a]
gb|ETY63069.1| ATP synthase subunit B [Escherichia coli BIDMC 6]
emb|CDL47896.1| ATP synthase B chain [Escherichia coli ISC41]
gb|EWC54438.1| F0F1 ATP synthase subunit B [Escherichia coli EC096/10]
gb|EWY55302.1| ATP F0F1 synthase subunit B [Escherichia coli MP1]
gb|AHM32339.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AHM36894.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AHM41482.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AHM45997.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AHM50600.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AHM55037.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB47179.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB47328.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB53363.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB59236.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB60065.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYB62223.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|EYD79909.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S1_C1]
gb|EYD80054.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S3_C1]
gb|EYD81401.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S3_C2]
gb|EYD94809.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S4_C3]
gb|EYD95994.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S4_C2]
gb|EYD98193.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S4_C1]
gb|EYE10439.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S3_C3]
gb|EYE17202.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S3_C2]
gb|EYE17677.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S1_C3]
gb|EYE19572.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S3_C1]
gb|EYE32288.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S1_C1]
gb|EYE33919.1| ATP synthase F0, B subunit [Escherichia coli 1-110-08_S1_C2]
gb|EYT06983.1| ATP synthase subunit B [Escherichia coli K02]
gb|EYU72367.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4221]
gb|EYU74583.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-4254]
gb|EYU85780.1| ATP F0F1 synthase subunit B [Escherichia coli O26:NM str.
2010C-4347]
gb|EYU87288.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4086]
gb|EYU91006.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-3977]
gb|EYU94567.1| ATP F0F1 synthase subunit B [Escherichia coli O45:H2 str.
2010C-3876]
gb|EYV04140.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-3840]
gb|EYV08117.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-3609]
gb|EYV08840.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3526]
gb|EYV20210.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3521]
gb|EYV24226.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3518]
gb|EYV26957.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3517]
gb|EYV31680.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3516]
gb|EYV41977.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3510]
gb|EYV43128.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3509]
gb|EYV45354.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3511]
gb|EYV56567.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3507]
gb|EYV60199.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H11 str.
2010C-3214]
gb|EYV61270.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2009EL2109]
gb|EYV68025.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2009EL1705]
gb|EYV72948.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2009EL1412]
gb|EYV76198.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2009C-4659]
gb|EYV83586.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5806]
gb|EYV92761.1| ATP F0F1 synthase subunit B [Escherichia coli O86:H34 str. 99-3124]
gb|EYV93530.1| ATP F0F1 synthase subunit B [Escherichia coli O6:H16 str. 99-3165]
gb|EYV94133.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F7350]
gb|EYW04646.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2312]
gb|EYW05795.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2289]
gb|EYW09402.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2288]
gb|EYW17004.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2287]
gb|EYW20990.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2114]
gb|EYW24917.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2286]
gb|EYW29718.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2113]
gb|EYW32647.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2112]
gb|EYW41281.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2111]
gb|EYW48477.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2108]
gb|EYW51937.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2109]
gb|EYW53716.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2107]
gb|EYW61231.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2106]
gb|EYW63145.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2105]
gb|EYW71758.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2104]
gb|EYW78646.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2103]
gb|EYW79738.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2101]
gb|EYW82110.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2099]
gb|EYW84994.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. 08-4487]
gb|EYW94284.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str. 08-4270]
gb|EYX00428.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 08-4169]
gb|EYX03643.1| ATP F0F1 synthase subunit B [Escherichia coli O118:H16 str.
08-3651]
gb|EYX14501.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 08-3037]
gb|EYX15466.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 08-3527]
gb|EYX17918.1| ATP F0F1 synthase subunit B [Escherichia coli O69:H11 str. 07-4281]
gb|EYX23732.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2098]
gb|EYX24203.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2097]
gb|EYX34597.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2096]
gb|EYX38670.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2094]
gb|EYX40168.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2093]
gb|EYX50186.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2092]
gb|EYX52510.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2091]
gb|EYX59188.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2090]
gb|EYX63150.1| ATP F0F1 synthase subunit B [Escherichia coli O104:H4 str.
2011EL-1675A]
gb|EYX64572.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-1107]
gb|EYX72029.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2011C-3679]
gb|EYX76062.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2011C-3632]
gb|EYX85052.1| ATP F0F1 synthase subunit B [Escherichia coli O156:H25 str.
2011C-3602]
gb|EYX88954.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H2 str.
2011C-3750]
gb|EYX92571.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3537]
gb|EYX95552.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2011C-3573]
gb|EYY02292.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3500]
gb|EYY04186.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2011C-3362]
gb|EYY11098.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3216]
gb|EYY13779.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2011C-3170]
gb|EYY21542.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3108]
gb|EYY21595.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010EL1058]
gb|EYY22091.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3072]
gb|EYY34864.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-4989]
gb|EYY39933.1| ATP F0F1 synthase subunit B [Escherichia coli O153:H2 str.
2010C-5034]
gb|EYY48968.1| ATP F0F1 synthase subunit B [Escherichia coli O165:H25 str.
2010C-4874]
gb|EYY50649.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2010C-4979C1]
gb|EYY54554.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-4966]
gb|EYY57471.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-4824]
gb|EYY59966.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4799]
gb|EYY66023.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4818]
gb|EYY73370.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4735]
gb|EYY74850.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4746]
gb|EYY83810.1| ATP F0F1 synthase subunit B [Escherichia coli O26:NM str.
2010C-4788]
gb|EYY87409.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-4732]
gb|EYY89770.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4715]
gb|EYY92445.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4622]
gb|EYY99364.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-4592]
gb|EYZ03023.1| ATP F0F1 synthase subunit B [Escherichia coli O177:NM str.
2010C-4558]
gb|EYZ11128.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H2 str.
2010C-4433]
gb|EYZ14876.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-4557C2]
gb|EYZ18138.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H25 str.
2010C-4529]
gb|EYZ28146.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 07-3091]
gb|EYZ29097.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 06-4039]
gb|EYZ33315.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 07-3391]
gb|EYZ42822.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
06-3822]
gb|EYZ46344.1| ATP F0F1 synthase subunit B [Escherichia coli O91:H14 str. 06-3691]
gb|EYZ50254.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 06-3745]
gb|EYZ57175.1| ATP F0F1 synthase subunit B [Escherichia coli O79:H7 str. 06-3501]
gb|EYZ61045.1| ATP F0F1 synthase subunit B [Escherichia coli O118:H16 str.
06-3612]
gb|EYZ61688.1| ATP F0F1 synthase subunit B [Escherichia coli O55:H7 str. 06-3555]
gb|EYZ72891.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str. 06-3484]
gb|EYZ74066.1| ATP F0F1 synthase subunit B [Escherichia coli O69:H11 str. 06-3325]
gb|EYZ82615.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
06-3003]
gb|EYZ83325.1| ATP F0F1 synthase subunit B [Escherichia coli O118:H16 str.
06-3256]
gb|EYZ84196.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. 04-3211]
gb|EYZ98342.1| ATP F0F1 synthase subunit B [Escherichia coli O119:H4 str. 03-3458]
gb|EYZ99079.1| ATP F0F1 synthase subunit B [Escherichia coli O174:H21 str.
03-3269]
gb|EZA04151.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. 03-3484]
gb|EZA07100.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
03-3227]
gb|EZA13955.1| ATP F0F1 synthase subunit B [Escherichia coli O81:NM str. 02-3012]
gb|EZA22741.1| ATP F0F1 synthase subunit B [Escherichia coli O28ac:NM str.
02-3404]
gb|EZA24263.1| ATP F0F1 synthase subunit B [Escherichia coli O113:H21 str.
07-4224]
gb|EZA28548.1| ATP F0F1 synthase subunit B [Escherichia coli O45:H2 str. 01-3147]
gb|EZA35583.1| ATP F0F1 synthase subunit B [Escherichia coli O174:H8 str. 04-3038]
gb|EZA39019.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H11 str.
04-3023]
gb|EZA44027.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str. 05-3646]
gb|EZA63043.1| ATP F0F1 synthase subunit B [Escherichia coli O104:H21 str.
94-3025]
gb|EZA73275.1| ATP F0F1 synthase subunit B [Escherichia coli O25:NM str. E2539C1]
gb|EZA73358.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H16 str.
98-3133]
gb|EZA79734.1| ATP F0F1 synthase subunit B [Escherichia coli O6:H16 str. F5656C1]
gb|EZA83786.1| ATP F0F1 synthase subunit B [Escherichia coli O111:H8 str. F6627]
gb|EZA91804.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str. F6714]
gb|EZA98314.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F6750]
gb|EZB05089.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F6749]
gb|EZB07991.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F6751]
gb|EZB15559.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F7384]
gb|EZB17491.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F7377]
gb|EZB23193.1| ATP F0F1 synthase subunit B [Escherichia coli O169:H41 str. F9792]
gb|EZB24131.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. F7410]
gb|EZB32530.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. G5303]
gb|EZB43636.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. H2495]
gb|EZB44134.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1420]
gb|EZB47845.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. H2498]
gb|EZB54280.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1793]
gb|EZB54776.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1792]
gb|EZB61626.1| ATP F0F1 synthase subunit B [Escherichia coli O15:H18 str. K1516]
gb|EZB69012.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1795]
gb|EZB71950.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1796]
gb|EZB73559.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1845]
gb|EZB84031.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1921]
gb|EZB85870.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K1927]
gb|EZB86359.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2188]
gb|EZB98923.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2191]
gb|EZC01858.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2324]
gb|EZC03578.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2192]
gb|EZC11855.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2581]
gb|EZC17956.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2622]
gb|EZC20058.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2845]
gb|EZC22716.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K2854]
gb|EZC31857.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K4396]
gb|EZC34249.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K4405]
gb|EZC40744.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K4406]
gb|EZC46202.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K4527]
gb|EZC52701.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str. K5198]
gb|EZC54070.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5418]
gb|EZC60197.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str. K5269]
gb|EZC67106.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5448]
gb|EZC73612.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5449]
gb|EZC74997.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5453]
gb|EZC81047.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5460]
gb|EZC87814.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5467]
gb|EZC91074.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5602]
gb|EZC94156.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5609]
gb|EZC95913.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5607]
gb|EZD04946.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K5852]
gb|EZD12004.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K6590]
gb|EZD12158.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K6676]
gb|EZD22153.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K6687]
gb|EZD22918.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6723]
gb|EZD24605.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6722]
gb|EZD28783.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6728]
gb|EZD40631.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6890]
gb|EZD45154.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6895]
gb|EZD45320.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6897]
gb|EZD51301.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6898]
gb|EZD54074.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6904]
gb|EZD64828.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6908]
gb|EZD65229.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. K6915]
gb|EZD73830.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. K7140]
gb|EZD77403.1| ATP F0F1 synthase subunit B [Escherichia coli O39:NM str. F8704-2]
gb|EZD80934.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. 08-4529]
gb|EZD87493.1| ATP F0F1 synthase subunit B [Escherichia coli O157:NM str. 08-4540]
gb|EZD95315.1| ATP F0F1 synthase subunit B [Escherichia coli O91:H14 str.
2009C-3227]
gb|EZD98745.1| ATP F0F1 synthase subunit B [Escherichia coli O145:H28 str.
2009C-3292]
gb|EZE00827.1| ATP F0F1 synthase subunit B [Escherichia coli O103:H2 str.
2009C-3279]
gb|EZE09778.1| ATP F0F1 synthase subunit B [Escherichia coli O69:H11 str. 08-4661]
gb|EZE10506.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H7 str.
2009C-3299]
gb|EZE19384.1| ATP F0F1 synthase subunit B [Escherichia coli O45:H2 str.
2009C-3686]
gb|EZE21421.1| ATP F0F1 synthase subunit B [Escherichia coli O123:H11 str.
2009C-3307]
gb|EZE24171.1| ATP F0F1 synthase subunit B [Escherichia coli O69:H11 str.
2009C-3601]
gb|EZE35199.1| ATP F0F1 synthase subunit B [Escherichia coli O91:NM str.
2009C-3745]
gb|EZE40826.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2009C-4050]
gb|EZE43480.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2009C-4006]
gb|EZE45177.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2009C-4052]
gb|EZE50061.1| ATP F0F1 synthase subunit B [Escherichia coli O118:H16 str.
2009C-4446]
gb|EZE60472.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2009C-4258]
gb|EZE66978.1| ATP F0F1 synthase subunit B [Escherichia coli O91:H21 str.
2009C-4646]
gb|EZE70808.1| ATP F0F1 synthase subunit B [Escherichia coli O45:H2 str.
2009C-4780]
gb|EZE71239.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2009C-4750]
gb|EZE81698.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2009EL1302]
gb|EZE82946.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2009EL1913]
gb|EZE84140.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2009EL1449]
gb|EZE93365.1| ATP F0F1 synthase subunit B [Escherichia coli O145:NM str.
2010C-3508]
gb|EZE98983.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2010C-3794]
gb|EZF06328.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2313]
gb|EZF06754.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str.
2011EL-2290]
gb|EZG33779.1| ATP F0F1 synthase subunit B [Escherichia coli E1728]
gb|EZG46610.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str. 06-3464]
gb|EZG48458.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str. 03-3500]
gb|EZG59007.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-4430]
gb|EZG63441.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-4819]
gb|EZG71153.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-4834]
gb|EZG75972.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-5028]
gb|EZG80951.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010EL-1699]
gb|EZG87959.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3270]
gb|EZG96169.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3387]
gb|EZH01632.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3282]
gb|EZH02355.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3506]
gb|EZH10596.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2009C-3689]
gb|EZH10924.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3655]
gb|EZH18122.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2009C-3612]
gb|EZH22298.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2009C-3996]
gb|EZH23564.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2009C-4760]
gb|EZH27977.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2009C-4826]
gb|EZH35973.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-3051]
gb|EZH43398.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-3472]
gb|EZH48695.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-3871]
gb|EZH54940.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-3902]
gb|EZH55233.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2010C-4244]
gb|EZJ16644.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S4_C3]
gb|EZJ17706.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S4_C3]
gb|EZJ26428.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S4_C2]
gb|EZJ33775.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S4_C2]
gb|EZJ35116.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S4_C3]
gb|EZJ38525.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S4_C2]
gb|EZJ48277.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S4_C2]
gb|EZJ51326.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S4_C1]
gb|EZJ59027.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S4_C1]
gb|EZJ66424.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S3_C3]
gb|EZJ66547.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S4_C1]
gb|EZJ67931.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S3_C3]
gb|EZJ80354.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S3_C2]
gb|EZJ82070.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S3_C1]
gb|EZJ88641.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S3_C1]
gb|EZJ92690.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S1_C3]
gb|EZJ93544.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S1_C3]
gb|EZK05577.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S1_C3]
gb|EZK11424.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S1_C3]
gb|EZK14771.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S1_C2]
gb|EZK17807.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S1_C2]
gb|EZK27274.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S1_C1]
gb|EZK28093.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S1_C2]
gb|EZK37031.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S1_C1]
gb|EZQ21794.1| ATP F0F1 synthase subunit B [Escherichia coli O111:H8 str.
2009EL-2169]
gb|EZQ22593.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str.
2010C-3053]
gb|EZQ33681.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H1 str.
2009C-4747]
gb|EZQ35801.1| ATP F0F1 synthase subunit B [Escherichia coli O111:H8 str.
2009C-4126]
gb|EZQ39054.1| ATP F0F1 synthase subunit B [Escherichia coli O111:H8 str.
2011C-3453]
gb|EZQ44997.1| ATP F0F1 synthase subunit B [Escherichia coli O157: str.
2010EL-2045]
gb|EZQ51628.1| ATP F0F1 synthase subunit B [Escherichia coli O157: str.
2010EL-2044]
gb|EZQ59266.1| ATP synthase subunit B [Escherichia coli BIDMC 83]
gb|EZQ66048.1| ATP synthase subunit B [Escherichia coli BIDMC 82]
gb|AHY67519.1| ATP synthase B chain [Escherichia coli O145:H28 str. RM12761]
gb|AHY73269.1| ATP synthase B chain [Escherichia coli O145:H28 str. RM12581]
gb|KCW96485.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDA55851.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S1_C1]
gb|KDA61658.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S1_C1]
gb|KDA66491.1| ATP synthase F0, B subunit [Escherichia coli 1-182-04_S1_C2]
gb|KDA71504.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S3_C2]
gb|KDA77599.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S3_C2]
gb|KDA82770.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S3_C3]
gb|KDA87955.1| ATP synthase F0, B subunit [Escherichia coli 1-176-05_S4_C2]
emb|CDP74453.1| ATP synthase subunit b [Escherichia coli]
emb|CDP67815.1| ATP synthase subunit b [Escherichia coli D6-113.11]
emb|CDP75748.1| Putative uncharacterized protein [Escherichia coli D6-117.29]
gb|KDF65287.1| ATP synthase subunit B [Escherichia coli BIDMC 59]
gb|KDF72404.1| ATP synthase subunit B [Escherichia coli BIDMC 58]
gb|KDF83842.1| ATP synthase subunit B [Escherichia coli BIDMC 62]
gb|KDF84889.1| ATP synthase subunit B [Escherichia coli BIDMC 64]
gb|KDF85743.1| ATP synthase subunit B [Escherichia coli BIDMC 63]
gb|KDF94338.1| ATP synthase subunit B [Escherichia coli BIDMC 65]
gb|KDG00519.1| ATP synthase subunit B [Escherichia coli BIDMC 70]
gb|KDG04629.1| ATP synthase subunit B [Escherichia coli BIDMC 72]
gb|KDG04728.1| ATP synthase subunit B [Escherichia coli BIDMC 71]
gb|KDG14628.1| ATP synthase subunit B [Escherichia coli BIDMC 73]
gb|KDG19230.1| ATP synthase subunit B [Escherichia coli BIDMC 74]
gb|KDG25524.1| ATP synthase subunit B [Escherichia coli BIDMC 76]
gb|KDG26089.1| ATP synthase subunit B [Escherichia coli BIDMC 75]
gb|KDG37714.1| ATP synthase subunit B [Escherichia coli BIDMC 78]
gb|KDG38407.1| ATP synthase subunit B [Escherichia coli BIDMC 77]
gb|KDG43533.1| ATP synthase subunit B [Escherichia coli BIDMC 79]
gb|KDG45841.1| ATP synthase subunit B [Escherichia coli CHS 68]
gb|KDG56670.1| ATP synthase subunit B [Escherichia coli CHS 77]
gb|KDG57806.1| ATP synthase subunit B [Escherichia coli CHS 69]
gb|KDG62911.1| ATP synthase subunit B [Escherichia coli MGH 57]
gb|KDG69185.1| ATP synthase subunit B [Escherichia coli UCI 51]
gb|KDG70604.1| ATP synthase subunit B [Escherichia coli MGH 58]
gb|KDG74168.1| ATP synthase subunit B [Escherichia coli UCI 53]
gb|KDG82236.1| ATP synthase subunit B [Escherichia coli UCI 57]
gb|KDG83526.1| ATP synthase subunit B [Escherichia coli UCI 58]
gb|KDG90318.1| ATP synthase subunit B [Escherichia coli UCI 65]
gb|KDG93847.1| ATP synthase subunit B [Escherichia coli UCI 66]
gb|KDM71485.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDM76870.1| ATP F0F1 synthase subunit B [Escherichia coli O145:H28 str.
4865/96]
gb|KDM80858.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDM87754.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDN09241.1| ATP synthase B chain [Escherichia coli]
emb|CDN84569.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli
O25b:H4-ST131]
gb|KDO88511.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDP14852.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KDS96022.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S3_C1]
gb|KDS96134.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S1_C3]
gb|KDT01163.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S4_C1]
gb|KDT10461.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S1_C3]
gb|KDT14014.1| ATP synthase F0, B subunit [Escherichia coli 2-011-08_S4_C3]
gb|KDT15512.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S3_C1]
gb|KDT25202.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S4_C1]
gb|KDT33636.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S3_C1]
gb|KDT38038.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S1_C1]
gb|KDT42272.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S4_C2]
gb|KDT45778.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S3_C2]
gb|KDT59539.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S1_C3]
gb|KDT59707.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S3_C1]
gb|KDT69722.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S3_C1]
gb|KDT73790.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S3_C3]
gb|KDT80023.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S1_C2]
gb|KDT83087.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S4_C1]
gb|KDT84082.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S1_C1]
gb|KDT94344.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S4_C1]
gb|KDT97317.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S3_C2]
gb|KDU03575.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S1_C2]
gb|KDU10612.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S3_C2]
gb|KDU16289.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S3_C3]
gb|KDU17962.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S1_C1]
gb|KDU22281.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S4_C2]
gb|KDU29635.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S4_C2]
gb|KDU40469.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S1_C3]
gb|KDU46288.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S1_C1]
gb|KDU51388.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S4_C1]
gb|KDU59453.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S4_C2]
gb|KDU61528.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S1_C1]
gb|KDU68707.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S4_C3]
gb|KDV16527.1| ATP F0F1 synthase subunit B [Escherichia coli O78:H12 str. 00-3279]
gb|KDV17491.1| ATP F0F1 synthase subunit B [Escherichia coli O111:NM str. 01-3076]
gb|KDV33189.1| ATP F0F1 synthase subunit B [Escherichia coli O69:H11 str. 07-3763]
gb|KDV37352.1| ATP F0F1 synthase subunit B [Escherichia coli O145:H25 str.
07-3858]
gb|KDV40534.1| ATP F0F1 synthase subunit B [Escherichia coli O146:H21 str.
2010C-3325]
gb|KDV45548.1| ATP F0F1 synthase subunit B [Escherichia coli O91:H21 str.
2009C-3740]
gb|KDV54172.1| ATP F0F1 synthase subunit B [Escherichia coli O121:H19 str.
2011C-3609]
gb|KDV58909.1| ATP F0F1 synthase subunit B [Escherichia coli O45:H2 str.
2010C-4211]
gb|KDV62784.1| ATP F0F1 synthase subunit B [Escherichia coli O128:H2 str.
2011C-3317]
gb|KDV68302.1| ATP F0F1 synthase subunit B [Escherichia coli O26:H11 str.
2011C-3274]
gb|KDV73961.1| ATP F0F1 synthase subunit B [Escherichia coli O118:H16 str.
07-4255]
gb|KDV79010.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S4_C2]
gb|KDV79178.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S4_C3]
gb|KDV79439.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S3_C3]
gb|KDV98161.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S3_C1]
gb|KDV98355.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S1_C3]
gb|KDW04725.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S3_C3]
gb|KDW13049.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S3_C1]
gb|KDW15145.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S4_C1]
gb|KDW15255.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S1_C1]
gb|KDW28257.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S3_C2]
gb|KDW28364.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S1_C2]
gb|KDW37652.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S1_C3]
gb|KDW44243.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S4_C2]
gb|KDW52359.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S1_C3]
gb|KDW56738.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S3_C2]
gb|KDW58886.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S3_C1]
gb|KDW67072.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S3_C3]
gb|KDW71214.1| ATP synthase F0, B subunit [Escherichia coli 2-005-03_S4_C1]
gb|KDW75163.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S1_C1]
gb|KDW82765.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S1_C2]
gb|KDW87981.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S4_C1]
gb|KDW94264.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S1_C2]
gb|KDW97610.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S3_C2]
gb|KDX02525.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S3_C1]
gb|KDX08149.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S4_C3]
gb|KDX18587.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S3_C3]
gb|KDX23036.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S4_C2]
gb|KDX33119.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S1_C2]
gb|KDX34862.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S1_C1]
gb|KDX38507.1| ATP synthase F0, B subunit [Escherichia coli 2-156-04_S4_C3]
gb|KDX44928.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S3_C2]
gb|KDX51522.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S4_C1]
gb|KDX54044.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S3_C1]
gb|KDX58976.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S4_C2]
gb|KDX64488.1| ATP synthase F0, B subunit [Escherichia coli 2-210-07_S4_C3]
gb|KDX67327.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S1_C1]
gb|KDX74452.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S1_C2]
gb|KDX79886.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S1_C3]
gb|KDX83894.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S3_C3]
gb|KDX91293.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S4_C2]
gb|KDX96218.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S3_C1]
gb|KDY01664.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S3_C2]
gb|KDY06450.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S3_C3]
gb|KDY10692.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S4_C1]
gb|KDY16752.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S4_C3]
gb|KDY17836.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S4_C2]
gb|KDY27008.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S1_C2]
gb|KDY30092.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S3_C3]
gb|KDY32456.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S3_C1]
gb|KDY43460.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S4_C1]
gb|KDY47242.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S4_C2]
gb|KDY51370.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S3_C1]
gb|KDY58552.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S3_C2]
gb|KDY60315.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S3_C3]
gb|KDY70092.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S4_C2]
gb|KDY76876.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S4_C3]
gb|KDY81145.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S1_C1]
gb|KDY84795.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S3_C1]
gb|KDY90243.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S3_C2]
gb|KDY93157.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S1_C3]
gb|KDZ01473.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S1_C2]
gb|KDZ06634.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S4_C2]
gb|KDZ12665.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S3_C3]
gb|KDZ13401.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S4_C3]
gb|KDZ22102.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S1_C1]
gb|KDZ26626.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S1_C2]
gb|KDZ31852.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S1_C3]
gb|KDZ39806.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S3_C1]
gb|KDZ43008.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S4_C2]
gb|KDZ49072.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S4_C3]
gb|KDZ51978.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S1_C1]
gb|KDZ60034.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S1_C2]
gb|KDZ61583.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S3_C1]
gb|KDZ61689.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S3_C2]
gb|KDZ77113.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S4_C2]
gb|KDZ84511.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S1_C2]
gb|KDZ93474.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S1_C3]
gb|KDZ95620.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S1_C1]
gb|KEJ06249.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S4_C2]
gb|KEJ07183.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S1_C2]
gb|KEJ07264.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S4_C1]
gb|KEJ21464.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S1_C1]
gb|KEJ22581.1| ATP synthase F0, B subunit [Escherichia coli 2-316-03_S1_C2]
gb|KEJ27486.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S4_C3]
gb|KEJ37696.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S1_C3]
gb|KEJ43905.1| ATP synthase F0, B subunit [Escherichia coli 2-427-07_S4_C3]
gb|KEJ47068.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S4_C1]
gb|KEJ54801.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S4_C1]
gb|KEJ57335.1| ATP synthase F0, B subunit [Escherichia coli 3-267-03_S4_C1]
gb|KEJ65638.1| ATP synthase F0, B subunit [Escherichia coli 3-020-07_S3_C2]
gb|KEJ71936.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S1_C3]
gb|KEK77335.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S3_C1]
gb|KEK81782.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S1_C2]
gb|KEK85588.1| ATP synthase F0, B subunit [Escherichia coli 3-475-03_S3_C2]
gb|KEK93342.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S1_C2]
gb|KEK98786.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S1_C3]
gb|KEL01218.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S3_C3]
gb|KEL11455.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S3_C2]
gb|KEL12499.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S4_C2]
gb|KEL18647.1| ATP synthase F0, B subunit [Escherichia coli 4-203-08_S3_C1]
gb|KEL23551.1| ATP synthase F0, B subunit [Escherichia coli 3-373-03_S4_C3]
gb|KEL26794.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S4_C2]
gb|KEL33544.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S4_C2]
gb|KEL37635.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S4_C1]
gb|KEL44416.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S3_C3]
gb|KEL52671.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S1_C1]
gb|KEL55554.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S3_C1]
gb|KEL59572.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S1_C3]
gb|KEL59687.1| ATP synthase F0, B subunit [Escherichia coli 5-172-05_S4_C3]
gb|KEL68191.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S1_C1]
gb|KEL71113.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S3_C3]
gb|KEL77829.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S3_C2]
gb|KEL90679.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S3_C1]
gb|KEM01356.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S4_C2]
gb|KEM02398.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S4_C1]
gb|KEM09810.1| ATP synthase F0, B subunit [Escherichia coli 6-319-05_S1_C2]
gb|KEM23354.1| ATP synthase F0, B subunit [Escherichia coli 6-319-05_S1_C3]
gb|KEM27559.1| ATP synthase F0, B subunit [Escherichia coli 6-319-05_S4_C2]
gb|KEM37852.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S1_C1]
gb|KEM45653.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S4_C3]
gb|KEM49866.1| ATP synthase F0, B subunit [Escherichia coli 6-175-07_S1_C3]
gb|KEM56584.1| ATP synthase F0, B subunit [Escherichia coli 6-319-05_S4_C3]
gb|KEM59261.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S1_C2]
gb|KEM69319.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S3_C1]
gb|KEM73439.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S3_C1]
gb|KEM81369.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S3_C3]
gb|KEM86826.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S4_C1]
gb|KEM88310.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S4_C1]
gb|KEM97530.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S1_C3]
gb|KEM98332.1| ATP synthase F0, B subunit [Escherichia coli 6-319-05_S1_C1]
gb|KEM98606.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S3_C3]
gb|KEN10266.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S4_C2]
gb|KEN14663.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S3_C2]
gb|KEN21080.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S1_C1]
gb|KEN31161.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S3_C3]
gb|KEN37341.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S3_C1]
gb|KEN39259.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S4_C1]
gb|KEN44574.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S1_C2]
gb|KEN51639.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S4_C3]
gb|KEN51891.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S1_C3]
gb|KEN59955.1| ATP synthase F0, B subunit [Escherichia coli 6-537-08_S4_C2]
gb|KEN64071.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S4_C3]
gb|KEN69258.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S3_C2]
gb|KEN73164.1| ATP synthase F0, B subunit [Escherichia coli 2-052-05_S3_C2]
gb|KEN82826.1| ATP synthase F0, B subunit [Escherichia coli 2-474-04_S4_C1]
gb|KEN86149.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S3_C1]
gb|KEN94433.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S3_C2]
gb|KEN96734.1| ATP synthase F0, B subunit [Escherichia coli 1-392-07_S4_C1]
gb|KEO06143.1| ATP synthase F0, B subunit [Escherichia coli 8-415-05_S1_C2]
gb|KEO06446.1| ATP synthase F0, B subunit [Escherichia coli 2-177-06_S3_C3]
gb|KEO13102.1| ATP synthase F0, B subunit [Escherichia coli 2-222-05_S4_C3]
gb|KEO21398.1| ATP synthase F0, B subunit [Escherichia coli 5-366-08_S4_C1]
gb|KEO26348.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S1_C1]
gb|KEO26848.1| ATP synthase F0, B subunit [Escherichia coli 1-250-04_S3_C2]
gb|KEO36777.1| ATP synthase F0, B subunit [Escherichia coli 2-460-02_S1_C2]
gb|AID80898.1| ATP F0F1 synthase subunit B [Escherichia coli Nissle 1917]
gb|KEO95908.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP01230.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP03409.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP08552.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP15692.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP16304.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KEP77330.1| ATP F0F1 synthase subunit B [Escherichia coli E1140]
gb|AIF39021.1| ATP F0F1 synthase subunit B [Escherichia coli KLY]
gb|AIF62940.1| ATP synthase F0F1 subunit B [Escherichia coli B7A]
emb|CDU35006.1| ATP synthase subunit b [Escherichia coli D6-113.11]
emb|CDU41644.1| ATP synthase subunit b [Escherichia coli]
gb|AIF96372.1| ATP synthase B chain [Escherichia coli O157:H7 str. SS17]
gb|AIG71205.1| ATP synthase B chain [Escherichia coli O157:H7 str. EDL933]
gb|KFB97302.1| ATP synthase B chain [Escherichia coli DSM 30083 = JCM 1649 = ATCC
11775]
gb|KFD78487.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFF38999.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFF53849.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFH77953.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFH79423.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFH94708.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AIL17193.1| ATP synthase F0, B subunit [Escherichia coli ATCC 25922]
gb|AIL38157.1| ATP synthase subunit b [Shigella flexneri 2003036]
gb|AIL43097.1| ATP synthase subunit b [Shigella flexneri Shi06HN006]
gb|KFV23881.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFV31189.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KFV36306.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CEE07271.1| ATP synthase F0, B subunit [Escherichia coli]
gb|AIN34061.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli BW25113]
gb|KFZ99994.1| ATP synthase F0, B subunit [Shigella flexneri]
gb|KGA82378.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CDY62841.1| ATP synthase F[0] complex-b subunit, subunit of b subunit complex
and ATP synthase, F0 complex [Escherichia coli]
emb|CDZ22516.1| ATP synthase F[0] complex-b subunit, subunit of b subunit complex
and ATP synthase, F0 complex [Escherichia coli]
gb|KGI48025.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|AIT36892.1| ATP F0F1 synthase subunit B [Escherichia coli FAP1]
gb|KGL70178.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli NCTC 50110]
gb|KGM58870.1| ATP synthase subunit b [Escherichia coli G3/10]
gb|KGM63107.1| ATP synthase subunit b [Escherichia coli]
gb|KGM67481.1| ATP synthase subunit b [Escherichia coli]
gb|KGM70296.1| ATP synthase subunit b [Escherichia coli]
gb|KGM76643.1| ATP synthase subunit b [Escherichia coli]
gb|KGM79410.1| ATP synthase subunit b [Escherichia coli]
gb|KGP14857.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGP16661.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGP20364.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGP39321.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGP49294.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGP52123.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT04499.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT12817.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT16821.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT17477.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT24960.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KGT30107.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CDX09218.1| F0F1 ATP synthase subunit B,F-type ATPase subunit b,F0F1 ATP
synthase subunit B,F0F1-type ATP synthase, beta
subunit,ATP synthase F0, B subunit,ATP synthase B/B'
CF(0) [Shigella flexneri]
gb|AIX65733.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHD41895.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHD52053.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHD54539.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHD56431.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG76095.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG79260.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG84445.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG85894.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG92968.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHG96882.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH00198.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH05409.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH12536.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH12719.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH19012.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH29417.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH31707.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH38436.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH41838.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH43245.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH52126.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH56788.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH58545.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH66057.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH71305.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH73558.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH80415.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH86535.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH90529.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH91221.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHH99349.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI04553.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI11587.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI12724.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI14858.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI23855.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI29181.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI30638.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI33635.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI45147.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI46772.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI50947.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI51389.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI58987.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI65433.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI69277.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI81957.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI84211.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI86833.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI90115.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHI94390.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ02646.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ06900.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ11143.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ16229.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ20977.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KHJ25544.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AIZ30225.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli ER2796]
gb|AIZ53549.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli K-12]
gb|AIZ80397.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AIZ84943.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AIZ93460.1| ATP F0F1 synthase subunit B [Escherichia coli str. K-12 substr.
MG1655]
gb|AJA28843.1| ATP synthase B chain [Escherichia coli O157:H7 str. SS52]
gb|KHO60222.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CEK07831.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli O26:H11]
gb|AJB36984.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli APEC IMT5155]
gb|AJB53763.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CCQ31385.2| F0 sector of membrane-bound ATP synthase,subunit b [Escherichia
coli]
gb|KIE65632.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIE71813.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIE72250.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIE79856.1| ATP F0F1 synthase subunit B [Escherichia coli RS218]
gb|KIG27994.1| ATP F0F1 synthase subunit B [Escherichia coli C691-71 (14b)]
gb|KIG29905.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG34772.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG36479.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG47858.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG56229.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG57731.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG61742.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG66042.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG72784.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG73731.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG80687.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG85230.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG93049.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG94587.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIG99715.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH03846.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH16696.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH16797.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH21730.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH28261.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH31798.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIH35203.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AJE58311.1| membrane-bound ATP synthase F0 sector, subunit b [Escherichia coli]
gb|KII06559.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AJF58611.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli 1303]
gb|AJF78867.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIN84546.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AJG10745.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli ECC-1470]
gb|AJH12384.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIO85443.1| ATP synthase F0, B subunit [Escherichia coli 97.0264]
gb|KIQ39201.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIQ44405.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AJM75933.1| F0F1 ATP synthase subunit B [Escherichia coli RS218]
gb|AJO85800.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIY27596.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ11319.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ63713.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ63832.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ68916.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ72617.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ80396.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ84055.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ91107.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ91496.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KIZ94647.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJA02808.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJA07280.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD61875.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD67722.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD71302.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD77761.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD83796.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD91657.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJD91906.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJG97598.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJH02097.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJH08305.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJI05938.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJI07280.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJI23352.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJJ44747.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJJ74158.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|KJJ79391.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|KJW23969.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW30951.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW35486.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW42992.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW46493.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW50964.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW58284.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW60520.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW61679.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJW73898.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KJY08366.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKA92935.1| ATP synthase subunit b [Escherichia coli VR50]
emb|CQR83163.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli K-12]
gb|KKA63396.1| ATP synthase F0, B subunit [Escherichia coli 9.1649]
gb|KKB21046.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KKB23480.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKC14104.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKD58968.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD63347.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD67717.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD72074.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD76437.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD80856.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD85218.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AKD89579.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|KKF75872.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7]
gb|KKF85771.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7]
gb|AKE86766.1| ATP F0F1 synthase subunit B [Escherichia coli O104:H4 str. C227-11]
gb|KKK00390.1| ATP F0F1 synthase subunit B [Escherichia coli NB8]
gb|KKK30716.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KKO25757.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KKO30343.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KKO35831.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KKO40169.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKF22958.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKF57490.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AKF61630.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AKF65768.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AKF69908.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AKF74047.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|KKY45315.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7]
gb|AKH24412.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLD45140.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLD48622.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG30638.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG37358.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG38829.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG47010.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG49043.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG53760.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG60967.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG64830.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG72785.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG79342.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG84694.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG88273.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG91131.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLG99149.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH06655.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH09987.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH10512.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH14387.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH21594.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH25729.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH35801.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH36427.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH39430.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH53438.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH54694.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH56470.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH63157.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH65514.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH70270.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH81570.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH83842.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH91356.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLH92730.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKI68743.1| ATP F0F1 synthase subunit B [Shigella boydii]
gb|AKK14519.1| F0 sector of membrane-bound ATP synthase,subunit b protein
[Escherichia coli K-12]
gb|AKK15875.1| F0 sector of membrane-bound ATP synthase,subunit b protein
[Escherichia coli K-12]
gb|AKK50620.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli PCN033]
gb|AKK35328.1| F0F1 ATP synthase subunit B [Escherichia coli APEC O18]
gb|AKK41073.1| F0F1 ATP synthase subunit B [Escherichia coli APEC O2-211]
gb|AKK44926.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKK56232.1| F0F1 ATP synthase subunit B [Shigella flexneri G1663]
gb|AKM37322.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli PCN061]
gb|KLU94245.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KLW99609.1| ATP synthase subunit B [Escherichia coli]
gb|KLW99998.1| ATP synthase subunit B [Escherichia coli]
gb|KLX03124.1| ATP synthase subunit B [Escherichia coli]
gb|KLX14353.1| ATP synthase subunit B [Escherichia coli]
gb|KLX18634.1| ATP synthase subunit B [Escherichia coli]
gb|KLX26303.1| ATP synthase subunit B [Escherichia coli]
gb|KLX30530.1| ATP synthase subunit B [Escherichia coli]
gb|KLX30709.1| ATP synthase subunit B [Escherichia coli]
gb|KLX44659.1| ATP synthase subunit B [Escherichia coli]
gb|KLX47156.1| ATP synthase subunit B [Escherichia coli]
gb|KLX52219.1| ATP synthase subunit B [Escherichia coli]
gb|KLX52499.1| ATP synthase subunit B [Escherichia coli]
gb|KLX63382.1| ATP synthase subunit B [Escherichia coli]
gb|KLX63572.1| ATP synthase subunit B [Escherichia coli]
gb|KLX69018.1| ATP synthase subunit B [Escherichia coli]
gb|KLX70329.1| ATP synthase subunit B [Escherichia coli]
gb|KLX81140.1| ATP synthase subunit B [Escherichia coli]
gb|KLX84724.1| ATP synthase subunit B [Escherichia coli]
gb|KLX90921.1| ATP synthase subunit B [Escherichia coli]
gb|KLX93789.1| ATP synthase subunit B [Escherichia coli]
gb|KLX98921.1| ATP synthase subunit B [Escherichia coli]
gb|KLY05514.1| ATP synthase subunit B [Escherichia coli]
gb|KME62096.1| ATP synthase subunit B [Escherichia coli]
gb|AKN49622.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKO54916.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKP86760.1| F0F1 ATP synthase subunit B [Escherichia coli ACN001]
emb|CEP58632.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a]
gb|KMV37739.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KMV42565.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KMV44711.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KMV46934.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KMV56684.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KMV60532.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKR22550.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKR26903.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AKR31392.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNA42558.1| ATP synthase F0 [Escherichia coli M114]
emb|CTD28135.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD18347.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD17123.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP77340.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD05858.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS50926.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD03726.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR94638.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP40771.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ60046.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ72837.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP48191.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG48107.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC93623.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP45573.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG35459.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ55313.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE97760.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP62713.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE41782.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD05608.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ42130.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ52256.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN95403.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR93182.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH52750.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP34639.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR46531.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO26489.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ95586.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR14007.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE63254.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE34175.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE77941.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN90740.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE54727.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ17044.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN86333.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ05352.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR62258.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN97262.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP05173.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF29169.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF62627.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO20973.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF13890.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ88328.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP31997.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO97828.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ68469.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR07553.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE60696.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ29048.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE90653.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR69029.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC88502.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR45427.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR12458.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ43224.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE84190.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF99876.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE93163.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF92863.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG33472.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST05051.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF24643.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO71503.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE79989.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ31538.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS25909.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE88916.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP69784.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ61036.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO48982.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST60375.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO73278.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG01987.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ99147.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP34699.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG45871.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN81172.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP99448.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR53803.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR24303.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS35913.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN01623.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ81998.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO34134.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN16501.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP01683.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP18074.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE42408.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO04286.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO37520.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP02962.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO19375.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK97766.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST60888.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS33908.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE57303.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF09005.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN62448.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO54945.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP40454.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO84630.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN80233.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP23773.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU12521.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ44585.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO72405.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO86744.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ62677.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST48732.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP68900.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN39360.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG04883.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ24077.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ58875.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP98197.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK23029.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ89927.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR69037.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS91134.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS18488.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ26186.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST16711.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW63705.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO81068.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM94330.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE89939.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL79467.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF18387.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTP69877.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF51274.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV24092.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST29833.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW37643.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL56300.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF77395.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF37258.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV89999.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO05292.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL54265.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO97972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST05221.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ27268.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO70379.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU13032.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE39037.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP94412.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS50783.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS97908.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST89560.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF49249.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO49863.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR94251.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR99273.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV80278.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF66619.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF58238.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG60090.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN43017.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP93755.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO91037.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM31774.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI95950.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW75049.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE38210.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV45910.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC50873.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF22167.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC58347.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX41270.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF82159.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ80935.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA21119.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW64855.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL49260.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR85399.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST26092.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU99267.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTP72239.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF82430.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS23814.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR50221.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS61581.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF75863.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM11753.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST67036.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS69720.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN57132.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ68342.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL67274.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY96228.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU97972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST69884.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG94512.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV95379.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV67536.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV32062.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL86101.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW90531.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ05345.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST18417.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX02088.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS04149.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ01669.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU47341.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR26502.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL32464.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW51151.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR95785.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY19314.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ65210.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO27945.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF52600.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX23333.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV63156.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ53227.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK58407.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS80064.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV35790.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL44506.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU18129.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTP69649.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI73597.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO14103.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW76755.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG95231.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY22591.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK79423.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS97051.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ96833.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL29847.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW15377.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV01946.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ85718.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF70880.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU23954.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX55932.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL34334.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ29067.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX14898.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK74845.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSE63798.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR94790.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN31544.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL99019.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS52120.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV57527.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU99929.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ67978.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY19096.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSQ78377.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ95804.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK89022.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY44183.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI24617.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ26767.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV29864.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ93828.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI90789.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL17810.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB23139.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU38810.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR90544.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM53293.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR59556.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK47570.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU40669.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI71757.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST99782.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL09830.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK67971.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL32628.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS69008.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK84449.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX41223.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU10576.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ13224.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK09546.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX42592.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV67767.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL73479.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX50919.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF96332.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA88585.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV20202.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS10372.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH68220.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR79856.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL19977.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL66586.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST82591.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV68350.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB64522.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ27688.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ52112.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF30989.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK07979.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU81707.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW50932.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY13816.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV73720.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX52382.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI57022.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK29751.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ77876.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY67419.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ49818.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY10135.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF71209.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG52584.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV56839.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM82661.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR21166.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB90195.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC50788.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY56890.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU96870.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ97968.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY95359.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB54125.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV96312.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY34497.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW23264.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM55332.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ84482.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY13717.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF38341.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ45214.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH14253.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ74860.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST87261.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSF13072.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI83588.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM04868.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD88602.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL92117.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV04370.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ32898.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS68024.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY65904.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG91574.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI67149.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV03547.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM59961.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV13220.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN75327.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS74082.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV72966.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM27145.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH94313.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV04042.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY06300.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY30153.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY45793.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX53578.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ48367.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP22053.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC03705.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO77755.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ59081.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX85492.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM07505.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW76361.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH00710.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB58346.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY13810.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD74586.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV12689.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST82085.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX04613.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU69594.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA11945.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV99169.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSO23811.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX37576.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSR16316.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ37908.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH84907.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB57449.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH71140.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX12232.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI12855.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX42938.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY47752.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB84603.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ38430.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH71195.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW96789.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX44602.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM92434.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSP47241.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH86062.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU54434.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK31338.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ67585.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC88305.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU94765.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ42224.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB50086.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU92577.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX91742.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX25195.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH96820.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS62401.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB58707.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS53995.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV97159.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB70834.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI57071.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM48589.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH84852.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ42972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH25054.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA18565.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM69771.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL74860.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ16168.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK03483.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ59826.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ06071.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM90686.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC09134.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB53277.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD97928.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC44896.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB61301.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC36603.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSL90635.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY10244.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ85268.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY43467.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH19696.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC19679.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX38625.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU63561.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ71602.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC21568.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH83789.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST50441.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM22800.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC62009.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU54455.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU84320.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY58972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ08420.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY47618.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST89002.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB64753.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ32594.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH16122.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU22443.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC74492.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY17642.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX22454.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH30765.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG78937.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI76213.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH03711.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU91830.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG51509.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK27771.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ04839.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC28380.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM66821.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ59507.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY41717.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ64559.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU63922.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV22464.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG71362.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSU78298.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI14022.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH74388.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSV19383.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSW90909.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSX50396.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH07493.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG68441.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSG63391.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB05235.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA96658.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSZ99021.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA95218.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA46061.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA31551.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH86435.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI00932.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN08330.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS77584.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH48741.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSN25376.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY36775.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH39956.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM03181.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSS09953.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM53216.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA56868.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM70979.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM64975.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM33125.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB16337.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH80561.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM13537.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB17007.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM72236.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH74170.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CST12926.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM95653.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA22703.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM57761.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA71296.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB34899.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA29441.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM62940.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ73735.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ84679.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH66422.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM25877.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSJ39094.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB47141.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSM64085.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB57954.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA68857.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA94715.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH43354.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA59974.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB28062.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA67024.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC34223.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSH47568.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSI39765.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA38399.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA76835.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB06324.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA48345.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTB66010.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTA64603.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK17643.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK06402.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK69369.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTC07735.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK58952.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK65862.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSK30573.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CSY41534.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|KNF16945.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF17469.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF22477.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF27985.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF32878.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF36403.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF39216.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF48932.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF52293.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF60809.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF63526.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF67746.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF79025.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF80274.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF85611.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF92084.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF97708.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNF98537.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG10995.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG12746.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG19633.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG28320.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG28522.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG34275.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG36722.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNG38670.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY01321.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY54647.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY62145.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY62998.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY70406.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY75359.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY82306.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY88941.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY90563.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNY97474.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ04935.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ06898.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ09784.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ12843.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ19802.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KNZ27369.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOA01016.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOA24931.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOA35597.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CTX07550.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX20853.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX21065.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX00371.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX20763.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX06464.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW94406.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX06135.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR23208.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR49901.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU35694.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU80510.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR63892.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV07489.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR79727.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR22960.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR67088.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV90109.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR29003.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV84104.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT09002.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV73240.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT80132.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT93962.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU97933.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS58835.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU15847.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT51815.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU69651.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR59183.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW48196.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU02458.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW33380.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR27807.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR40920.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV35810.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU31603.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS21124.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS48865.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU31940.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR86286.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV72962.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW13320.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS10806.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR80729.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT28914.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR58247.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV25400.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW29983.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV29519.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW70729.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV69017.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS26892.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW10495.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW21970.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS19935.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV94794.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS68221.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS11863.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS16734.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV88195.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW22435.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR67424.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU38472.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU84958.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS57917.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS34443.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU71648.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS15663.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR77131.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU59033.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS96239.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS56108.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR97579.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV59966.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW56069.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTR43054.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV52965.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT24122.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW16339.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU00021.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV08103.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU24443.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW55444.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT21049.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU86309.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS18340.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS47640.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT67904.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV13584.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV42848.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV41249.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT45220.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW04899.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW83213.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW51834.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS90449.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT44441.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT47784.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU61351.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT88520.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV27464.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT49707.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV63259.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT00282.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW09502.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW27807.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS79672.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV50653.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT03540.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT58398.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS48746.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT57333.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW92942.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV51891.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS33931.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTU12250.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV16187.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV51051.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT82573.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW04527.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS68953.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTV85702.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT35559.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTW57848.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTS48487.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTT68712.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY38283.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY69941.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX75007.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY80446.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY56970.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY68576.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY33008.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY29172.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ48920.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ16432.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ60371.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY82265.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ53292.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ04371.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY69537.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ52594.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY12595.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ18853.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY18696.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY90552.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY54947.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX82329.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY23922.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ57395.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY14889.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY71283.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ22764.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX87931.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ08032.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ83131.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ80231.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ69956.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY63671.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ44367.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ27631.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ56544.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY17284.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ94201.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ06065.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY91217.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ29777.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ15302.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ85511.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ68313.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTZ94440.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA13376.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA09973.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA06533.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA04747.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA35217.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA60290.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA32975.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA57905.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA40383.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA32508.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA36852.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA42217.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CUA38314.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
gb|KOQ98609.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALB33761.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALD27645.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALD42453.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALD32703.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALD37474.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CUH57981.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli KRX]
gb|KOZ07076.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ10614.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ17045.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ23477.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ25763.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ34043.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ38192.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ44402.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ48319.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ54132.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ56141.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ64996.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ68512.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ73881.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ78387.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ79985.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ85856.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOZ93902.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CUK13066.1| F-type ATPase subunit b [Achromobacter sp. ATCC35328]
gb|KPH32406.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPH33989.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPH42898.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPH49583.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CUQ99016.1| ATP synthase B chain [Escherichia coli]
emb|CTX45364.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX60477.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX63827.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX62108.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX71198.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX57448.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY52622.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX92158.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTD58269.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTD57980.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|CTX54089.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX46320.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTY50931.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
emb|CTX46238.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
gb|ALH93059.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7]
gb|ALI38571.1| ATP F0F1 synthase subunit B [Escherichia coli str. K-12 substr.
MG1655]
gb|ALI42970.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALI47367.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO03795.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO06922.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO17544.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO21537.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO21966.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO27312.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO27621.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO32030.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO45599.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO59521.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO59974.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO63090.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO67950.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO75825.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO79890.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO82353.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO90329.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPO93903.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP00017.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP05334.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP13000.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP14976.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP20141.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP23465.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP29352.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP37141.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP42560.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP46420.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPP47421.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KPQ49690.1| ATP synthase subunit b [Escherichia coli TW10598]
gb|KQB27413.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQC25218.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI75173.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI79842.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI86757.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI89437.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI95916.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQI97907.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ03947.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ05865.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ17870.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ19654.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ21249.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ27173.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ33829.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ40093.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ43954.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQJ48881.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALL88088.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALL95774.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KQL79104.1| ATP synthase F0F1 subunit B [Escherichia coli]
gb|KRQ05061.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7]
gb|KRR52728.1| F0F1 ATP synthase subunit B [Escherichia coli VL2732]
gb|KRR58252.1| F0F1 ATP synthase subunit B [Escherichia coli K71]
gb|KRR63128.1| F0F1 ATP synthase subunit B [Escherichia coli VL2874]
gb|ALN47827.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KRT20201.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KRV67963.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KRV96361.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KRW04087.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KST26788.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KST34931.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALQ57239.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALQ74657.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSW93201.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSX59564.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSX80270.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSX88914.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY05300.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY09627.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY36660.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY53548.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY64862.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY76683.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY79234.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSY90225.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSZ07404.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KSZ22051.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CRL91491.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|ALT51669.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG68835.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG76066.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG76646.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG82900.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG85099.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG86312.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG96503.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUG98202.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH04666.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH12010.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH13157.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH15326.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH21609.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH24562.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUH30004.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALV71235.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALX54627.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALX59846.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALX64632.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALY15296.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|CUW79125.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|KUR29457.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUR34732.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ALZ57995.1| ATP synthase F0 sector subunit b [Shigella sonnei]
gb|KUR83755.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUR88874.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUR95250.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS02353.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS06318.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS06886.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS10369.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS16297.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS23409.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS28371.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS35764.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS37286.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS39081.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS42908.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS51188.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS53372.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS54956.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS67367.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS71774.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS80978.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS84710.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS85975.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS92887.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS94048.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUS96666.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT11678.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT15435.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT18959.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT23337.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT27692.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT30860.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT33926.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT42005.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT43757.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT48944.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT52688.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT56035.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT57411.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT70133.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT70289.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT76976.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT81413.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT87380.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT94468.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUT96292.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU01922.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU03789.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU07561.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU12985.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU22031.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU25211.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU30649.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU43082.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU44597.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU44865.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU52973.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU53842.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU61993.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU65499.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU68344.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU70205.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU77579.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU86788.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU86948.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUU97711.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV03694.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV08206.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV09134.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV12007.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV16290.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV21094.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV27317.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV30594.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV32923.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV44405.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV52472.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV60856.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV61783.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV66427.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV69026.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV71194.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV79381.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV83043.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV83994.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV93499.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUV99752.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW03070.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW06857.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW12558.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW19612.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW24839.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW28635.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW35861.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW37214.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW44694.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW45385.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW48348.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW56018.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW61204.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW63215.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW70401.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW75900.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW77108.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW85944.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW86959.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW93307.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUW93725.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX04315.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX13267.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX14726.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX18398.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX24017.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX28095.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX37161.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX40300.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX40939.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX43330.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX52419.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX55576.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX62325.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX64749.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX66808.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX78883.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX87488.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX87669.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUX88091.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUY00666.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUY01503.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUY07440.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KUY09403.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KVI16315.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KVI16861.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KVI23994.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KWV18040.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMB56476.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KWV97819.1| ATP F0F1 synthase subunit B [Escherichia fergusonii]
gb|KWV98564.1| ATP F0F1 synthase subunit B [Escherichia fergusonii]
gb|KWW00354.1| ATP F0F1 synthase subunit B [Escherichia fergusonii]
gb|AMC96628.1| ATP F0F1 synthase subunit B [Escherichia coli str. K-12 substr.
MG1655]
gb|KXC11048.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMG17354.1| ATP synthase subunit B [Shigella sonnei]
gb|AMG80921.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AMH20357.1| ATP F0F1 synthase subunit B [Escherichia coli B]
gb|AMH24566.1| ATP F0F1 synthase subunit B [Escherichia coli B]
gb|AMH32345.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|AMH37065.1| ATP F0F1 synthase subunit B [Escherichia coli K-12]
gb|KXG58005.1| ATP synthase subunit b [Escherichia coli]
gb|KXG59636.1| ATP synthase subunit b [Escherichia coli]
gb|KXG60799.1| ATP synthase subunit b [Escherichia coli]
gb|KXG70144.1| ATP synthase subunit b [Escherichia coli]
gb|AMF89661.1| ATP synthase subunit B [Escherichia coli]
gb|KXG96941.1| ATP synthase F0, B subunit [Escherichia coli]
gb|KXG99907.1| ATP synthase F0, B subunit [Escherichia coli]
gb|KXH91687.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXH93924.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXI03439.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXI06256.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CUW23889.1| F-type ATPase subunit b [Escherichia coli]
gb|AMK99765.1| ATP F0F1 synthase subunit B [Escherichia coli str. K-12 substr.
MG1655]
gb|AML07014.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AML11661.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AML16682.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AML21619.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXK74137.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXK76426.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXK77503.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXK92356.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXK99770.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL05784.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL06076.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL06921.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL10981.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL17804.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL24337.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL25760.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL34859.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL41285.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL54806.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL55680.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL64938.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL75122.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL79804.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL87549.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL89053.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL93346.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXL96551.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM10278.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM15256.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM16592.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM24813.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM25085.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM33387.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM33535.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM41952.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM43640.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM56045.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM61635.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM66132.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM71860.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM78717.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM86354.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM89367.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM91267.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXM97484.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN05407.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN09024.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN09812.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN16491.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN20232.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN29386.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN33606.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN42481.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN44357.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN48440.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN57238.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXN62718.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP16618.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP19643.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP20356.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP32114.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP37570.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP40022.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP48301.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP49068.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP51772.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP53464.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP64261.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP65529.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP71912.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP75587.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP80284.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP83754.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP89634.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXP92513.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ03253.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ03425.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ06258.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ10902.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ23693.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ24621.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ24769.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ29961.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ36097.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ41045.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ42877.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ52430.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ55236.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ56463.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ61960.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ65243.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ73798.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ78334.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ78901.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ82229.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ88823.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ93092.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXQ98509.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR05415.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR09641.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR10939.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR17843.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR20822.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR23989.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR31989.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR35483.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR41594.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR47044.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR52219.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR55718.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR59800.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR66340.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR67863.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR70092.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR79813.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR84025.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR88463.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR95783.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXR96523.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMM38725.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMM77236.1| ATP F0F1 synthase subunit B [Shigella flexneri 1a]
emb|CUU96047.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AMN60084.1| ATP F0F1 synthase subunit B [Shigella flexneri 2a]
gb|AMN64911.1| ATP F0F1 synthase subunit B [Shigella flexneri 4c]
gb|KXU67732.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXU73315.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KXU74026.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|CUX81679.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AMQ53543.1| ATP F0F1 synthase subunit B [Escherichia coli JJ1887]
gb|AMR21169.1| F0F1 ATP synthase subunit B [Shigella sp. PAMC 28760]
gb|KYL38038.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYO66644.1| ATP synthase subunit b [Escherichia coli]
gb|KYO70518.1| ATP synthase subunit b [Escherichia coli]
gb|KYR03618.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR10038.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR16766.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR17551.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR24731.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR28847.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR37668.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR40517.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR51290.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR57709.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR61768.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR62423.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR69041.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR70153.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR80460.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR81109.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR91504.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR91679.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYR96192.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS00291.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS05724.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS13754.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS27507.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS27723.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS32035.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS37882.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS41770.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS48438.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS54659.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS55553.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS63517.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS63754.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS66542.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS71391.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS78275.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS82755.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS88444.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYS94575.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT03444.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT14213.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT14943.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT19007.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT20152.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT25364.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT28386.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT36868.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYT39276.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT46177.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT48062.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT51004.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT63467.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT71002.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT76412.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT78993.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT84196.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT88733.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT94303.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYT95020.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU02122.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU10927.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU14481.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU15880.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU20508.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU27549.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU33753.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU40920.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU44886.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU48608.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU56215.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU57509.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU62851.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU70393.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU72886.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU75208.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU76681.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU95241.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU96979.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYU97295.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV02661.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV12263.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV13152.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV15383.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV24668.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV26986.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV28993.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV41548.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV44044.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV47541.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV62047.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV67328.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV68437.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV72656.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV86614.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV87983.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYV88735.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW00920.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW01935.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW05119.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW08405.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW15119.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW21709.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW28254.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW35716.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW40652.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW50102.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW52874.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW58018.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW61070.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW66501.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW74607.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW74784.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYW76026.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMU84314.1| ATP F0F1 synthase subunit B [Escherichia coli str. Sanji]
gb|KYZ90831.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYZ94547.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KYZ97673.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|AMW43579.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AMW48998.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AMX13589.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AMX31308.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AMX34117.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AMX41817.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZG96406.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH00422.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH06845.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH14986.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH19142.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH19333.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH28822.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH31414.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH41033.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH43039.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH45624.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH49648.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH56405.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH60097.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH65326.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH71891.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH75531.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH76900.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH79542.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH90996.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZH98563.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI01543.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI06689.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI14308.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI17920.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI19442.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI25068.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI31349.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI34863.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI42403.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI48943.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI49044.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI54901.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI57259.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI59046.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI68832.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI71755.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI72276.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI79829.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI86187.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI93734.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI96624.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZI98676.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ07809.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ11382.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ13117.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ18166.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ29414.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ30741.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ33988.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ37937.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ51368.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ51914.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ54494.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ61572.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ67355.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ75893.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ82724.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ83419.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ86293.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ97368.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ97950.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZJ98093.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KZO70928.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KZO79294.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KZO82215.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KZP43360.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAC00869.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC01563.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC09429.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC11320.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC17909.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC21638.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC29118.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC32712.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC38673.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAC41148.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|OAE50995.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAE73987.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAF23326.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAF25488.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAF28284.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAF47209.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAF53876.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAF90849.1| ATP synthase subunit b [Escherichia coli PCN009]
gb|OAF91059.1| ATP synthase subunit b [Escherichia coli PCN079]
gb|OAI35406.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANE60055.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANE64813.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAJ79786.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAJ84403.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAM47391.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SAP67068.1| ATP synthase subunit B [Klebsiella oxytoca]
gb|OAN06879.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|OAO46880.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO47137.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO52827.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO57705.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO65038.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO68055.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAO72397.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANG71245.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|ANG76744.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|ANG82425.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|OAP72880.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAR88633.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAR96646.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAS04412.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OAS90345.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAT64063.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAV62193.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANJ37578.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANJ40251.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OAY11833.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANK04280.1| atpF [Escherichia coli O25b:H4]
gb|ANK11391.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|CTQ84359.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|ANK50920.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANM84557.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANK34566.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OBU92384.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANO91698.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANP09769.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANP20583.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANP30413.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANO80296.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ANQ03116.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANO27659.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANR83567.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OBZ36664.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OBZ36821.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OBZ48625.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCC39222.1| ATP F0F1 synthase subunit B [Shigella sonnei]
gb|OCC40699.1| ATP F0F1 synthase subunit B [Shigella sonnei]
gb|OCC43592.1| ATP F0F1 synthase subunit B [Shigella sonnei]
gb|OCC44322.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC52353.1| ATP F0F1 synthase subunit B [Shigella sonnei]
gb|OCC53779.1| ATP F0F1 synthase subunit B [Shigella sonnei]
gb|OCC60598.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC67271.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC68710.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC77428.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC79373.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC82806.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC84617.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC92831.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC95634.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCC96646.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD03130.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD09087.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD09145.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD17873.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD21639.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD22436.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD24534.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD34524.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD45000.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD46414.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD51507.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD55524.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD59304.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD70520.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD70890.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD72030.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD73107.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD74683.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD81829.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD93316.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD93867.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCD96419.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE06465.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE09158.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE09204.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE21884.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE22975.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE24820.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE28489.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE35076.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE35119.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE45581.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE45685.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE50289.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE52832.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE57211.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE59820.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE60254.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE64970.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE74250.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE76652.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE78243.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE79173.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE87836.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE91619.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCE97015.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCF01981.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCF09095.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCF14329.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCF16028.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OCF16479.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SCA73624.1| ATP synthase F0F1 subunit B [Escherichia coli]
gb|OCJ85052.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCJ89852.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCJ94547.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCJ97568.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCK02173.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANV95612.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCK69082.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANW29563.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ANW42725.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|OCO45975.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCQ17167.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OCQ25369.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCQ34602.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCQ49750.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS55437.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS56465.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS61472.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS63634.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS73101.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCS80232.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCT06928.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCW52005.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OCW80186.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOD09096.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODA86101.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODB47938.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODB49139.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODG70788.1| F0F1 ATP synthase subunit B [Shigella sp. FC1661]
gb|ODG78178.1| F0F1 ATP synthase subunit B [Shigella sp. FC1764]
gb|ODG82191.1| F0F1 ATP synthase subunit B [Shigella sp. FC1882]
gb|ODH15301.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODH22676.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODH27695.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODH36292.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODH40588.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODJ19073.1| F0F1 ATP synthase subunit B [Shigella sp. FC1172]
gb|ODJ22563.1| F0F1 ATP synthase subunit B [Shigella sp. FC1180]
gb|ODJ25695.1| F0F1 ATP synthase subunit B [Shigella sp. FC2383]
gb|ODJ28390.1| F0F1 ATP synthase subunit B [Shigella sp. FC2833]
gb|ODJ35456.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ODJ39582.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOM49022.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|AOM55646.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOM60233.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOM72272.1| ATP synthase subunit b [Escherichia coli]
gb|ODQ08942.1| F0F1 ATP synthase subunit B [Shigella sp. FC569]
gb|ODQ10284.1| F0F1 ATP synthase subunit B [Shigella sp. FC1056]
gb|ODQ14781.1| F0F1 ATP synthase subunit B [Shigella sp. FC1139]
gb|AOO71947.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEB95789.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEG25721.1| F0F1 ATP synthase subunit B [Shigella sp. FC2117]
gb|OEG27262.1| F0F1 ATP synthase subunit B [Shigella sp. FC2175]
gb|OEG27581.1| F0F1 ATP synthase subunit B [Shigella sp. FC2125]
gb|OEG38782.1| F0F1 ATP synthase subunit B [Shigella sp. FC2710]
gb|OEG66303.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOR21960.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI06742.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI10826.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI12192.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI16240.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI26186.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI27467.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI28776.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI36012.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI36564.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI43670.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI49967.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI50690.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI51569.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEI63173.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL39456.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL41586.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL50098.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL53898.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL59741.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL63294.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL73010.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL76249.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL80865.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL80910.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL88072.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL91870.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEL95391.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM03705.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM11501.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM11947.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM22324.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM23722.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM26463.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM27529.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM41566.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM46755.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM50149.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM57050.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM58024.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM69092.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM71067.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM76281.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM79635.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM84832.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM88305.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM96872.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEM98971.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN06981.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN12314.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN14057.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN19674.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN22118.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN29608.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN37257.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN39536.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN42363.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN47056.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN56693.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN58075.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN62856.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN70637.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN78552.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN78591.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN83391.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN96513.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEN97316.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEO01721.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEO04550.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEO11099.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEO15746.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OEO18167.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOT35222.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|AOV35368.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AOV46128.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|OFE26222.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SDP29877.1| ATP synthase F0 subcomplex B subunit [Shigella sonnei]
gb|AOX54948.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AOX60340.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OHV07154.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SEQ03473.1| ATP synthase F0 subcomplex B subunit [Escherichia coli]
gb|APA24201.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OII46280.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OII51285.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APA39778.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OII80426.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OII92909.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OII94978.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OII99205.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIJ02230.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIJ09090.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SCQ09755.1| F-type ATPase subunit b [Escherichia coli]
gb|OIU77484.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIU79514.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APC53672.1| F0F1 ATP synthase subunit B [Escherichia coli str. K-12 substr.
W3110]
gb|OIY23780.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY28222.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY37177.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY38741.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY41772.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY46215.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY50707.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY55999.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY63045.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY74575.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY76918.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY81536.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY83831.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY89545.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY91128.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIY97312.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ00353.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ06406.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ21715.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ22079.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ22603.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ26101.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ61787.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ71186.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ77288.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ86999.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OIZ90166.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF20411.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF23541.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF23582.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF35945.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF37884.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF46476.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF52630.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF52847.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF63022.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJF86304.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|SHD58671.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|APE55488.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APE60438.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APE65318.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APE70153.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APE82469.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|APE94438.1| hypothetical protein FORC41_4611 [Escherichia coli]
gb|OJH23920.1| F0F1 ATP synthase subunit B [Escherichia coli NA114]
gb|APG34382.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API00863.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API06481.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API12056.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API17620.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API23264.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API28757.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API34429.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API39990.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|API49692.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK12632.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK17465.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK21078.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK26229.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK38442.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK43460.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK44061.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK51519.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK51836.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK60646.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK65188.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK72567.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK75814.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK79420.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK84119.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK89239.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK91459.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJK98850.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL07555.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL11972.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL18771.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL20665.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL30553.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL34618.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL37376.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL44370.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL46895.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL48272.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL52333.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL61366.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL68018.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL72543.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL74969.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL80079.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL91298.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJL95087.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM03234.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM05581.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM16359.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM17597.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM25452.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM28991.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM35472.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM39648.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM43672.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM51087.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM56507.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM61288.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM65708.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM70505.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM74747.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM80793.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM84254.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM89980.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM93633.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJM99128.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN09101.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN13055.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN15343.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN18587.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN23528.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN30106.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN40009.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN42747.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN47105.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN51438.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN60721.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN64056.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN69966.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN71626.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN74151.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN81377.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN86406.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN92692.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN94684.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJN99900.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO07197.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO13886.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO16394.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO20883.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO29153.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO30135.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO48485.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO49216.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO55651.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO65522.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO68410.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO71804.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO80191.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO84388.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO89654.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO93058.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO96166.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP01933.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP08741.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP12626.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP16684.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP21603.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP31509.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP37154.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP40254.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP41975.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP42924.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP66587.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP72853.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP75402.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP80453.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP89599.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP94624.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP99340.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ02254.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ07979.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ10013.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ10393.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ24076.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ31810.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ38766.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ39224.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ43923.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ45386.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ56612.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ60163.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ62687.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ70205.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ75268.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ76121.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ84363.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ88497.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ93588.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJQ95743.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR02290.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR09075.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR16319.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR19474.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR20252.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR27114.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR32923.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR41358.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR44808.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR45086.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR51373.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR58080.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR68763.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR72530.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR77751.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR81663.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR87343.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR90456.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJR98006.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS03564.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS05793.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS09587.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS09943.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS24751.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS30250.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS32119.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS34433.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS39215.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS46811.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS52812.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS59238.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS61251.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS66348.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS75358.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS76095.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS91254.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJS92283.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJZ36220.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APJ56185.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ63433.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ66271.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ70313.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ79144.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ84351.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ85098.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ90231.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APJ96150.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK01453.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK04244.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK13033.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK17677.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK21431.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK25044.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK29912.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK36077.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK41251.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK46075.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK48905.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK56040.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK61150.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK64642.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK71699.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK74560.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK82016.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK84196.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK90954.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK94662.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APK98867.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL05506.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL08122.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL16073.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL18880.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL24956.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL30913.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL33810.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL39055.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL44894.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL49325.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL57730.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL61966.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL63976.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL72478.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL75143.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL80086.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL84532.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL89409.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|APL51360.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OKA61724.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKB69983.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKB73021.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKB84956.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKB90706.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKB93564.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKL78375.1| ATP synthase subunit B [Escherichia coli]
gb|OKL97809.1| ATP synthase subunit B [Escherichia coli]
gb|OKO60788.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APO29216.1| ATP_synt_b: ATP synthase F0, B [uncultured bacterium]
gb|OKP63654.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKS65934.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKS98634.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT00455.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT06297.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT06465.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT16454.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT17479.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT20184.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT32057.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT34634.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT43650.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT44601.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT52939.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT54486.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT62638.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT65449.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT68366.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT71098.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT84519.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT85232.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT86460.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT93560.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKT97139.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU03624.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU09619.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU21731.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU22923.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU27751.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU34104.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU38303.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU42586.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU46976.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU56291.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU65522.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU73089.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU76911.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU86133.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU87889.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU91130.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU97343.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKU98231.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV07464.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV14678.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV16423.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV22969.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV25324.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV33442.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV35892.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV46019.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV53054.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV56124.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV59036.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV64175.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV67123.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV71880.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV79892.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV86546.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV89483.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKV99666.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW00588.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW08687.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW15036.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW20257.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW20695.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW25561.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW30207.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW40028.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW42387.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW47952.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW57869.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW60773.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW63591.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW67318.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW73920.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW80652.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW85435.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW90005.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW94783.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKW99352.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX03766.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX14563.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX17323.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX24221.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX27884.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX31580.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX32896.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX40680.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX45999.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX47738.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX62300.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX68341.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OKX75773.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APQ23863.1| F-type ATPase subunit b [Escherichia coli]
gb|OLL61247.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APT05270.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLN75844.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OLO95540.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|APT64880.1| ATP synthase subunit B [Escherichia coli]
gb|OLR35747.1| ATP F0F1 synthase subunit B [Escherichia coli O25b:H4-ST131]
gb|OLR85969.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS68646.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS73053.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS77435.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS80871.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS90230.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLS91796.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLT04798.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLY54520.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OLY88320.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H43]
gb|OMG95766.1| ATP synthase subunit B [Escherichia coli]
gb|OMH00816.1| ATP synthase subunit B [Escherichia coli]
gb|OMH07173.1| ATP synthase subunit B [Escherichia coli]
gb|OMI44604.1| F0F1 ATP synthase subunit B [Escherichia coli N37058PS]
gb|OMI52715.1| F0F1 ATP synthase subunit B [Escherichia coli N37122PS]
gb|OMI54431.1| F0F1 ATP synthase subunit B [Escherichia coli N40607]
gb|OMI56822.1| F0F1 ATP synthase subunit B [Escherichia coli N40513]
gb|OMI62827.1| F0F1 ATP synthase subunit B [Escherichia coli N36410PS]
gb|OMI64953.1| ATP F0F1 synthase subunit B [Escherichia coli N37139PS]
gb|OMI71573.1| F0F1 ATP synthase subunit B [Escherichia coli N36254PS]
emb|SIY01264.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX62968.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD12318.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC46503.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB40503.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC49146.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY28516.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK05474.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX79974.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH23088.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC94359.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB52256.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC56504.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC67704.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX36366.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB22661.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC00064.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC55170.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC18888.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB77042.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX53355.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC20022.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB37069.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX36690.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI44998.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX62702.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH66497.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA84199.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH99977.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB72417.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH56635.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX31334.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH60499.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB35671.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB65032.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB57879.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB62920.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB58219.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB96696.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI17035.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC50955.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB52574.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI18896.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY05951.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB83874.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ72027.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX02206.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX92694.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX37612.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX75502.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX25265.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI91972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI20756.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX76427.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA89693.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA70124.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ61340.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD20700.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX74629.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA42818.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG55331.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH95391.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG13007.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY17422.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA64035.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH68270.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI12161.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH31120.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX28617.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB02568.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG92618.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI01938.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC71364.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC42090.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB81113.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG73025.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA44734.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH42321.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH03863.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ74796.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK00506.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA56436.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX70273.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG48092.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA65602.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA21913.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA71732.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG99641.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH16473.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ23099.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ98296.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK41224.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA79543.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB91519.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ14082.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB31306.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF63273.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY26507.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX63782.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA41722.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA65654.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH59584.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI78989.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX33594.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA53703.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY10465.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI17802.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY88413.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK56447.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX84828.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB97222.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH23191.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK24706.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH06226.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK68394.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY12723.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX87328.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI46247.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB27972.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK48518.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK66219.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ14411.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX84181.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ30822.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI99983.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX76423.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ20220.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI29508.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI85316.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX65242.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA00386.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ29179.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI77626.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY29662.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG56542.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ02696.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB82188.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ40725.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB79925.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX99782.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC44008.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ20590.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI34670.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH42408.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ68222.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX72792.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK35775.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI34892.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX92191.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ57630.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ96722.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA17245.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ76400.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX68240.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY10537.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI33058.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ02781.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB88276.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ99880.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI70691.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH23814.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG61206.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ63236.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA60621.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB50738.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX16686.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ78259.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ98489.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY48882.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX58311.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG85875.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX34089.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ17416.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ70628.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA27054.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG60383.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH25051.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ31781.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY91329.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ72718.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH83934.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC05900.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ69568.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX80309.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY12767.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE74244.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ36718.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ31519.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ75449.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK43949.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF63163.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA73537.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA27903.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB15116.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ03532.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ80050.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY51785.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ85931.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ46638.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG94366.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA78384.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ11156.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG86819.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ97121.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH99638.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ48800.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG62158.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB43928.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB85522.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC22858.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ51333.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF36123.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ29776.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ98560.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG56533.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF79268.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD21816.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF30275.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB37516.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF58500.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG62216.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJA95041.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK05791.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ40510.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB47809.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG10756.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF56638.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC47528.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ98714.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG88510.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ05100.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ83167.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG47938.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG92231.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF42483.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB91154.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK00290.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX09286.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG81748.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE54138.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF32372.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF27339.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG54087.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG16085.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJB68600.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG87833.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK47525.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY05733.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD95309.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX39891.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJC22613.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY53593.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF54663.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIY45964.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE13279.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG67584.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF36157.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG38673.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG98476.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ30858.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI39768.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG89069.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE06565.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ90627.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD56735.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH54740.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE06168.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG15237.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE92731.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE16328.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD96673.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE60694.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJH03376.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIX76424.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG12642.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK07338.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJJ48693.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SIZ23940.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG68250.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK38059.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD93011.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE36013.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD55273.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE39845.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD00896.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD12427.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD24667.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD43564.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE97864.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG55825.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD50041.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE32712.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE77789.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJF91560.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE87720.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJG17191.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE11027.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE85805.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD49222.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE41142.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD94106.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE16207.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE44016.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE33447.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD90870.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJK10830.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE43035.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD20518.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD88261.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD51197.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE42415.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJD55302.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE04954.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJE30145.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|ONF81778.1| ATP synthase subunit B [Escherichia coli]
gb|ONG05297.1| ATP synthase subunit B [Escherichia coli]
gb|ONG17136.1| ATP synthase subunit B [Escherichia coli]
gb|ONG26688.1| ATP synthase subunit B [Escherichia coli]
gb|ONG28705.1| ATP synthase subunit B [Escherichia coli]
gb|ONG31997.1| ATP synthase subunit B [Escherichia coli]
emb|SJK90723.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|ONK35687.1| ATP synthase subunit B [Escherichia coli]
gb|ONK40305.1| ATP synthase subunit B [Escherichia coli]
gb|ONK54482.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SJL99849.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJL98733.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJM02130.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJM06457.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJM05525.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJM04484.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|ONN30597.1| ATP F0F1 synthase subunit B [Escherichia coli]
emb|SJM22463.1| F0F1 ATP synthase subunit B [Shigella sonnei]
gb|OOC69657.1| ATP synthase subunit B [Escherichia coli]
gb|OOC73890.1| ATP synthase subunit B [Escherichia coli]
gb|OOC78263.1| ATP synthase subunit B [Escherichia coli]
gb|OOD47773.1| ATP synthase subunit B [Escherichia coli]
gb|AQP93660.1| ATP synthase subunit B [Escherichia coli]
gb|OOG28945.1| ATP synthase subunit B [Escherichia coli]
gb|OOH61842.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOH69489.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOH98221.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI13581.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI14676.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI24310.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI28875.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI29703.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI31888.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI41300.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI44666.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI52635.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI52951.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI62065.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI66396.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI69068.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI77391.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI81984.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI88081.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI88123.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOI98524.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ00881.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ07284.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ08480.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ16901.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ23367.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ26712.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ32436.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ35807.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ42385.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ45811.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ51460.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ54674.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ62996.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ65185.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ73104.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ76886.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ80701.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ82504.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ87287.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOJ93993.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK03077.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK05999.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK12564.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK16052.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK22316.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK28177.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK28601.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK33836.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOK55510.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OOM83553.1| ATP synthase subunit B [Escherichia coli]
gb|OON52224.1| ATP synthase subunit B [Escherichia coli]
gb|OON76771.1| ATP synthase subunit B [Escherichia coli]
gb|AQU01531.1| ATP synthase subunit B [Escherichia coli]
gb|AQU94914.1| ATP synthase subunit B [Escherichia coli]
gb|OOO77110.1| ATP synthase subunit B [Shigella boydii]
gb|OOO77148.1| ATP synthase subunit B [Shigella sonnei]
gb|OOO88912.1| ATP synthase subunit B [Shigella dysenteriae]
gb|OOO89434.1| ATP synthase subunit B [Shigella dysenteriae]
gb|OOO97517.1| ATP synthase subunit B [Shigella dysenteriae]
gb|OOP03735.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP10938.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP14847.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP18614.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP19093.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP27715.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP28309.1| ATP synthase subunit B [Shigella flexneri]
gb|OOP35615.1| ATP synthase subunit B [Shigella sonnei]
gb|OOP37911.1| ATP synthase subunit B [Shigella flexneri]
gb|AQV18270.1| ATP synthase subunit B [Escherichia coli]
gb|AQV25719.1| ATP synthase subunit B [Escherichia coli]
gb|AQV29891.1| ATP synthase subunit B [Escherichia coli]
gb|AQV35163.1| ATP synthase subunit B [Escherichia coli]
gb|AQV40104.1| ATP synthase subunit B [Escherichia coli]
gb|AQV46593.1| ATP synthase subunit B [Escherichia coli]
gb|AQV53550.1| ATP synthase subunit B [Escherichia coli]
gb|AQV57051.1| ATP synthase subunit B [Escherichia coli]
gb|AQV64026.1| ATP synthase subunit B [Escherichia coli]
gb|AQV68851.1| ATP synthase subunit B [Escherichia coli]
gb|AQV74196.1| ATP synthase subunit B [Escherichia coli]
gb|AQV81099.1| ATP synthase subunit B [Escherichia coli]
gb|AQV85296.1| ATP synthase subunit B [Escherichia coli]
gb|AQV88222.1| ATP synthase subunit B [Escherichia coli]
gb|AQV99936.1| ATP synthase subunit B [Escherichia coli]
gb|AQW07076.1| ATP synthase subunit B [Escherichia coli]
gb|AQW11791.1| ATP synthase subunit B [Escherichia coli]
gb|AQW19732.1| ATP synthase subunit B [Escherichia coli]
gb|OOV73850.1| ATP synthase subunit B [Escherichia coli]
gb|OOW15949.1| ATP synthase subunit B [Escherichia coli]
gb|OOW18489.1| ATP synthase subunit B [Escherichia coli]
gb|OOW23946.1| ATP synthase subunit B [Escherichia coli]
gb|AQW75439.1| ATP synthase subunit B [Escherichia coli M8]
gb|AQX99026.1| ATP synthase subunit B [Escherichia coli NU14]
gb|OPH58034.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|OPH67584.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|OPH70268.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|OPI30044.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI31650.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI37782.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI45664.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI50337.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI52151.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI63398.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI65271.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI73478.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI73662.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI75736.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI85383.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI88424.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPI90860.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ00764.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ02804.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ05595.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ19618.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ20362.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ20418.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ39863.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ41119.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ43036.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ48752.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OPJ49019.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AQZ28413.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AQZ80106.1| ATP synthase F0F1 subunit B [Escherichia coli]
gb|AQZ84048.1| ATP synthase subunit B [Escherichia coli]
gb|ARA00163.1| ATP synthase subunit B [Escherichia coli]
gb|ARA05512.1| ATP synthase subunit B [Escherichia coli]
gb|ARA17915.1| ATP synthase subunit B [Escherichia coli]
gb|ARA31541.1| ATP synthase subunit B [Escherichia coli]
gb|ARA37041.1| ATP synthase subunit B [Escherichia coli]
gb|ARA66434.1| ATP synthase subunit B [Escherichia coli]
gb|OQK69268.1| ATP synthase subunit B [Shigella sonnei]
gb|ARD53530.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ARD79058.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ARD82925.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ARE49724.1| ATP synthase subunit B [Escherichia coli C]
dbj|BAX13209.1| ATP synthase subunit b [Escherichia coli]
dbj|BAX18370.1| ATP synthase subunit b [Escherichia coli]
dbj|BAX23248.1| ATP synthase subunit b [Escherichia coli]
gb|ORC96601.1| ATP synthase subunit B [Escherichia coli]
gb|ORC97726.1| ATP synthase subunit B [Escherichia coli]
gb|ORD05940.1| ATP synthase subunit B [Escherichia coli]
gb|ORD14945.1| ATP synthase subunit B [Escherichia coli]
gb|ORD16907.1| ATP synthase subunit B [Escherichia coli]
gb|ORD24388.1| ATP synthase subunit B [Escherichia coli]
gb|ORD25140.1| ATP synthase subunit B [Escherichia coli]
gb|ORD36805.1| ATP synthase subunit B [Escherichia coli]
gb|ORD38932.1| ATP synthase subunit B [Escherichia coli]
gb|ORD53569.1| ATP synthase subunit B [Escherichia coli]
gb|ORD60550.1| ATP synthase subunit B [Escherichia coli]
gb|ORD69213.1| ATP synthase subunit B [Escherichia coli]
gb|ORD72998.1| ATP synthase subunit B [Escherichia coli]
gb|ORD85515.1| ATP synthase subunit B [Escherichia coli]
gb|ORD86789.1| ATP synthase subunit B [Escherichia coli]
gb|ORD88763.1| ATP synthase subunit B [Escherichia coli]
gb|ORE77392.1| ATP synthase subunit B [Escherichia coli]
gb|ORE80490.1| ATP synthase subunit B [Escherichia coli]
gb|ARH99399.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|ORJ73996.1| ATP synthase subunit B [Escherichia coli]
gb|ORR78722.1| ATP synthase subunit B [Escherichia coli]
gb|ORR78901.1| ATP synthase subunit B [Escherichia coli]
gb|ORR87552.1| ATP synthase subunit B [Escherichia coli]
gb|ORR90322.1| ATP synthase subunit B [Escherichia coli]
gb|ORR90929.1| ATP synthase subunit B [Escherichia coli]
gb|ORS01798.1| ATP synthase subunit B [Escherichia coli]
gb|ORS02967.1| ATP synthase subunit B [Escherichia coli]
gb|ORS05702.1| ATP synthase subunit B [Escherichia coli]
gb|ORS15118.1| ATP synthase subunit B [Escherichia coli]
gb|ORS17705.1| ATP synthase subunit B [Escherichia coli]
gb|ORS18554.1| ATP synthase subunit B [Escherichia coli]
gb|ORS28685.1| ATP synthase subunit B [Escherichia coli]
gb|ORS30391.1| ATP synthase subunit B [Escherichia coli]
gb|ORS31383.1| ATP synthase subunit B [Escherichia coli]
gb|ORS42932.1| ATP synthase subunit B [Escherichia coli]
gb|ORS49306.1| ATP synthase subunit B [Escherichia coli]
gb|ORS56228.1| ATP synthase subunit B [Escherichia coli]
gb|ORS58657.1| ATP synthase subunit B [Escherichia coli]
gb|ORS64076.1| ATP synthase subunit B [Escherichia coli]
gb|ORS67335.1| ATP synthase subunit B [Escherichia coli]
gb|ORS71124.1| ATP synthase subunit B [Escherichia coli]
gb|ORS72424.1| ATP synthase subunit B [Escherichia coli]
gb|ORS80913.1| ATP synthase subunit B [Escherichia coli]
gb|ORS87142.1| ATP synthase subunit B [Escherichia coli]
gb|ORS87588.1| ATP synthase subunit B [Escherichia coli]
gb|ORS98160.1| ATP synthase subunit B [Escherichia coli]
gb|ORS99102.1| ATP synthase subunit B [Escherichia coli]
gb|ORT02186.1| ATP synthase subunit B [Escherichia coli]
gb|ORT12704.1| ATP synthase subunit B [Escherichia coli]
gb|ORT15708.1| ATP synthase subunit B [Escherichia coli]
gb|ORT15750.1| ATP synthase subunit B [Escherichia coli]
gb|ORT27638.1| ATP synthase subunit B [Escherichia coli]
gb|ORT30664.1| ATP synthase subunit B [Escherichia coli]
gb|ORT37415.1| ATP synthase subunit B [Escherichia coli]
gb|ORT42337.1| ATP synthase subunit B [Escherichia coli]
emb|SMB37543.1| ATP synthase F0 sector subunit b [Escherichia coli]
emb|SMB37544.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|OSB90109.1| ATP synthase subunit B [Escherichia coli]
gb|OSB91674.1| ATP synthase subunit B [Escherichia coli]
gb|OSC09977.1| ATP synthase subunit B [Escherichia coli]
gb|OSC15289.1| ATP synthase subunit B [Escherichia coli]
gb|OSC16465.1| ATP synthase subunit B [Escherichia coli]
emb|SMH27184.1| ATP synthase F0 subcomplex B subunit [Escherichia coli]
gb|ARJ98501.1| ATP synthase subunit B [Escherichia coli]
gb|OSK05171.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli SHECO001]
gb|OSK09049.1| hypothetical protein EAOG_03988 [Escherichia coli R527]
gb|OSK10427.1| ATP synthase F0, B subunit [Escherichia coli FVEC1465]
gb|OSK18854.1| ATP synthase F0, B subunit [Escherichia coli M056]
gb|OSK22431.1| ATP synthase F0, B subunit [Escherichia coli TA144]
gb|OSK24769.1| ATP synthase F0, B subunit [Escherichia coli B574]
gb|OSK34715.1| ATP synthase F0, B subunit [Escherichia coli E267]
gb|OSK36727.1| ATP synthase F0, B subunit [Escherichia coli B671]
gb|OSK39345.1| ATP synthase F0, B subunit [Escherichia coli B108]
gb|OSK48494.1| ATP synthase F0, B subunit [Escherichia coli H588]
gb|OSK50970.1| ATP synthase F0, B subunit [Escherichia coli H413]
gb|OSK59195.1| ATP synthase F0, B subunit [Escherichia coli B921]
gb|OSK60035.1| ATP synthase F0, B subunit [Escherichia coli E560]
gb|OSK61214.1| ATP synthase F0, B subunit [Escherichia coli E1114]
gb|OSK71890.1| ATP synthase F0, B subunit [Escherichia coli H223]
gb|OSK74265.1| ATP synthase F0, B subunit [Escherichia coli H001]
gb|OSK82758.1| ATP synthase F0, B subunit [Escherichia coli H378]
gb|OSK83759.1| ATP synthase F0, B subunit [Escherichia coli B367]
gb|OSK90805.1| ATP synthase F0, B subunit [Escherichia coli TA447]
gb|OSK95840.1| ATP synthase F0, B subunit [Escherichia coli E1002]
gb|OSL02273.1| ATP synthase F0, B subunit [Escherichia coli H386]
gb|OSL03834.1| ATP synthase F0, B subunit [Escherichia coli H296]
gb|OSL09519.1| ATP synthase F0, B subunit [Escherichia coli H305]
gb|OSL16896.1| ATP synthase F0, B subunit [Escherichia coli B175]
gb|OSL22394.1| ATP synthase F0, B subunit [Escherichia coli TA255]
gb|OSL27548.1| ATP synthase F0, B subunit [Escherichia coli H617]
gb|OSL34518.1| ATP synthase F0, B subunit [Escherichia coli TA464]
gb|OSL42031.1| ATP synthase F0, B subunit [Escherichia coli H461]
gb|OSL44198.1| ATP synthase F0, B subunit [Escherichia coli H605]
gb|OSL52235.1| ATP synthase F0, B subunit [Escherichia coli H454]
gb|OSL52376.1| ATP synthase F0, B subunit [Escherichia coli H383]
gb|OSL58684.1| ATP synthase F0, B subunit [Escherichia coli H420]
gb|OSL68237.1| ATP synthase F0, B subunit [Escherichia coli TA008]
gb|OSL68352.1| ATP synthase F0, B subunit [Escherichia coli TA054]
gb|OSL73451.1| ATP synthase F0, B subunit [Escherichia coli TA014]
gb|OSL82356.1| ATP synthase F0, B subunit [Escherichia coli TA249]
gb|OSL85281.1| ATP synthase F0, B subunit [Escherichia coli E704]
gb|OSL85412.1| ATP synthase F0, B subunit [Escherichia coli T426]
gb|OSL96268.1| ATP synthase F0, B subunit [Escherichia coli E1118]
gb|OSL98562.1| ATP synthase F0, B subunit [Escherichia coli R424]
gb|OSM85854.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli SHECO003]
gb|OSM90357.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli SHECO002]
gb|OSP28557.1| ATP synthase subunit B [Escherichia coli]
gb|ARM40864.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OSQ33158.1| ATP synthase subunit B [Escherichia coli]
gb|ARM77613.1| ATP synthase subunit B [Escherichia coli]
gb|OSY85829.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ARQ24043.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTA09714.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTB23778.1| ATP synthase subunit B [Escherichia coli]
gb|OTB25243.1| ATP synthase subunit B [Escherichia coli]
gb|OTB34185.1| ATP synthase subunit B [Escherichia coli]
gb|OTB37961.1| ATP synthase subunit B [Escherichia coli]
gb|OTB44950.1| ATP synthase subunit B [Escherichia coli]
gb|OTB49088.1| ATP synthase subunit B [Escherichia coli]
gb|OTB55290.1| ATP synthase subunit B [Escherichia coli]
gb|OTB58285.1| ATP synthase subunit B [Escherichia coli]
gb|OTB62394.1| ATP synthase subunit B [Escherichia coli]
gb|OTB68031.1| ATP synthase subunit B [Escherichia coli]
gb|OTB78121.1| ATP synthase subunit B [Escherichia coli]
gb|OTB83798.1| ATP synthase subunit B [Escherichia coli]
gb|OTB91331.1| ATP synthase subunit B [Escherichia coli]
gb|OTB94777.1| ATP synthase subunit B [Escherichia coli]
gb|OTC04283.1| ATP synthase subunit B [Escherichia coli]
gb|OTC07443.1| ATP synthase subunit B [Escherichia coli]
gb|OTC10188.1| ATP synthase subunit B [Escherichia coli]
gb|OTC14724.1| ATP synthase subunit B [Escherichia coli]
gb|OTC19455.1| ATP synthase subunit B [Escherichia coli]
gb|OTC26204.1| ATP synthase subunit B [Escherichia coli]
gb|OTC31098.1| ATP synthase subunit B [Escherichia coli]
gb|OTC39104.1| ATP synthase subunit B [Escherichia coli]
gb|OTC43203.1| ATP synthase subunit B [Escherichia coli]
gb|OTC47904.1| ATP synthase subunit B [Escherichia coli]
gb|OTC53329.1| ATP synthase subunit B [Escherichia coli]
gb|OTC58394.1| ATP synthase subunit B [Escherichia coli]
gb|OTC65447.1| ATP synthase subunit B [Escherichia coli]
gb|OTC65490.1| ATP synthase subunit B [Escherichia coli]
gb|OTC73698.1| ATP synthase subunit B [Escherichia coli]
gb|OTC79089.1| ATP synthase subunit B [Escherichia coli]
gb|OTC84029.1| ATP synthase subunit B [Escherichia coli]
gb|OTC87721.1| ATP synthase subunit B [Escherichia coli]
gb|OTC99133.1| ATP synthase subunit B [Escherichia coli]
gb|OTD02270.1| ATP synthase subunit B [Escherichia coli]
gb|OTD12594.1| ATP synthase subunit B [Escherichia coli]
gb|OTD15810.1| ATP synthase subunit B [Escherichia coli]
gb|OTD18151.1| ATP synthase subunit B [Escherichia coli]
gb|OTD19948.1| ATP synthase subunit B [Escherichia coli]
gb|OTD31008.1| ATP synthase subunit B [Escherichia coli]
gb|OTD37053.1| ATP synthase subunit B [Escherichia coli]
gb|OTD40702.1| ATP synthase subunit B [Escherichia coli]
gb|OTD49849.1| ATP synthase subunit B [Escherichia coli]
gb|OTD53954.1| ATP synthase subunit B [Escherichia coli]
gb|OTD55138.1| ATP synthase subunit B [Escherichia coli]
gb|OTD61603.1| ATP synthase subunit B [Escherichia coli]
gb|OTD73351.1| ATP synthase subunit B [Escherichia coli]
gb|OTD81370.1| ATP synthase subunit B [Escherichia coli]
gb|OTD84335.1| ATP synthase subunit B [Escherichia coli]
gb|OTD93119.1| ATP synthase subunit B [Escherichia coli]
gb|OTD93356.1| ATP synthase subunit B [Escherichia coli]
gb|OTD95527.1| ATP synthase subunit B [Escherichia coli]
gb|OTE05002.1| ATP synthase subunit B [Escherichia coli]
gb|OTE05339.1| ATP synthase subunit B [Escherichia coli]
gb|OTE20314.1| ATP synthase subunit B [Escherichia coli]
gb|OTE21198.1| ATP synthase subunit B [Escherichia coli]
gb|OTE22631.1| ATP synthase subunit B [Escherichia coli]
gb|OTE29228.1| ATP synthase subunit B [Escherichia coli]
gb|OTE36685.1| ATP synthase subunit B [Escherichia coli]
gb|OTE45450.1| ATP synthase subunit B [Escherichia coli]
gb|OTE51823.1| ATP synthase subunit B [Escherichia coli]
gb|OTE54956.1| ATP synthase subunit B [Escherichia coli]
gb|OTE57254.1| ATP synthase subunit B [Escherichia coli]
gb|OTE64972.1| ATP synthase subunit B [Escherichia coli]
gb|OTE71049.1| ATP synthase subunit B [Escherichia coli]
gb|OTE73661.1| ATP synthase subunit B [Escherichia coli]
gb|OTE79496.1| ATP synthase subunit B [Escherichia coli]
gb|OTE85903.1| ATP synthase subunit B [Escherichia coli]
gb|OTE89633.1| ATP synthase subunit B [Escherichia coli]
gb|ARR32922.1| ATP synthase subunit B [Escherichia coli]
gb|ARR41279.1| ATP synthase subunit B [Shigella sonnei]
gb|ARR58467.1| ATP synthase subunit B [Escherichia coli]
gb|ARR66218.1| ATP synthase subunit B [Escherichia coli]
gb|OTU99381.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV08230.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV08343.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV16199.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV18393.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV19798.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV39377.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTV51593.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OUD16970.1| ATP synthase subunit B [Escherichia coli M4]
gb|ARS05914.1| ATP synthase subunit B [Shigella sonnei]
gb|OUF52961.1| ATP synthase subunit B [Escherichia coli]
gb|OUF64890.1| ATP synthase subunit B [Escherichia coli]
gb|OUF68146.1| ATP synthase subunit B [Escherichia coli]
gb|OUF71180.1| ATP synthase subunit B [Escherichia coli]
gb|OUF79195.1| ATP synthase subunit B [Escherichia coli]
gb|OUF81718.1| ATP synthase subunit B [Escherichia coli]
gb|OUF86108.1| ATP synthase subunit B [Escherichia coli]
gb|OUF94317.1| ATP synthase subunit B [Escherichia coli]
gb|OUF95868.1| ATP synthase subunit B [Escherichia coli]
gb|OUF98787.1| ATP synthase subunit B [Escherichia coli]
gb|OUG05675.1| ATP synthase subunit B [Escherichia coli]
gb|OUG12217.1| ATP synthase subunit B [Escherichia coli]
gb|OUG14527.1| ATP synthase subunit B [Escherichia coli]
gb|OUG20914.1| ATP synthase subunit B [Escherichia coli]
gb|OUG23947.1| ATP synthase subunit B [Escherichia coli]
gb|OUG32522.1| ATP synthase subunit B [Escherichia coli]
gb|OUG34051.1| ATP synthase subunit B [Escherichia coli]
gb|OUJ63900.1| ATP synthase subunit B [Escherichia coli]
gb|OUJ69155.1| ATP synthase subunit B [Escherichia coli]
gb|OUJ78899.1| ATP synthase subunit B [Shigella flexneri]
gb|OUJ89031.1| ATP synthase subunit B [Escherichia coli]
gb|OUK48191.1| ATP synthase subunit B [Escherichia coli]
gb|OUK49612.1| ATP synthase subunit B [Escherichia coli]
gb|OUK62760.1| ATP synthase subunit B [Escherichia coli]
gb|OUK88350.1| ATP synthase subunit B [Escherichia coli]
gb|OUK90474.1| ATP synthase subunit B [Escherichia coli]
gb|OUK90831.1| ATP synthase subunit B [Escherichia coli]
gb|OUL12743.1| ATP synthase subunit B [Escherichia coli]
gb|ART19114.1| ATP synthase subunit b [Escherichia coli]
gb|ART26894.1| ATP synthase subunit b [Escherichia coli]
gb|ART41891.1| ATP synthase F0 complex - b subunit [Escherichia coli]
gb|OUP41519.1| ATP synthase subunit B [Escherichia coli]
gb|OUR46330.1| ATP synthase subunit B [Escherichia coli]
gb|OUR49514.1| ATP synthase subunit B [Escherichia coli]
gb|OUR52127.1| ATP synthase subunit B [Escherichia coli]
gb|ARV29836.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ARV34685.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ARV49045.1| ATP synthase subunit B [Escherichia coli]
gb|ARV55561.1| ATP synthase subunit B [Escherichia coli]
gb|OUZ52914.1| ATP synthase subunit B [Shigella flexneri]
gb|OUZ60326.1| ATP synthase subunit B [Shigella sonnei]
gb|OUZ75804.1| ATP synthase subunit B [Shigella flexneri]
gb|OUZ81603.1| ATP synthase subunit B [Shigella flexneri]
gb|OUZ86537.1| ATP synthase subunit B [Shigella flexneri]
gb|OUZ94119.1| ATP synthase subunit B [Shigella sonnei]
gb|OUZ97756.1| ATP synthase subunit B [Shigella sonnei]
gb|OVA37832.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA42694.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA43209.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA56317.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA59299.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA59420.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA71003.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA76655.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA81095.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA86129.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVA91046.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB00350.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB04057.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB07576.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB12498.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB21979.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB24190.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB28080.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB37034.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB41872.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB42060.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB54830.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB57265.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB63944.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB72165.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB74493.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB75550.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB86288.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB90752.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVB91890.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC02581.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC10861.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC15140.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC15184.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC19673.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC27508.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC34236.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC41378.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC41775.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC52912.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC53060.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC57736.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC66235.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC71372.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC72172.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC81590.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC86394.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVC92318.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD00824.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD05865.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD12332.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD14160.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD24917.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD25691.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD30678.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD31600.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD42417.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD47979.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD49692.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD61953.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD64574.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD68157.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD77386.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD81017.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD82518.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVD93207.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVE01237.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVE02916.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVE10425.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVE27047.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OVE27302.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ARW85716.1| ATP synthase subunit B [Escherichia coli]
gb|ARW90529.1| ATP synthase subunit B [Escherichia coli]
gb|ARX16437.1| ATP synthase subunit B [Escherichia coli]
gb|ARX23821.1| ATP synthase subunit B [Escherichia coli]
gb|ARX28291.1| ATP synthase subunit B [Escherichia coli]
gb|ARX54343.1| ATP synthase subunit B [Escherichia coli]
gb|OVG05073.1| ATP synthase subunit B [Escherichia coli]
gb|OVG47254.1| ATP synthase subunit B [Escherichia coli]
gb|OVJ48056.1| ATP synthase subunit B [Escherichia coli]
gb|OWB87091.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWB87673.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWB92942.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC00370.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC10647.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC16553.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC19069.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC22086.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC26606.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC37749.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC38382.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC40149.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC49595.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC52042.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC60951.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC63837.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC70615.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC72904.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC73374.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC76819.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC88856.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC90435.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWC93347.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD02032.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD02069.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD02685.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD08645.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD14823.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD19370.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD19899.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD26323.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD33253.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD38089.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD47305.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD49303.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD50963.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD52645.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD61514.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD74713.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD76805.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD76957.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD79391.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD85010.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD86530.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWD99424.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE00799.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE02209.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE05516.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE11356.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE14663.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE25584.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE29778.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE31408.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE37240.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE43259.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE51327.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE53503.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE63249.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE65989.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE68680.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE75480.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE81418.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE87723.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE88840.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWE93423.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF01045.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF04811.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF10594.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF11330.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF18526.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF24292.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OWF27330.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ARZ83917.1| ATP synthase subunit B [Escherichia coli]
gb|ARZ88058.1| ATP synthase subunit B [Escherichia coli]
gb|ASA45168.1| ATP synthase subunit B [Escherichia coli]
gb|OWG43291.1| ATP synthase subunit B [Escherichia coli]
gb|OWG48076.1| ATP synthase subunit B [Escherichia coli]
gb|OWG48665.1| ATP synthase subunit B [Escherichia coli]
gb|OWG57430.1| ATP synthase subunit B [Escherichia coli]
gb|OWG61932.1| ATP synthase subunit B [Escherichia coli]
gb|OWG63805.1| ATP synthase subunit B [Escherichia coli]
gb|OWG72211.1| ATP synthase subunit B [Escherichia coli]
gb|OWG72571.1| ATP synthase subunit B [Escherichia coli]
gb|OWG76906.1| ATP synthase subunit B [Escherichia coli]
gb|OWG88211.1| ATP synthase subunit B [Escherichia coli]
gb|OWG88917.1| ATP synthase subunit B [Escherichia coli]
gb|OWG96229.1| ATP synthase subunit B [Escherichia coli]
gb|OWG99809.1| ATP synthase subunit B [Escherichia coli]
gb|OWH01270.1| ATP synthase subunit B [Escherichia coli]
gb|OWH09583.1| ATP synthase subunit B [Escherichia coli]
gb|OWH10339.1| ATP synthase subunit B [Escherichia coli]
gb|OWH16894.1| ATP synthase subunit B [Escherichia coli]
gb|OWH23369.1| ATP synthase subunit B [Escherichia coli]
gb|ASA59735.1| ATP synthase subunit B [Escherichia coli]
gb|ASA68183.1| ATP synthase subunit B [Escherichia coli]
gb|ASB78151.1| ATP synthase subunit B [Escherichia coli]
gb|ASC16927.1| ATP synthase subunit B [Escherichia coli]
gb|OWP97272.1| ATP synthase subunit B [Escherichia coli]
gb|OWR17830.1| ATP synthase subunit B [Shigella boydii]
gb|OWS78181.1| ATP synthase subunit B [Escherichia coli]
gb|OWS83972.1| ATP synthase subunit B [Escherichia coli]
gb|ASE47917.1| ATP synthase subunit B [Escherichia coli O157]
gb|ASF04661.1| ATP synthase subunit B [Escherichia coli O104:H4]
gb|ASG52105.1| ATP synthase subunit B [Escherichia coli]
gb|OWW49140.1| ATP synthase subunit B [Escherichia coli]
gb|OWW55846.1| ATP synthase subunit B [Escherichia coli]
gb|OWX79457.1| ATP synthase subunit B [Escherichia coli]
gb|OWX80050.1| ATP synthase subunit B [Escherichia coli]
gb|OWX89532.1| ATP synthase subunit B [Escherichia coli]
gb|OWY54883.1| ATP synthase subunit B [Escherichia coli]
gb|ASI18746.1| ATP synthase subunit B [Escherichia coli]
gb|ASI53581.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|ASJ28522.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ASJ36110.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ASJ45614.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OXB29926.1| ATP synthase subunit b [Shigella flexneri 2a str. 301]
gb|ASL29583.1| ATP synthase subunit B [Escherichia coli]
gb|ASL62315.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|OXJ43783.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ51073.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ52933.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ55821.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ67361.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ70068.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ72108.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ78083.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ85692.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ90394.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ96060.1| ATP synthase subunit B [Escherichia coli]
gb|OXJ97383.1| ATP synthase subunit B [Escherichia coli]
gb|OXK06461.1| ATP synthase subunit B [Escherichia coli]
gb|OXK10798.1| ATP synthase subunit B [Escherichia coli]
gb|OXK18342.1| ATP synthase subunit B [Escherichia coli]
gb|OXK18723.1| ATP synthase subunit B [Escherichia coli]
gb|OXK24928.1| ATP synthase subunit B [Escherichia coli]
gb|OXK26813.1| ATP synthase subunit B [Escherichia coli]
gb|OXK34413.1| ATP synthase subunit B [Escherichia coli]
gb|OXK41048.1| ATP synthase subunit B [Escherichia coli]
gb|OXK44958.1| ATP synthase subunit B [Escherichia coli]
gb|OXK52799.1| ATP synthase subunit B [Escherichia coli]
gb|OXK58117.1| ATP synthase subunit B [Escherichia coli]
gb|OXK64068.1| ATP synthase subunit B [Escherichia coli]
gb|OXK70825.1| ATP synthase subunit B [Escherichia coli]
gb|OXK75667.1| ATP synthase subunit B [Escherichia coli]
gb|OXK78464.1| ATP synthase subunit B [Escherichia coli]
gb|OXK83367.1| ATP synthase subunit B [Escherichia coli]
gb|OXK85124.1| ATP synthase subunit B [Escherichia coli]
gb|OXK95246.1| ATP synthase subunit B [Escherichia coli]
gb|OXL02149.1| ATP synthase subunit B [Escherichia coli]
gb|ASN31813.1| ATP synthase subunit B [Shigella sonnei]
gb|ASN35878.1| ATP synthase subunit B [Shigella sonnei]
gb|ASN42331.1| ATP synthase subunit B [Shigella sonnei]
gb|OXL48515.1| ATP synthase subunit B [Escherichia coli]
gb|OXL51866.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OXL59980.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OXL61284.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OXL72695.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OXL74004.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OXL80743.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|ASO02841.1| ATP synthase subunit B [Escherichia coli]
gb|ASO81595.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ASO85658.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ASO90448.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|ASO95212.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OXU86454.1| ATP synthase subunit B [Escherichia coli]
gb|OXU91189.1| ATP synthase subunit B [Escherichia coli]
gb|ASQ55224.1| ATP synthase subunit B [Shigella flexneri 4c]
gb|ASQ59034.1| ATP synthase subunit B [Shigella flexneri 4c]
gb|ASQ61800.1| ATP synthase subunit B [Shigella flexneri 1a]
gb|ASQ69375.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli NCCP15648]
gb|ASQ80129.1| ATP synthase subunit B [Shigella flexneri 1a]
gb|OXV19813.1| ATP synthase subunit B [Escherichia coli]
gb|OXV20581.1| ATP synthase subunit B [Escherichia coli]
gb|OXV30294.1| ATP synthase subunit B [Escherichia coli]
gb|OXV41802.1| ATP synthase subunit B [Escherichia coli]
gb|OXV41946.1| ATP synthase subunit B [Escherichia coli]
gb|OXW57181.1| ATP synthase subunit B [Shigella flexneri]
gb|OXW63115.1| ATP synthase subunit B [Shigella flexneri]
gb|OXW67030.1| ATP synthase subunit B [Shigella sonnei]
gb|OXW76460.1| ATP synthase subunit B [Shigella flexneri]
gb|OXX08864.1| ATP synthase subunit B [Shigella sonnei]
gb|OXZ48831.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ52850.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ52943.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ63952.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ73158.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ74038.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ75542.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ81879.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ82271.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ88934.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ95337.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ95570.1| ATP synthase subunit B [Escherichia coli]
gb|OXZ95794.1| ATP synthase subunit B [Escherichia coli]
gb|OYA10984.1| ATP synthase subunit B [Escherichia coli]
gb|OYA14207.1| ATP synthase subunit B [Escherichia coli]
gb|OYA14412.1| ATP synthase subunit B [Escherichia coli]
gb|OYA23934.1| ATP synthase subunit B [Escherichia coli]
gb|OYA32033.1| ATP synthase subunit B [Escherichia coli]
gb|OYA32532.1| ATP synthase subunit B [Escherichia coli]
gb|OYA38208.1| ATP synthase subunit B [Escherichia coli]
gb|OYA40640.1| ATP synthase subunit B [Escherichia coli]
gb|OYA44224.1| ATP synthase subunit B [Escherichia coli]
gb|OYA52913.1| ATP synthase subunit B [Escherichia coli]
gb|OYA53859.1| ATP synthase subunit B [Escherichia coli]
gb|OYA54675.1| ATP synthase subunit B [Escherichia coli]
gb|OYA65956.1| ATP synthase subunit B [Escherichia coli]
gb|OYA74820.1| ATP synthase subunit B [Escherichia coli]
gb|OYA76524.1| ATP synthase subunit B [Escherichia coli]
gb|OYA80780.1| ATP synthase subunit B [Escherichia coli]
gb|OYA83339.1| ATP synthase subunit B [Escherichia coli]
gb|OYA91863.1| ATP synthase subunit B [Escherichia coli]
gb|OYA98921.1| ATP synthase subunit B [Escherichia coli]
gb|OYA99544.1| ATP synthase subunit B [Escherichia coli]
gb|OYB01851.1| ATP synthase subunit B [Escherichia coli]
gb|OYB06387.1| ATP synthase subunit B [Escherichia coli]
gb|OYB12772.1| ATP synthase subunit B [Escherichia coli]
gb|OYB18644.1| ATP synthase subunit B [Escherichia coli]
gb|OYB19778.1| ATP synthase subunit B [Escherichia coli]
gb|OYB29712.1| ATP synthase subunit B [Escherichia coli]
gb|OYB34352.1| ATP synthase subunit B [Escherichia coli]
gb|OYB35369.1| ATP synthase subunit B [Escherichia coli]
gb|OYB38237.1| ATP synthase subunit B [Escherichia coli]
gb|OYB48379.1| ATP synthase subunit B [Escherichia coli]
gb|OYB49983.1| ATP synthase subunit B [Escherichia coli]
gb|OYB50537.1| ATP synthase subunit B [Escherichia coli]
gb|OYB62761.1| ATP synthase subunit B [Escherichia coli]
gb|OYB67022.1| ATP synthase subunit B [Escherichia coli]
gb|OYB69907.1| ATP synthase subunit B [Escherichia coli]
gb|OYB74873.1| ATP synthase subunit B [Escherichia coli]
gb|OYB76181.1| ATP synthase subunit B [Escherichia coli]
gb|OYB83271.1| ATP synthase subunit B [Escherichia coli]
gb|OYB88981.1| ATP synthase subunit B [Escherichia coli]
gb|OYB92418.1| ATP synthase subunit B [Escherichia coli]
gb|OYC03824.1| ATP synthase subunit B [Escherichia coli]
gb|OYC04118.1| ATP synthase subunit B [Escherichia coli]
gb|OYC05410.1| ATP synthase subunit B [Escherichia coli]
gb|OYC10454.1| ATP synthase subunit B [Escherichia coli]
gb|OYC18790.1| ATP synthase subunit B [Escherichia coli]
gb|OYC21840.1| ATP synthase subunit B [Escherichia coli]
gb|OYC30139.1| ATP synthase subunit B [Escherichia coli]
gb|OYC36198.1| ATP synthase subunit B [Escherichia coli]
gb|OYC45000.1| ATP synthase subunit B [Escherichia coli]
gb|OYC48302.1| ATP synthase subunit B [Escherichia coli]
gb|OYC50941.1| ATP synthase subunit B [Escherichia coli]
gb|OYC55303.1| ATP synthase subunit B [Escherichia coli]
gb|OYC59350.1| ATP synthase subunit B [Escherichia coli]
gb|OYC68071.1| ATP synthase subunit B [Escherichia coli]
gb|OYC74200.1| ATP synthase subunit B [Escherichia coli]
gb|OYC74996.1| ATP synthase subunit B [Escherichia coli]
gb|OYC83656.1| ATP synthase subunit B [Escherichia coli]
gb|OYD30538.1| ATP synthase subunit B [Escherichia coli]
gb|OYE16052.1| ATP synthase subunit B [Shigella sonnei]
gb|OYE25565.1| ATP synthase subunit B [Shigella sonnei]
gb|OYE49817.1| ATP synthase subunit B [Shigella sonnei]
gb|OYE54675.1| ATP synthase subunit B [Shigella sonnei]
gb|OYE77203.1| ATP synthase subunit B [Shigella sonnei]
gb|OYF37689.1| ATP synthase subunit B [Shigella sonnei]
gb|OYF62955.1| ATP synthase subunit B [Shigella sonnei]
gb|OYF70111.1| ATP synthase subunit B [Shigella sonnei]
gb|OYF91188.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG09507.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG59318.1| ATP synthase subunit B [Escherichia coli]
gb|OYG67528.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG73362.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG74741.1| ATP synthase subunit B [Shigella boydii]
gb|OYG79706.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG91633.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG94006.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG97281.1| ATP synthase subunit B [Shigella sonnei]
gb|OYG99641.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI05045.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI14069.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI26689.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI35985.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI38926.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI52329.1| ATP synthase subunit B [Shigella boydii]
gb|OYI52849.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI58919.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI69288.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI70271.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI72690.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI74609.1| ATP synthase subunit B [Shigella boydii]
gb|OYI77706.1| ATP synthase subunit B [Shigella sonnei]
gb|OYI81721.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ14134.1| ATP synthase subunit B [Shigella boydii]
gb|OYJ22187.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ22650.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ30305.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ41960.1| ATP synthase subunit B [Shigella boydii]
gb|OYJ43810.1| ATP synthase subunit B [Shigella boydii]
gb|OYJ51965.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ60549.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ64546.1| ATP synthase subunit B [Escherichia coli]
gb|OYJ75772.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ77225.1| ATP synthase subunit B [Shigella sonnei]
gb|OYJ79095.1| ATP synthase subunit B [Escherichia coli]
gb|OYK23484.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK28512.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK28710.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK37863.1| ATP synthase subunit B [Escherichia coli]
gb|OYK38722.1| ATP synthase subunit B [Escherichia coli]
gb|OYK50466.1| ATP synthase subunit B [Escherichia coli]
gb|OYK50632.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK51460.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK61816.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK64927.1| ATP synthase subunit B [Shigella sonnei]
gb|OYK65520.1| ATP synthase subunit B [Shigella boydii]
gb|OYK70596.1| ATP synthase subunit B [Escherichia coli]
gb|OYL21306.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL27419.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL32195.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL39332.1| ATP synthase subunit B [Escherichia coli]
gb|OYL42201.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL42791.1| ATP synthase subunit B [Shigella boydii]
gb|OYL57040.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL61168.1| ATP synthase subunit B [Shigella sonnei]
gb|OYL73462.1| ATP synthase subunit B [Escherichia coli]
gb|OYL84814.1| ATP synthase subunit B [Shigella sonnei]
gb|OYN23959.1| ATP synthase subunit B [Shigella boydii]
gb|OYN42342.1| ATP synthase subunit B [Escherichia coli]
gb|OYN48489.1| ATP synthase subunit B [Escherichia coli]
gb|OYN68866.1| ATP synthase subunit B [Escherichia coli]
gb|AST63758.1| ATP synthase subunit B [Escherichia coli]
gb|OYQ60474.1| ATP synthase subunit B [Shigella sonnei]
emb|SNW16179.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli]
gb|OZC25326.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OZG35187.1| ATP synthase subunit B [Escherichia coli O157:H7]
gb|OZM86234.1| ATP synthase subunit B [Escherichia coli]
gb|OZM92295.1| ATP synthase subunit B [Escherichia coli]
gb|OZM97934.1| ATP synthase subunit B [Escherichia coli]
gb|OZN01529.1| ATP synthase subunit B [Escherichia coli]
gb|OZN05048.1| ATP synthase subunit B [Escherichia coli]
gb|OZO55113.1| ATP synthase subunit B [Escherichia coli]
gb|OZO58394.1| ATP synthase subunit B [Escherichia coli]
gb|OZO63135.1| ATP synthase subunit B [Escherichia coli]
gb|OZO68456.1| ATP synthase subunit B [Escherichia coli]
gb|OZO73086.1| ATP synthase subunit B [Escherichia coli]
gb|OZO78156.1| ATP synthase subunit B [Escherichia coli]
gb|OZO83305.1| ATP synthase subunit B [Escherichia coli]
gb|OZO88243.1| ATP synthase subunit B [Escherichia coli]
gb|OZO93044.1| ATP synthase subunit B [Escherichia coli]
gb|OZP02439.1| ATP synthase subunit B [Escherichia coli]
gb|OZP06189.1| ATP synthase subunit B [Escherichia coli]
gb|OZP12527.1| ATP synthase subunit B [Escherichia coli]
gb|OZP17654.1| ATP synthase subunit B [Escherichia coli]
gb|OZP22531.1| ATP synthase subunit B [Escherichia coli]
gb|OZP26464.1| ATP synthase subunit B [Escherichia coli]
gb|OZP32206.1| ATP synthase subunit B [Escherichia coli]
gb|OZR91007.1| ATP synthase subunit B [Escherichia coli]
gb|OZS00963.1| ATP synthase subunit B [Escherichia coli]
gb|OZS05884.1| ATP synthase subunit B [Escherichia coli]
gb|OZS11018.1| ATP synthase subunit B [Escherichia coli]
gb|OZX62168.1| ATP synthase subunit B [Escherichia coli]
gb|OZX68503.1| ATP synthase subunit B [Escherichia coli]
gb|OZX72161.1| ATP synthase subunit B [Escherichia coli]
gb|OZX78230.1| ATP synthase subunit B [Escherichia coli]
gb|OZX85577.1| ATP synthase subunit B [Escherichia coli]
gb|OZX89054.1| ATP synthase subunit B [Escherichia coli]
gb|OZX92369.1| ATP synthase subunit B [Escherichia coli]
gb|OZX99747.1| ATP synthase subunit B [Escherichia coli]
gb|OZY02901.1| ATP synthase subunit B [Escherichia coli]
gb|OZY07012.1| ATP synthase subunit B [Escherichia coli]
gb|OZY13355.1| ATP synthase subunit B [Escherichia coli]
gb|OZY19683.1| ATP synthase subunit B [Escherichia coli]
gb|OZY20586.1| ATP synthase subunit B [Escherichia coli]
gb|PAB63669.1| ATP synthase subunit B [Escherichia coli]
gb|PAB78200.1| ATP synthase subunit B [Escherichia coli]
gb|PAB84817.1| ATP synthase subunit B [Escherichia coli]
gb|PAB85332.1| ATP synthase subunit B [Escherichia coli]
gb|PAB96725.1| ATP synthase subunit B [Escherichia coli]
gb|PAB97148.1| ATP synthase subunit B [Escherichia coli]
gb|PAC01757.1| ATP synthase subunit B [Escherichia coli]
gb|PAC16759.1| ATP synthase subunit B [Escherichia coli]
gb|PAL30106.1| ATP synthase subunit B [Escherichia coli]
gb|PAL30499.1| ATP synthase subunit B [Escherichia coli]
gb|PAL38746.1| ATP synthase subunit B [Escherichia coli]
gb|PAL42999.1| ATP synthase subunit B [Escherichia coli]
gb|PAL46173.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ19745.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ23114.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ28481.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ33288.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ36199.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ46627.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ48064.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ54172.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ55695.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ60103.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ73323.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ76772.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ85083.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ85206.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ92116.1| ATP synthase subunit B [Escherichia coli]
gb|PAQ96301.1| ATP synthase subunit B [Escherichia coli]
gb|PAR06582.1| ATP synthase subunit B [Escherichia coli]
gb|PAS47764.1| ATP synthase subunit B [Escherichia coli]
gb|PAS49172.1| ATP synthase subunit B [Escherichia coli]
gb|PAS51819.1| ATP synthase subunit B [Escherichia coli]
gb|PAS60294.1| ATP synthase subunit B [Escherichia coli]
gb|PAS66617.1| ATP synthase subunit B [Escherichia coli]
gb|PAS72136.1| ATP synthase subunit B [Escherichia coli]
gb|PAS76691.1| ATP synthase subunit B [Escherichia coli]
gb|PAS77916.1| ATP synthase subunit B [Escherichia coli]
gb|PAS83278.1| ATP synthase subunit B [Escherichia coli]
emb|CTP94121.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|ASW62023.1| ATP synthase F0 complex - b subunit [Escherichia coli]
gb|ASX08619.1| ATP synthase subunit B [Escherichia coli]
gb|PAT80610.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAT82171.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAT91477.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAT96071.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU00118.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU01865.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU09537.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU12613.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU19708.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU28887.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAU30621.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PAX41492.1| ATP synthase subunit B [Escherichia coli]
gb|PAX47858.1| ATP synthase subunit B [Escherichia coli]
gb|PAX53946.1| ATP synthase subunit B [Escherichia coli]
gb|ASZ43720.1| ATP synthase subunit B [Escherichia coli]
gb|ASZ48203.1| ATP synthase subunit B [Escherichia coli]
gb|PAY69928.1| ATP synthase subunit B [Shigella boydii]
gb|PAY79531.1| ATP synthase subunit B [Shigella flexneri]
gb|PAY79599.1| ATP synthase subunit B [Shigella flexneri]
gb|PAY81696.1| ATP synthase subunit B [Shigella flexneri]
gb|PAY89202.1| ATP synthase subunit B [Shigella boydii]
gb|PAY92106.1| ATP synthase subunit B [Shigella flexneri]
gb|PAY98358.1| ATP synthase subunit B [Shigella boydii]
gb|PAZ22899.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ32088.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ41599.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ42751.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ46442.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ50044.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ54261.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ60076.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ64389.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ68427.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ77892.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ82268.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ84024.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ92686.1| ATP synthase subunit B [Escherichia coli]
gb|PAZ97509.1| ATP synthase subunit B [Escherichia coli]
gb|ATB10714.1| ATP synthase subunit B [Escherichia coli]
gb|ATB15910.1| ATP synthase subunit B [Escherichia coli]
gb|PBK10761.1| ATP synthase subunit B [Escherichia coli]
gb|PBK13366.1| ATP synthase subunit B [Escherichia coli]
gb|PBK19039.1| ATP synthase subunit B [Escherichia coli]
gb|PBK22549.1| ATP synthase subunit B [Escherichia coli]
gb|PBK29597.1| ATP synthase subunit B [Escherichia coli]
gb|PBK34817.1| ATP synthase subunit B [Escherichia coli]
gb|PBK38528.1| ATP synthase subunit B [Escherichia coli]
gb|PBK45750.1| ATP synthase subunit B [Escherichia coli]
gb|ATB70984.1| ATP synthase subunit B [Escherichia coli]
gb|ATB76055.1| ATP synthase subunit B [Escherichia coli]
gb|ATB80910.1| ATP synthase subunit B [Escherichia coli]
gb|ATB85879.1| ATP synthase subunit B [Escherichia coli]
gb|ATB90817.1| ATP synthase subunit B [Escherichia coli]
gb|ATB95958.1| ATP synthase subunit B [Escherichia coli]
gb|ATC00658.1| ATP synthase subunit B [Escherichia coli]
gb|ATC09881.1| ATP synthase subunit B [Escherichia coli]
gb|ATC10330.1| ATP synthase subunit B [Escherichia coli]
gb|PBN55817.1| ATP synthase subunit B [Escherichia coli]
gb|PBN57164.1| ATP synthase subunit B [Escherichia coli]
gb|PBN62079.1| ATP synthase subunit B [Escherichia coli]
gb|PBN67996.1| ATP synthase subunit B [Escherichia coli]
gb|PBN71737.1| ATP synthase subunit B [Escherichia coli]
gb|PBN85358.1| ATP synthase subunit B [Escherichia coli]
gb|PBN86130.1| ATP synthase subunit B [Escherichia coli]
gb|PBN91847.1| ATP synthase subunit B [Escherichia coli]
gb|PBO09638.1| ATP synthase subunit B [Shigella sonnei]
gb|PBO45677.1| ATP synthase subunit B [Escherichia coli]
gb|PBO45761.1| ATP synthase subunit B [Escherichia coli]
gb|PBO47104.1| ATP synthase subunit B [Escherichia coli]
gb|PBO57180.1| ATP synthase subunit B [Escherichia coli]
gb|PBO57502.1| ATP synthase subunit B [Escherichia coli]
gb|PBO66793.1| ATP synthase subunit B [Escherichia coli]
gb|PBO72214.1| ATP synthase subunit B [Escherichia coli]
gb|PBO73821.1| ATP synthase subunit B [Escherichia coli]
gb|PBO94596.1| ATP synthase subunit B [Shigella sonnei]
gb|PBP04849.1| ATP synthase subunit B [Escherichia coli]
gb|PBP05413.1| ATP synthase subunit B [Shigella sonnei]
gb|PBP05844.1| ATP synthase subunit B [Shigella sonnei]
gb|PBQ36920.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ40801.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ45663.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ51124.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ56498.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ62497.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ65972.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ71323.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ77411.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ83200.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ87949.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ91528.1| ATP synthase subunit B [Escherichia coli]
gb|PBQ96724.1| ATP synthase subunit B [Escherichia coli]
gb|PBR04609.1| ATP synthase subunit B [Escherichia coli]
gb|PBR09799.1| ATP synthase subunit B [Escherichia coli]
gb|PBR18838.1| ATP synthase subunit B [Escherichia coli]
gb|PBR21292.1| ATP synthase subunit B [Escherichia coli]
gb|PBR25132.1| ATP synthase subunit B [Escherichia coli]
gb|PBR30615.1| ATP synthase subunit B [Escherichia coli]
gb|PBR33988.1| ATP synthase subunit B [Escherichia coli]
gb|PBR40170.1| ATP synthase subunit B [Escherichia coli]
gb|PBR45262.1| ATP synthase subunit B [Escherichia coli]
gb|PBR53286.1| ATP synthase subunit B [Escherichia coli]
gb|PBR57165.1| ATP synthase subunit B [Escherichia coli]
gb|PBR60042.1| ATP synthase subunit B [Escherichia coli]
gb|PBR65222.1| ATP synthase subunit B [Escherichia coli]
gb|PBR72467.1| ATP synthase subunit B [Escherichia coli]
gb|PBR76812.1| ATP synthase subunit B [Escherichia coli]
gb|PBR82984.1| ATP synthase subunit B [Escherichia coli]
gb|PBR88647.1| ATP synthase subunit B [Escherichia coli]
gb|PBR92185.1| ATP synthase subunit B [Escherichia coli]
gb|PBR98263.1| ATP synthase subunit B [Escherichia coli]
gb|PBS01369.1| ATP synthase subunit B [Escherichia coli]
gb|PBS08238.1| ATP synthase subunit B [Escherichia coli]
gb|PBS21629.1| ATP synthase subunit B [Escherichia coli]
gb|PBS26557.1| ATP synthase subunit B [Escherichia coli]
gb|PBS31430.1| ATP synthase subunit B [Escherichia coli]
gb|PBS37648.1| ATP synthase subunit B [Escherichia coli]
gb|PBS42769.1| ATP synthase subunit B [Escherichia coli]
gb|PBS49673.1| ATP synthase subunit B [Escherichia coli]
gb|PBS51709.1| ATP synthase subunit B [Escherichia coli]
gb|PBS55862.1| ATP synthase subunit B [Escherichia coli]
gb|PBS60496.1| ATP synthase subunit B [Escherichia coli]
gb|PBS66467.1| ATP synthase subunit B [Escherichia coli]
gb|PBS72434.1| ATP synthase subunit B [Escherichia coli]
gb|PBS78364.1| ATP synthase subunit B [Escherichia coli]
gb|PBS80059.1| ATP synthase subunit B [Escherichia coli]
gb|PBS84055.1| ATP synthase subunit B [Escherichia coli]
gb|PBS89296.1| ATP synthase subunit B [Escherichia coli]
gb|PBS97297.1| ATP synthase subunit B [Escherichia coli]
gb|PBS99154.1| ATP synthase subunit B [Escherichia coli]
gb|PBT07332.1| ATP synthase subunit B [Escherichia coli]
gb|PBT12116.1| ATP synthase subunit B [Escherichia coli]
gb|PBT14368.1| ATP synthase subunit B [Escherichia coli]
gb|PBT18614.1| ATP synthase subunit B [Escherichia coli]
gb|PBT27078.1| ATP synthase subunit B [Escherichia coli]
gb|PBT28148.1| ATP synthase subunit B [Escherichia coli]
gb|PBT36326.1| ATP synthase subunit B [Escherichia coli]
gb|PBT38660.1| ATP synthase subunit B [Escherichia coli]
gb|PBT39571.1| ATP synthase subunit B [Escherichia coli]
gb|PBT47130.1| ATP synthase subunit B [Escherichia coli]
gb|PBT53665.1| ATP synthase subunit B [Escherichia coli]
gb|PBT54982.1| ATP synthase subunit B [Escherichia coli]
gb|PBT60950.1| ATP synthase subunit B [Escherichia coli]
gb|PBT66155.1| ATP synthase subunit B [Escherichia coli]
gb|PBT72971.1| ATP synthase subunit B [Escherichia coli]
gb|PBT79408.1| ATP synthase subunit B [Escherichia coli]
gb|PBT80226.1| ATP synthase subunit B [Escherichia coli]
gb|PBT87013.1| ATP synthase subunit B [Escherichia coli]
gb|PBT89037.1| ATP synthase subunit B [Escherichia coli]
gb|PBT94381.1| ATP synthase subunit B [Escherichia coli]
gb|PBT98150.1| ATP synthase subunit B [Escherichia coli]
gb|PBU03032.1| ATP synthase subunit B [Escherichia coli]
gb|PBU08289.1| ATP synthase subunit B [Escherichia coli]
gb|PBU11414.1| ATP synthase subunit B [Escherichia coli]
gb|PBU18581.1| ATP synthase subunit B [Escherichia coli]
gb|PBU22393.1| ATP synthase subunit B [Escherichia coli]
gb|PBU27119.1| ATP synthase subunit B [Escherichia coli]
gb|PBU31968.1| ATP synthase subunit B [Escherichia coli]
gb|PBU37306.1| ATP synthase subunit B [Escherichia coli]
gb|PBU42636.1| ATP synthase subunit B [Escherichia coli]
gb|PBU47492.1| ATP synthase subunit B [Escherichia coli]
gb|PBU51945.1| ATP synthase subunit B [Escherichia coli]
gb|PBU56560.1| ATP synthase subunit B [Escherichia coli]
gb|PBU61739.1| ATP synthase subunit B [Escherichia coli]
gb|PBU69092.1| ATP synthase subunit B [Escherichia coli]
gb|PBU75580.1| ATP synthase subunit B [Escherichia coli]
gb|PBU79508.1| ATP synthase subunit B [Escherichia coli]
gb|PBU86491.1| ATP synthase subunit B [Escherichia coli]
gb|PBU88007.1| ATP synthase subunit B [Escherichia coli]
gb|PBU91379.1| ATP synthase subunit B [Escherichia coli]
gb|PCD48207.1| ATP synthase subunit B [Escherichia coli]
gb|PCD55534.1| ATP synthase subunit B [Escherichia coli]
gb|PCD75223.1| ATP synthase subunit B [Escherichia coli]
gb|PCG23519.1| ATP synthase subunit B [Escherichia coli]
gb|PCG28180.1| ATP synthase subunit B [Escherichia coli]
gb|PCG34064.1| ATP synthase subunit B [Escherichia coli]
gb|PCG39629.1| ATP synthase subunit B [Escherichia coli]
gb|PCG44236.1| ATP synthase subunit B [Escherichia coli]
gb|PCG48480.1| ATP synthase subunit B [Escherichia coli]
gb|PCG53894.1| ATP synthase subunit B [Escherichia coli]
gb|ATG08222.1| ATP synthase subunit B [Escherichia coli]
gb|ATG12638.1| ATP synthase subunit B [Escherichia coli]
gb|ATG59796.1| ATP synthase subunit B [Escherichia coli O104:H21 str. CFSAN002236]
gb|PCM07539.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM08429.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM16458.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM20969.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM24134.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM33163.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PCM35932.1| ATP synthase subunit B [Escherichia coli]
gb|PCO24550.1| ATP synthase subunit B [Escherichia coli]
gb|PCO32137.1| ATP synthase subunit B [Escherichia coli]
gb|PCO55032.1| ATP synthase subunit B [Escherichia coli]
gb|PCO62109.1| ATP synthase subunit B [Escherichia coli]
gb|PCO75942.1| ATP synthase subunit B [Escherichia coli]
gb|PCO80967.1| ATP synthase subunit B [Escherichia coli]
gb|PCO89081.1| ATP synthase subunit B [Escherichia coli]
gb|PCO96989.1| ATP synthase subunit B [Escherichia coli]
gb|PCP03308.1| ATP synthase subunit B [Escherichia coli]
gb|PCQ51843.1| ATP synthase subunit B [Escherichia coli]
gb|PCQ83398.1| ATP synthase subunit B [Escherichia coli]
gb|PCQ90077.1| ATP synthase subunit B [Escherichia coli]
gb|PCQ94443.1| ATP synthase subunit B [Escherichia coli]
gb|PCR55201.1| ATP synthase subunit B [Escherichia coli]
gb|PCR58019.1| ATP synthase subunit B [Escherichia coli]
gb|PCR65015.1| ATP synthase subunit B [Escherichia coli]
gb|PCR67745.1| ATP synthase subunit B [Escherichia coli]
gb|PCR76317.1| ATP synthase subunit B [Escherichia coli]
gb|PCS32702.1| ATP synthase subunit B [Escherichia coli]
gb|PCS33973.1| ATP synthase subunit B [Escherichia coli]
gb|PCS39650.1| ATP synthase subunit B [Escherichia coli]
gb|PCS48496.1| ATP synthase subunit B [Escherichia coli]
gb|PCS50329.1| ATP synthase subunit B [Escherichia coli]
gb|PCS55142.1| ATP synthase subunit B [Escherichia coli]
gb|PCS59090.1| ATP synthase subunit B [Escherichia coli]
gb|PCS68297.1| ATP synthase subunit B [Escherichia coli]
gb|PCS72764.1| ATP synthase subunit B [Escherichia coli]
gb|PCS74236.1| ATP synthase subunit B [Escherichia coli]
gb|PCS76406.1| ATP synthase subunit B [Escherichia coli]
gb|PCS85640.1| ATP synthase subunit B [Escherichia coli]
gb|PCS92327.1| ATP synthase subunit B [Escherichia coli]
gb|PCS98373.1| ATP synthase subunit B [Escherichia coli]
gb|PCT02075.1| ATP synthase subunit B [Escherichia coli]
gb|PCT10658.1| ATP synthase subunit B [Escherichia coli]
gb|PCT19389.1| ATP synthase subunit B [Escherichia coli]
gb|PCT21584.1| ATP synthase subunit B [Escherichia coli]
gb|PCT29607.1| ATP synthase subunit B [Escherichia coli]
gb|PCT30712.1| ATP synthase subunit B [Escherichia coli]
gb|PCT35189.1| ATP synthase subunit B [Escherichia coli]
gb|ATH69935.1| ATP synthase subunit B [Shigella flexneri 1c]
gb|ATH90517.1| ATP synthase subunit B [Shigella sonnei]
gb|ATI04450.1| ATP synthase subunit B [Escherichia coli M12]
gb|PDM31941.1| ATP synthase subunit B [Escherichia coli]
gb|PDM44172.1| ATP synthase subunit B [Escherichia coli]
gb|PDM86558.1| ATP synthase subunit B [Escherichia coli]
gb|PDM91137.1| ATP synthase subunit B [Escherichia coli]
gb|PDM95817.1| ATP synthase subunit B [Escherichia coli]
gb|PDN00999.1| ATP synthase subunit B [Escherichia coli]
gb|PDN90334.1| ATP synthase subunit B [Escherichia coli]
gb|PDN92483.1| ATP synthase subunit B [Escherichia coli]
gb|PDN95827.1| ATP synthase subunit B [Escherichia coli]
gb|PDO05233.1| ATP synthase subunit B [Escherichia coli]
gb|PDO13344.1| ATP synthase subunit B [Escherichia coli]
gb|PDO17544.1| ATP synthase subunit B [Escherichia coli]
gb|PDO22119.1| ATP synthase subunit B [Escherichia coli]
gb|PDO28344.1| ATP synthase subunit B [Escherichia coli]
gb|PDO31318.1| ATP synthase subunit B [Escherichia coli]
gb|PDO36827.1| ATP synthase subunit B [Escherichia coli]
gb|PDO44622.1| ATP synthase subunit B [Escherichia coli]
gb|PDO48976.1| ATP synthase subunit B [Escherichia coli]
gb|PDO52593.1| ATP synthase subunit B [Escherichia coli]
gb|PDO56952.1| ATP synthase subunit B [Escherichia coli]
gb|PDO61974.1| ATP synthase subunit B [Escherichia coli]
gb|PDO66233.1| ATP synthase subunit B [Escherichia coli]
gb|PDS07932.1| ATP synthase subunit B [Escherichia coli]
gb|PDS12710.1| ATP synthase subunit B [Escherichia coli]
gb|PDS20206.1| ATP synthase subunit B [Escherichia coli]
gb|PDT93179.1| ATP synthase subunit B [Escherichia coli]
gb|PDT98529.1| ATP synthase subunit B [Escherichia coli]
gb|PDU03896.1| ATP synthase subunit B [Escherichia coli]
gb|PDU09440.1| ATP synthase subunit B [Escherichia coli]
gb|PDU16022.1| ATP synthase subunit B [Escherichia coli]
gb|PDU19716.1| ATP synthase subunit B [Escherichia coli]
gb|PDU24914.1| ATP synthase subunit B [Escherichia coli]
gb|PDU30603.1| ATP synthase subunit B [Escherichia coli]
gb|PDU36262.1| ATP synthase subunit B [Escherichia coli]
gb|PDU43911.1| ATP synthase subunit B [Escherichia coli]
gb|PDU50005.1| ATP synthase subunit B [Escherichia coli]
gb|PDU56090.1| ATP synthase subunit B [Escherichia coli]
gb|PDU59946.1| ATP synthase subunit B [Escherichia coli]
gb|PDU65137.1| ATP synthase subunit B [Escherichia coli]
gb|PDU70621.1| ATP synthase subunit B [Escherichia coli]
gb|PDU76035.1| ATP synthase subunit B [Escherichia coli]
gb|PDU81557.1| ATP synthase subunit B [Escherichia coli]
gb|PDU87278.1| ATP synthase subunit B [Escherichia coli]
gb|PDU95349.1| ATP synthase subunit B [Escherichia coli]
gb|PDV00668.1| ATP synthase subunit B [Escherichia coli]
gb|PDV05970.1| ATP synthase subunit B [Escherichia coli]
gb|PDV11487.1| ATP synthase subunit B [Escherichia coli]
gb|PDV23261.1| ATP synthase subunit B [Escherichia coli]
gb|PDV27918.1| ATP synthase subunit B [Escherichia coli]
gb|PDV32716.1| ATP synthase subunit B [Escherichia coli]
gb|PDV38707.1| ATP synthase subunit B [Escherichia coli]
gb|PDV42576.1| ATP synthase subunit B [Escherichia coli]
gb|PDV51299.1| ATP synthase subunit B [Escherichia coli]
gb|PDV52774.1| ATP synthase subunit B [Escherichia coli]
gb|PDV56686.1| ATP synthase subunit B [Escherichia coli]
gb|PDV63972.1| ATP synthase subunit B [Escherichia coli]
gb|PDV71330.1| ATP synthase subunit B [Escherichia coli]
gb|PDV77276.1| ATP synthase subunit B [Escherichia coli]
gb|PDV82390.1| ATP synthase subunit B [Escherichia coli]
gb|PDV93745.1| ATP synthase subunit B [Escherichia coli]
gb|PEH63872.1| ATP synthase subunit B [Escherichia coli]
gb|PEH94430.1| ATP synthase subunit B [Escherichia coli]
gb|PEI00116.1| ATP synthase subunit B [Escherichia coli]
gb|PEI19220.1| ATP synthase subunit B [Escherichia coli]
gb|PGF61884.1| ATP synthase subunit B [Escherichia coli]
gb|PGF62817.1| ATP synthase subunit B [Escherichia coli]
gb|PGF71319.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGF76021.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGF82797.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGF86875.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGF88809.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGF95708.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG01307.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG03566.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG09242.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG14314.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG23287.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG27033.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG30413.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG34997.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG37437.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG44854.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG54455.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG55437.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG57950.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG64869.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PGG69778.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PHG88403.1| ATP synthase subunit B [Escherichia coli]
gb|PHG92084.1| ATP synthase subunit B [Escherichia coli]
gb|PHH32430.1| ATP synthase subunit B [Escherichia coli]
gb|ATM10590.1| ATP synthase subunit B [Escherichia coli]
gb|ATM26392.1| ATP synthase subunit B [Escherichia coli]
gb|ATM82767.1| ATP synthase subunit B [Escherichia coli]
gb|PHK60105.1| ATP synthase subunit B [Escherichia coli]
gb|PHL24827.1| ATP synthase subunit B [Escherichia coli]
gb|PHL27900.1| ATP synthase subunit B [Escherichia coli]
gb|PHL34312.1| ATP synthase subunit B [Escherichia coli]
gb|PHL41071.1| ATP synthase subunit B [Escherichia coli]
gb|PHL46070.1| ATP synthase subunit B [Escherichia coli]
gb|PHL48228.1| ATP synthase subunit B [Escherichia coli]
gb|PHL52940.1| ATP synthase subunit B [Escherichia coli]
gb|PHL57443.1| ATP synthase subunit B [Escherichia coli]
gb|PHL63965.1| ATP synthase subunit B [Escherichia coli]
gb|PHL70512.1| ATP synthase subunit B [Escherichia coli]
gb|PHL92984.1| ATP synthase subunit B [Escherichia coli]
gb|PHL98002.1| ATP synthase subunit B [Escherichia coli]
gb|PHN14431.1| ATP synthase subunit B [Escherichia coli]
gb|ATO77550.1| F0F1 ATP synthase subunit B [Escherichia coli O91 str. RM7190]
gb|PHU44579.1| ATP synthase subunit B [Shigella flexneri]
gb|PHU49085.1| ATP synthase subunit B [Shigella flexneri]
gb|PHU52812.1| ATP synthase subunit B [Shigella flexneri]
gb|PHU79472.1| ATP synthase subunit B [Shigella sonnei]
gb|PHU84345.1| ATP synthase subunit B [Shigella boydii]
gb|PHU94438.1| ATP synthase subunit B [Shigella boydii]
gb|PHU98229.1| ATP synthase subunit B [Shigella boydii]
gb|ATP24223.1| ATP synthase subunit B [Escherichia coli]
gb|PHW97487.1| ATP synthase subunit B [Escherichia coli]
gb|PHX02477.1| ATP synthase subunit B [Escherichia coli]
gb|PIA84638.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PIM06782.1| ATP synthase subunit B [Escherichia coli]
gb|PIM12630.1| ATP synthase subunit B [Escherichia coli]
gb|PIM16159.1| ATP synthase subunit B [Escherichia coli]
gb|PIM23167.1| ATP synthase subunit B [Escherichia coli]
gb|PIM28479.1| ATP synthase subunit B [Escherichia coli]
gb|PIM32223.1| ATP synthase subunit B [Escherichia coli]
gb|PIM37096.1| ATP synthase subunit B [Escherichia coli]
gb|PIM41677.1| ATP synthase subunit B [Escherichia coli]
gb|PIM48013.1| ATP synthase subunit B [Escherichia coli]
gb|PIM56541.1| ATP synthase subunit B [Escherichia coli]
gb|PIM65475.1| ATP synthase subunit B [Escherichia coli]
gb|ATU37077.1| ATP synthase subunit B [Escherichia coli]
gb|ATV11106.1| ATP synthase subunit B [Escherichia coli]
gb|ATV48757.1| ATP synthase subunit B [Escherichia coli]
gb|ATV77994.1| ATP synthase subunit B [Escherichia coli]
gb|PIS72948.1| ATP F0F1 synthase subunit B [Escherichia coli O55:H7 str. USDA
5905]
gb|ATW95649.1| ATP synthase subunit B [Escherichia coli]
gb|ATX10053.1| ATP synthase subunit B [Escherichia coli]
gb|ATX12631.1| ATP synthase subunit B [Escherichia coli]
gb|ATX18329.1| ATP synthase subunit B [Escherichia coli]
gb|ATX41143.1| ATP synthase subunit B [Escherichia coli]
gb|ATX48578.1| ATP synthase subunit B [Escherichia coli]
gb|ATX52641.1| ATP synthase subunit B [Escherichia coli]
gb|ATX57381.1| ATP synthase subunit B [Escherichia coli]
gb|PJF56868.1| ATP synthase subunit B [Escherichia coli]
gb|PJF60933.1| ATP synthase subunit B [Escherichia coli]
gb|PJF65385.1| ATP synthase subunit B [Escherichia coli]
gb|PJF70396.1| ATP synthase subunit B [Escherichia coli]
gb|PJF78189.1| ATP synthase subunit B [Escherichia coli]
gb|PJF78773.1| ATP synthase subunit B [Escherichia coli]
gb|PJF83296.1| ATP synthase subunit B [Escherichia coli]
gb|PJF89014.1| ATP synthase subunit B [Escherichia coli]
gb|PJF95860.1| ATP synthase subunit B [Escherichia coli]
gb|PJG00934.1| ATP synthase subunit B [Escherichia coli]
gb|PJG02413.1| ATP synthase subunit B [Escherichia coli]
gb|PJG09672.1| ATP synthase subunit B [Escherichia coli]
gb|PJG10793.1| ATP synthase subunit B [Escherichia coli]
gb|PJG20028.1| ATP synthase subunit B [Escherichia coli]
gb|PJG23184.1| ATP synthase subunit B [Escherichia coli]
gb|PJG26346.1| ATP synthase subunit B [Escherichia coli]
gb|PJG31396.1| ATP synthase subunit B [Escherichia coli]
gb|PJG74085.1| ATP synthase subunit B [Escherichia coli]
gb|ATY20505.1| ATP synthase subunit B [Escherichia coli]
gb|ATY25844.1| ATP synthase subunit B [Escherichia coli]
gb|PJH96699.1| ATP synthase subunit B [Escherichia coli]
gb|PJI57954.1| ATP synthase subunit B [Escherichia coli]
gb|PJI62750.1| ATP synthase subunit B [Escherichia coli]
gb|PJN77847.1| ATP synthase subunit B [Escherichia coli]
gb|ATX37850.1| ATP synthase subunit B [Escherichia coli]
gb|ATZ40423.1| ATP synthase subunit B [Escherichia coli]
gb|PJR33197.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. TW14313]
gb|PJR39053.1| ATP F0F1 synthase subunit B [Escherichia coli O55:H7 str. TB182A]
gb|PJR44618.1| ATP F0F1 synthase subunit B [Escherichia coli O157:H7 str. EC1825]
gb|PJW25070.1| ATP synthase subunit B [Escherichia coli]
gb|PJW32464.1| ATP synthase subunit B [Escherichia coli]
gb|PJW33889.1| ATP synthase subunit B [Escherichia coli]
gb|PJW39531.1| ATP synthase subunit B [Escherichia coli]
gb|PJW48712.1| ATP synthase subunit B [Escherichia coli]
gb|PJW54307.1| ATP synthase subunit B [Escherichia coli]
gb|PJW60436.1| ATP synthase subunit B [Escherichia coli]
gb|PJW63201.1| ATP synthase subunit B [Escherichia coli]
gb|PJW69217.1| ATP synthase subunit B [Escherichia coli]
gb|PJW74854.1| ATP synthase subunit B [Escherichia coli]
gb|PJW80088.1| ATP synthase subunit B [Escherichia coli]
gb|PJW84326.1| ATP synthase subunit B [Escherichia coli]
gb|PJW87357.1| ATP synthase subunit B [Escherichia coli]
gb|PJW97338.1| ATP synthase subunit B [Escherichia coli]
gb|PJX03938.1| ATP synthase subunit B [Escherichia coli]
gb|ATZ32639.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PJX79184.1| ATP synthase subunit B [Escherichia coli]
gb|PJX83257.1| ATP synthase subunit B [Escherichia coli]
gb|PJX90209.1| ATP synthase subunit B [Escherichia coli]
gb|PJX98482.1| ATP synthase subunit B [Escherichia coli]
gb|PJY01893.1| ATP synthase subunit B [Escherichia coli]
gb|PJY08950.1| ATP synthase subunit B [Escherichia coli]
gb|PJY15866.1| ATP synthase subunit B [Escherichia coli]
gb|PJY20902.1| ATP synthase subunit B [Escherichia coli]
gb|PJY25231.1| ATP synthase subunit B [Escherichia coli]
gb|PJY28354.1| ATP synthase subunit B [Escherichia coli]
gb|PJY32966.1| ATP synthase subunit B [Escherichia coli]
gb|PJY39593.1| ATP synthase subunit B [Escherichia coli]
gb|PJY46310.1| ATP synthase subunit B [Escherichia coli]
gb|PJY52137.1| ATP synthase subunit B [Escherichia coli]
gb|PJY53015.1| ATP synthase subunit B [Escherichia coli]
gb|PJY61869.1| ATP synthase subunit B [Escherichia coli]
emb|SMZ47653.1| ATP synthase F0 sector subunit b [Escherichia coli]
gb|AUA41580.1| ATP synthase subunit B [Escherichia coli]
gb|AUA44437.1| ATP synthase subunit B [Escherichia coli]
gb|PKD52560.1| ATP synthase subunit B [Escherichia coli]
gb|PKD57068.1| ATP synthase subunit B [Escherichia coli]
gb|PKD65715.1| ATP synthase subunit B [Escherichia coli]
gb|PKD71476.1| ATP synthase subunit B [Escherichia coli]
gb|PKD74923.1| ATP synthase subunit B [Escherichia coli]
gb|PKD86673.1| ATP synthase subunit B [Escherichia coli]
gb|PKD86954.1| ATP synthase subunit B [Escherichia coli]
gb|PKD94505.1| ATP synthase subunit B [Escherichia coli]
gb|PKE05274.1| ATP synthase subunit B [Escherichia coli]
gb|PKE15330.1| ATP synthase subunit B [Escherichia coli]
gb|PKE79330.1| ATP synthase subunit B [Escherichia coli]
gb|PKE84081.1| ATP synthase subunit B [Escherichia coli]
gb|PKE88607.1| ATP synthase subunit B [Escherichia coli]
gb|PKE93207.1| ATP synthase subunit B [Escherichia coli]
gb|PKE97825.1| ATP synthase subunit B [Escherichia coli]
gb|PKE99526.1| ATP synthase subunit B [Escherichia coli]
gb|PKF17560.1| ATP synthase subunit B [Escherichia coli]
gb|PKF53775.1| ATP synthase subunit B [Escherichia coli]
gb|PKG04596.1| ATP synthase subunit B [Escherichia coli]
gb|PKI87280.1| ATP synthase subunit B [Escherichia coli]
gb|PKI93910.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ02754.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ08208.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ10042.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ15909.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ19161.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ24584.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ32372.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ40334.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ46209.1| ATP synthase subunit B [Escherichia coli]
gb|PKJ50888.1| ATP synthase subunit B [Escherichia coli]
gb|AUF77951.1| ATP synthase subunit B [Escherichia coli O121:H19]
gb|AUG18448.1| ATP synthase subunit B [Escherichia coli str. K-12 substr. MG1655]
gb|PKQ94994.1| ATP synthase subunit B [Escherichia coli]
gb|PKR63077.1| ATP synthase subunit B [Escherichia coli]
gb|PKR67842.1| ATP synthase subunit B [Escherichia coli]
gb|PKR73162.1| ATP synthase subunit B [Escherichia coli]
gb|AUG66907.1| ATP synthase subunit B [Escherichia coli]
gb|AUG95717.1| ATP synthase F0 complex - b subunit [Escherichia coli]
gb|PKZ10269.1| ATP synthase subunit B [Escherichia coli]
gb|PKZ32613.1| ATP synthase subunit B [Escherichia coli]
gb|PKZ50467.1| ATP synthase subunit B [Escherichia coli]
gb|PKZ77736.1| ATP synthase subunit B [Escherichia coli]
gb|PLA85547.1| ATP synthase subunit B [Escherichia coli]
gb|PLB01106.1| ATP synthase subunit B [Escherichia coli]
gb|PLB57325.1| ATP synthase subunit B [Escherichia coli]
gb|PLB61877.1| ATP synthase subunit B [Escherichia coli]
gb|PLB69481.1| ATP synthase subunit B [Escherichia coli]
gb|PLB70992.1| ATP synthase subunit B [Escherichia coli]
gb|PLB78863.1| ATP synthase subunit B [Escherichia coli]
gb|AUJ93528.1| ATP synthase subunit B [Escherichia coli]
gb|AUJ94047.1| ATP synthase subunit B [Escherichia coli]
gb|AUK03488.1| ATP synthase subunit B [Escherichia coli]
gb|AUK08817.1| ATP synthase subunit B [Escherichia coli]
gb|AUK14075.1| ATP synthase subunit B [Escherichia coli]
gb|AUK19231.1| ATP synthase subunit B [Escherichia coli]
gb|PLJ80128.1| ATP synthase subunit B [Escherichia coli]
gb|PLJ82360.1| ATP synthase subunit B [Escherichia coli]
gb|PLJ91040.1| ATP synthase subunit B [Escherichia coli]
gb|PLJ95693.1| ATP synthase subunit B [Escherichia coli]
gb|PLK02286.1| ATP synthase subunit B [Escherichia coli]
gb|PLK08409.1| ATP synthase subunit B [Escherichia coli]
gb|PLK10789.1| ATP synthase subunit B [Escherichia coli]
gb|PLR06145.1| ATP synthase subunit B [Escherichia coli]
gb|AUF93218.1| ATP synthase subunit B [Escherichia coli]
gb|AUL65963.1| ATP synthase subunit B [Escherichia coli]
gb|AUL67876.1| ATP synthase subunit B [Escherichia coli]
gb|AUL87614.1| ATP synthase subunit B [Escherichia coli]
gb|AUL92605.1| ATP synthase subunit B [Escherichia coli]
gb|AUM10445.1| ATP synthase subunit B [Escherichia coli]
gb|AUM24996.1| ATP synthase subunit B [Escherichia coli]
gb|AUN49854.1| ATP synthase subunit B [Escherichia coli]
gb|PMB58823.1| ATP synthase subunit B [Escherichia coli]
gb|PMD82255.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PMD86701.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PMD89181.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PME01525.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SOQ98248.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ89303.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOR03356.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ85590.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ64240.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ65505.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ76773.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ81654.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOQ73036.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
emb|SOR06059.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
coli]
gb|AUO34624.1| ATP synthase F0, B subunit [Escherichia coli]
gb|AUO40499.1| ATP synthase subunit B [Escherichia coli]
gb|AUO59784.1| ATP synthase subunit B [Escherichia coli]
gb|PNB96719.1| ATP synthase subunit B [Escherichia coli]
gb|PNC01529.1| ATP synthase subunit B [Escherichia coli]
gb|PNC15547.1| ATP synthase subunit B [Escherichia coli]
gb|PND44582.1| ATP synthase subunit B [Escherichia coli]
gb|AUQ39637.1| ATP synthase subunit B [Escherichia coli]
gb|PND68233.1| ATP synthase subunit B [Escherichia coli]
gb|PND74355.1| ATP synthase subunit B [Escherichia coli]
gb|PND78726.1| ATP synthase subunit B [Escherichia coli]
gb|PND86396.1| ATP synthase subunit B [Escherichia coli]
gb|PND99206.1| ATP synthase subunit B [Escherichia coli]
gb|PNL71117.1| ATP synthase subunit B [Escherichia coli O157]
gb|PNM75381.1| ATP synthase subunit B [Shigella sonnei]
gb|PNN27230.1| ATP synthase subunit B [Escherichia coli]
gb|PNO48477.1| ATP synthase subunit B [Shigella sonnei]
gb|PNO96024.1| ATP synthase subunit B [Escherichia coli]
gb|PNP03223.1| ATP synthase subunit B [Shigella flexneri]
gb|PNP62094.1| ATP synthase subunit B [Escherichia coli]
gb|AUP44518.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|AUS40534.1| ATP synthase subunit B [Escherichia coli]
gb|PNR01732.1| ATP synthase subunit B [Escherichia coli]
gb|PNR06479.1| ATP synthase subunit B [Escherichia coli]
gb|PNR12325.1| ATP synthase subunit B [Escherichia coli]
gb|PNR20325.1| ATP synthase subunit B [Escherichia coli]
gb|PNR22478.1| ATP synthase subunit B [Escherichia coli]
gb|PNS25627.1| ATP synthase subunit B [Escherichia coli]
gb|AUT11443.1| ATP synthase subunit B [Escherichia coli]
gb|AUN92609.1| ATP synthase subunit B [Escherichia coli]
gb|AUT28595.1| ATP synthase subunit B [Escherichia marmotae]
gb|PNY39134.1| ATP synthase subunit B [Escherichia coli]
gb|PNY52643.1| ATP synthase subunit B [Escherichia coli]
gb|PNY58532.1| ATP synthase subunit B [Escherichia coli]
gb|PNY66007.1| ATP synthase subunit B [Escherichia coli]
gb|AUV21824.1| ATP synthase subunit B [Escherichia coli]
gb|AUV31778.1| ATP synthase subunit B [Escherichia coli]
gb|POF66699.1| ATP synthase subunit B [Escherichia coli]
gb|POF72132.1| ATP synthase subunit B [Escherichia coli]
gb|POF78394.1| ATP synthase subunit B [Escherichia coli]
gb|POF82664.1| ATP synthase subunit B [Escherichia coli]
gb|POH76677.1| ATP synthase subunit B [Escherichia coli]
gb|POH98264.1| ATP synthase subunit B [Escherichia coli]
gb|POI01182.1| ATP synthase subunit B [Escherichia coli]
gb|POI01724.1| ATP synthase subunit B [Escherichia coli]
gb|POI05397.1| ATP synthase subunit B [Escherichia coli]
gb|POI13863.1| ATP synthase subunit B [Escherichia coli]
gb|POL44895.1| ATP synthase subunit B [Escherichia coli]
gb|POL49769.1| ATP synthase subunit B [Escherichia coli]
gb|POL56223.1| ATP synthase subunit B [Escherichia coli]
gb|POL58750.1| ATP synthase subunit B [Escherichia coli]
gb|POL65963.1| ATP synthase subunit B [Escherichia coli]
gb|POL73228.1| ATP synthase subunit B [Escherichia coli]
gb|POL76689.1| ATP synthase subunit B [Escherichia coli]
gb|POL85187.1| ATP synthase subunit B [Escherichia coli]
gb|POL85351.1| ATP synthase subunit B [Escherichia coli]
gb|POL94841.1| ATP synthase subunit B [Escherichia coli]
gb|POL95027.1| ATP synthase subunit B [Escherichia coli]
gb|POL98511.1| ATP synthase subunit B [Escherichia coli]
gb|AUX05080.1| hypothetical protein FORC42_4806 [Escherichia coli]
gb|POO33612.1| ATP synthase subunit B [Escherichia coli]
gb|POO40556.1| ATP synthase subunit B [Escherichia coli]
gb|POO46218.1| ATP synthase subunit B [Escherichia coli]
gb|AUY03305.1| ATP synthase subunit B [Escherichia coli]
gb|AUY44885.1| ATP synthase subunit B [Escherichia coli]
gb|AUY31421.1| ATP synthase subunit b [Escherichia coli]
gb|POR90126.1| ATP synthase subunit B [Shigella flexneri]
gb|POR96381.1| ATP synthase subunit B [Shigella flexneri]
gb|POS11589.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS19731.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS20746.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS29497.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS35573.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS38028.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS42378.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS44856.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS55075.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POS60343.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|POT04381.1| ATP synthase subunit B [Escherichia coli]
gb|POT05565.1| ATP synthase subunit B [Escherichia coli]
gb|POT05966.1| ATP synthase subunit B [Escherichia coli]
gb|POT16266.1| ATP synthase subunit B [Escherichia coli]
gb|POT20057.1| ATP synthase subunit B [Escherichia coli]
gb|POT20846.1| ATP synthase subunit B [Escherichia coli]
gb|POU28626.1| ATP synthase subunit B [Escherichia coli]
gb|POV25366.1| ATP synthase subunit B [Escherichia coli]
gb|AUZ91285.1| ATP synthase subunit B [Escherichia coli]
gb|POZ11632.1| ATP synthase subunit B [Escherichia coli]
gb|AVB47876.1| ATP synthase subunit B [Escherichia coli]
gb|PPA54414.1| ATP synthase subunit B [Escherichia coli]
gb|AVD30978.1| ATP synthase subunit B [Escherichia coli]
gb|PPE10572.1| ATP synthase subunit B [Escherichia coli]
gb|PPE16610.1| ATP synthase subunit B [Escherichia coli]
gb|PPE21635.1| ATP synthase subunit B [Escherichia coli]
gb|PPE27628.1| ATP synthase subunit B [Escherichia coli]
gb|PPE31089.1| ATP synthase subunit B [Escherichia coli]
gb|PPE35742.1| ATP synthase subunit B [Escherichia coli]
gb|PPE39059.1| ATP synthase subunit B [Escherichia coli]
gb|PPE46940.1| ATP synthase subunit B [Escherichia coli]
gb|PPE53778.1| ATP synthase subunit B [Escherichia coli]
gb|PPE88803.1| ATP synthase subunit B [Escherichia coli]
gb|AVE96036.1| ATP synthase subunit B [Escherichia coli]
gb|AVG01390.1| ATP synthase subunit B [Escherichia coli]
gb|PPI93062.1| ATP synthase subunit B [Escherichia coli]
gb|PPO21220.1| ATP synthase subunit B [Escherichia coli]
gb|PPO91886.1| ATP synthase subunit B [Escherichia coli]
gb|PPV43512.1| ATP synthase subunit B [Escherichia coli]
gb|PPV48229.1| ATP synthase subunit B [Escherichia coli]
gb|PPV53843.1| ATP synthase subunit B [Escherichia coli]
gb|PPV62453.1| ATP synthase subunit B [Escherichia coli]
gb|PPV62813.1| ATP synthase subunit B [Escherichia coli]
gb|PPV70718.1| ATP synthase subunit B [Escherichia coli]
gb|PPV73867.1| ATP synthase subunit B [Escherichia coli]
gb|PPV86568.1| ATP synthase subunit B [Escherichia coli]
gb|PPV89550.1| ATP synthase subunit B [Escherichia coli]
gb|PPV94299.1| ATP synthase subunit B [Escherichia coli]
gb|PPV99307.1| ATP synthase subunit B [Escherichia coli]
gb|PPW04452.1| ATP synthase subunit B [Escherichia coli]
gb|PPW11252.1| ATP synthase subunit B [Escherichia coli]
gb|PPW13301.1| ATP synthase subunit B [Escherichia coli]
gb|PPW13540.1| ATP synthase subunit B [Escherichia coli]
gb|PPW22609.1| ATP synthase subunit B [Escherichia coli]
gb|PPW27968.1| ATP synthase subunit B [Escherichia coli]
gb|PPW28125.1| ATP synthase subunit B [Escherichia coli]
gb|PPW40039.1| ATP synthase subunit B [Escherichia coli]
gb|PPW41783.1| ATP synthase subunit B [Escherichia coli]
gb|PPW47111.1| ATP synthase subunit B [Escherichia coli]
gb|PPW54149.1| ATP synthase subunit B [Escherichia coli]
gb|PPW62880.1| ATP synthase subunit B [Escherichia coli]
gb|PPW63845.1| ATP synthase subunit B [Escherichia coli]
gb|PPW67887.1| ATP synthase subunit B [Escherichia coli]
gb|PPW68693.1| ATP synthase subunit B [Escherichia coli]
gb|PPW79467.1| ATP synthase subunit B [Escherichia coli]
gb|PPW82267.1| ATP synthase subunit B [Escherichia coli]
gb|PPW89283.1| ATP synthase subunit B [Escherichia coli]
gb|PPW92916.1| ATP synthase subunit B [Escherichia coli]
gb|PPX01237.1| ATP synthase subunit B [Escherichia coli]
gb|PPX01511.1| ATP synthase subunit B [Escherichia coli]
gb|PPX07892.1| ATP synthase subunit B [Escherichia coli]
gb|PPX13792.1| ATP synthase subunit B [Escherichia coli]
gb|PPX16819.1| ATP synthase subunit B [Escherichia coli]
gb|PPX22489.1| ATP synthase subunit B [Escherichia coli]
gb|PPX23948.1| ATP synthase subunit B [Escherichia coli]
gb|PPX34135.1| ATP synthase subunit B [Escherichia coli]
gb|PPX37622.1| ATP synthase subunit B [Escherichia coli]
gb|PPX43761.1| ATP synthase subunit B [Escherichia coli]
gb|PPX47894.1| ATP synthase subunit B [Escherichia coli]
gb|PPX53145.1| ATP synthase subunit B [Escherichia coli]
gb|PPX58389.1| ATP synthase subunit B [Escherichia coli]
gb|PPX60168.1| ATP synthase subunit B [Escherichia coli]
gb|PPY60854.1| ATP synthase subunit B [Escherichia coli]
gb|PPY63066.1| ATP synthase subunit B [Escherichia coli]
gb|PPY66721.1| ATP synthase subunit B [Escherichia coli]
gb|PPY75473.1| ATP synthase subunit B [Escherichia coli]
gb|PPY81804.1| ATP synthase subunit B [Escherichia coli]
gb|PPY82530.1| ATP synthase subunit B [Escherichia coli]
gb|PPY87952.1| ATP synthase subunit B [Escherichia coli]
gb|PPY94404.1| ATP synthase subunit B [Escherichia coli]
gb|PPY94830.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ05165.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ11357.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ16792.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ19717.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ25969.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ29934.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ34814.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ40778.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ54157.1| ATP synthase subunit B [Escherichia coli]
gb|PPZ99921.1| ATP synthase subunit B [Escherichia coli]
gb|PQA05564.1| ATP synthase subunit B [Escherichia coli]
gb|PQA06531.1| ATP synthase subunit B [Escherichia coli]
gb|PQA13667.1| ATP synthase subunit B [Escherichia coli]
gb|PQA19628.1| ATP synthase subunit B [Escherichia coli]
gb|PQA21761.1| ATP synthase subunit B [Escherichia coli]
gb|PQA27277.1| ATP synthase subunit B [Escherichia coli]
gb|PQA31952.1| ATP synthase subunit B [Escherichia coli]
gb|PQA38849.1| ATP synthase subunit B [Escherichia coli]
gb|PQA42950.1| ATP synthase subunit B [Escherichia coli]
gb|PQA43432.1| ATP synthase subunit B [Escherichia coli]
gb|PQA53831.1| ATP synthase subunit B [Escherichia coli]
gb|PQA63377.1| ATP synthase subunit B [Escherichia coli]
gb|PQA66661.1| ATP synthase subunit B [Escherichia coli]
gb|PQH08333.1| ATP synthase subunit B [Escherichia coli]
gb|PQI95916.1| ATP synthase subunit B [Escherichia fergusonii]
gb|PQI97953.1| ATP synthase subunit B [Escherichia fergusonii]
gb|PQK20365.1| ATP synthase subunit B [Escherichia coli]
gb|PQK26946.1| ATP synthase subunit B [Escherichia coli]
gb|PQK31183.1| ATP synthase subunit B [Escherichia coli]
gb|PQK33121.1| ATP synthase subunit B [Escherichia coli]
gb|PQK40771.1| ATP synthase subunit B [Escherichia coli]
gb|PQK44445.1| ATP synthase subunit B [Escherichia coli]
gb|PQK50912.1| ATP synthase subunit B [Escherichia coli]
gb|PQK56088.1| ATP synthase subunit B [Escherichia coli]
gb|PQK63496.1| ATP synthase subunit B [Escherichia coli]
gb|PQK63584.1| ATP synthase subunit B [Escherichia coli]
gb|AVI53906.1| ATP synthase subunit B [Escherichia coli str. K-12 substr. MG1655]
gb|AVJ15465.1| ATP synthase subunit B [Escherichia coli]
gb|PQM82342.1| ATP synthase subunit B [Shigella flexneri]
gb|PQM95585.1| ATP synthase subunit B [Shigella flexneri]
gb|PQM97230.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN00666.1| ATP synthase subunit B [Shigella dysenteriae]
gb|PQN09276.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN21605.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN22403.1| ATP synthase subunit B [Shigella dysenteriae]
gb|PQN24238.1| ATP synthase subunit B [Shigella boydii]
gb|PQN25716.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN30946.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN35862.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN43803.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN55049.1| ATP synthase subunit B [Shigella dysenteriae]
gb|PQN57899.1| ATP synthase subunit B [Shigella dysenteriae]
gb|PQN59002.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN60186.1| ATP synthase subunit B [Shigella boydii]
gb|PQN66168.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN67170.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN79242.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN81698.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN84304.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN93971.1| ATP synthase subunit B [Shigella flexneri]
gb|PQN98227.1| ATP synthase subunit B [Shigella flexneri]
gb|PQO04215.1| ATP synthase subunit B [Shigella flexneri]
gb|PQO08196.1| ATP synthase subunit B [Shigella dysenteriae]
gb|PQO09158.1| ATP synthase subunit B [Shigella flexneri]
gb|PQO16352.1| ATP synthase subunit B [Shigella flexneri]
gb|PQO19391.1| ATP synthase subunit B [Shigella flexneri]
gb|PQO64607.1| ATP synthase subunit B [Escherichia coli]
gb|PQO66817.1| ATP synthase subunit B [Escherichia coli]
gb|PQO70043.1| ATP synthase subunit B [Escherichia coli]
gb|PQO79450.1| ATP synthase subunit B [Escherichia coli]
gb|PQO83454.1| ATP synthase subunit B [Escherichia coli]
gb|PQO91985.1| ATP synthase subunit B [Escherichia coli]
gb|PQP07278.1| ATP synthase subunit B [Escherichia coli]
gb|PQP32543.1| ATP synthase subunit B [Escherichia coli]
gb|AVJ70736.1| ATP synthase F0, B subunit [Escherichia coli]
gb|AVJ76569.1| ATP synthase F0, B subunit [Escherichia coli]
gb|PQV19880.1| ATP synthase subunit B [Escherichia coli]
gb|PQV24999.1| ATP synthase subunit B [Escherichia coli]
gb|PQV28580.1| ATP synthase subunit B [Escherichia coli]
gb|PQV32671.1| ATP synthase subunit B [Escherichia coli]
gb|PQV39396.1| ATP synthase subunit B [Escherichia coli]
gb|PRB38662.1| ATP synthase subunit B [Escherichia coli]
gb|PRC26724.1| ATP synthase subunit B [Escherichia coli]
gb|AVL31803.1| ATP synthase subunit B [Escherichia coli O104:H4]
gb|AVM04388.1| ATP synthase subunit B [Escherichia coli]
gb|PRP03461.1| ATP synthase subunit B [Escherichia coli]
gb|PRP06172.1| ATP synthase subunit B [Escherichia coli]
gb|PRP08360.1| ATP synthase subunit B [Escherichia coli]
gb|PRP12951.1| ATP synthase subunit B [Escherichia coli]
gb|PRP19119.1| ATP synthase subunit B [Escherichia coli]
gb|PRP21306.1| ATP synthase subunit B [Escherichia coli]
gb|PRP29354.1| ATP synthase subunit B [Escherichia coli]
gb|PRP34537.1| ATP synthase subunit B [Escherichia coli]
gb|PRP42517.1| ATP synthase subunit B [Escherichia coli]
gb|PRP44887.1| ATP synthase subunit B [Escherichia coli]
gb|PRP45208.1| ATP synthase subunit B [Escherichia coli]
gb|AVN03478.1| ATP synthase subunit B [Escherichia coli]
gb|AVN08889.1| ATP synthase F0, B subunit [Escherichia coli]
gb|AVL08712.1| ATP synthase subunit B [Escherichia coli]
gb|AVN37504.1| ATP synthase subunit B [Escherichia coli]
gb|PRT58943.1| ATP synthase subunit B [Escherichia coli]
gb|PRW36516.1| ATP synthase F0, B subunit [Escherichia coli]
gb|PRW49003.1| ATP synthase F0, B subunit [Escherichia coli]
gb|PRW51636.1| ATP synthase F0, B subunit [Escherichia coli]
gb|PSB93778.1| ATP synthase subunit B [Escherichia coli]
gb|PSF26525.1| ATP synthase subunit B [Escherichia coli]
gb|PSF27198.1| ATP synthase subunit B [Escherichia coli]
gb|PSF44602.1| ATP synthase subunit B [Escherichia coli]
gb|PSF48996.1| ATP synthase subunit B [Escherichia coli]
gb|PSF56463.1| ATP synthase subunit B [Escherichia coli]
gb|PSF63482.1| ATP synthase subunit B [Escherichia coli]
gb|PSF71816.1| ATP synthase subunit B [Escherichia coli]
gb|PSF77085.1| ATP synthase subunit B [Escherichia coli]
gb|PSF86118.1| ATP synthase subunit B [Escherichia coli]
gb|PSG08818.1| ATP synthase subunit B [Escherichia coli]
gb|PSG19458.1| ATP synthase subunit B [Escherichia coli]
gb|PSG22863.1| ATP synthase subunit B [Escherichia coli]
gb|PSG28474.1| ATP synthase subunit B [Escherichia coli]
gb|PSG37904.1| ATP synthase subunit B [Escherichia coli]
gb|PSG42788.1| ATP synthase subunit B [Escherichia coli]
gb|PSG47382.1| ATP synthase subunit B [Escherichia coli]
gb|PSG56853.1| ATP synthase subunit B [Escherichia coli]
gb|PSG80604.1| ATP synthase subunit B [Escherichia coli]
gb|AVP31904.1| ATP synthase subunit B [Escherichia coli]
gb|PSK09335.1| ATP synthase subunit B [Escherichia coli]
gb|PSK22744.1| ATP synthase subunit B [Escherichia coli]
gb|PSL61055.1| ATP synthase subunit B [Escherichia coli]
gb|PSL62154.1| ATP synthase subunit B [Escherichia coli]
gb|PSL65431.1| ATP synthase subunit B [Escherichia coli]
gb|PSL73596.1| ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_052934231.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|KOA31279.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OEM37634.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQARAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_033810871.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQVEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_032255600.1| MULTISPECIES: F0F1 ATP synthase subunit B [Enterobacteriaceae]
gb|KDT53290.1| ATP synthase F0, B subunit [Escherichia coli 3-105-05_S4_C3]
gb|KDU38884.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S4_C1]
gb|KDZ84364.1| ATP synthase F0, B subunit [Escherichia coli 3-073-06_S4_C3]
gb|KEN20609.1| ATP synthase F0, B subunit [Escherichia coli 7-233-03_S3_C2]
gb|OJO44122.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJO51937.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OJP73181.1| F0F1 ATP synthase subunit B [Escherichia coli]
emb|SJI00257.1| F0F1 ATP synthase subunit B [Shigella sonnei]
emb|SJI64004.1| F0F1 ATP synthase subunit B [Shigella sonnei]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAECKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_001052217.1| F0F1 ATP synthase subunit B [Escherichia coli]
ref|YP_006122063.1| F0F1 ATP synthase subunit B [Escherichia coli O83:H1 str. NRG 857C]
emb|CAP78194.1| ATP synthase B chain [Escherichia coli LF82]
gb|ADR29129.1| F0F1 ATP synthase subunit B [Escherichia coli O83:H1 str. NRG 857C]
gb|ELJ81148.1| ATP synthase subunit B [Escherichia coli KTE94]
gb|EOX19906.1| ATP synthase subunit B [Escherichia coli KTE185]
gb|EQN29208.1| ATP synthase subunit B [Escherichia coli HVH 9 (4-6942539)]
gb|KKJ12889.1| ATP F0F1 synthase subunit B [Escherichia coli MRSN 10204]
gb|KZF30126.1| ATP F0F1 synthase subunit B [Escherichia coli APEC O2]
gb|OAO39438.1| ATP F0F1 synthase subunit B [Escherichia coli]
gb|OYC14686.1| ATP synthase subunit B [Escherichia coli]
gb|OYC61016.1| ATP synthase subunit B [Escherichia coli]
gb|ATC15147.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_023568271.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|EST63898.1| F0F1 ATP synthase subunit B [Escherichia coli ECC-Z]
gb|OEN73225.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRVREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_001052218.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTB78962.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTC94866.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|OTD69324.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 242 bits (617), Expect = 6e-76
Identities = 134/155 (86%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAHEEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_001052220.1| ATP synthase subunit B [Escherichia coli]
gb|EIP06734.1| ATP synthase F0, B subunit [Escherichia coli TW14301]
gb|EKW52734.1| ATP synthase F0, B subunit [Escherichia coli 96.0932]
gb|ELW08950.1| ATP synthase F0, B subunit [Escherichia coli 7.1982]
gb|ERE30570.1| ATP synthase F0, B subunit [Escherichia coli Tx1686]
gb|AOV19297.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AOV24650.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AOV30003.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AOV40782.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|AOV51542.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7]
gb|PDV16905.1| ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 241 bits (616), Expect = 9e-76
Identities = 133/155 (85%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSD+VDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDVVDKLVAE 155
>ref|WP_016235054.1| ATP synthase subunit B [Escherichia coli]
gb|EOU67671.1| ATP synthase subunit B [Escherichia coli KTE24]
gb|ODG72701.1| F0F1 ATP synthase subunit B [Shigella sp. FC2045]
gb|ODG78565.1| F0F1 ATP synthase subunit B [Shigella sp. FC2928]
Length = 156
Score = 241 bits (616), Expect = 9e-76
Identities = 133/155 (85%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQ+IIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQIIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_062903466.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|KYV46751.1| ATP F0F1 synthase subunit B [Escherichia coli]
Length = 156
Score = 241 bits (614), Expect = 2e-75
Identities = 133/155 (85%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLV+E
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVSE 155
>ref|WP_021573472.1| ATP synthase subunit B [Escherichia coli]
gb|ERF52157.1| ATP synthase subunit B [Escherichia coli UMEA 3652-1]
Length = 156
Score = 241 bits (614), Expect = 2e-75
Identities = 133/155 (85%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKY+WPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYLWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155
>ref|WP_001617354.1| ATP synthase subunit B [Escherichia coli]
gb|ELH65297.1| ATP synthase subunit B [Escherichia coli KTE209]
gb|ELI70430.1| ATP synthase subunit B [Escherichia coli KTE137]
gb|EQO34950.1| ATP synthase subunit B [Escherichia coli HVH 37 (4-2773848)]
gb|EQO49696.1| ATP synthase subunit B [Escherichia coli HVH 40 (4-1219782)]
Length = 156
Score = 241 bits (614), Expect = 2e-75
Identities = 133/155 (85%), Positives = 135/155 (87%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDI+DKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIMDKLVAE 155
>ref|WP_100541683.1| F0F1 ATP synthase subunit B [Escherichia coli]
gb|PJO17694.1| F0F1 ATP synthase subunit B [Escherichia coli]
Length = 156
Score = 240 bits (613), Expect = 2e-75
Identities = 133/155 (85%), Positives = 134/155 (86%)
Frame = -3
Query: 786 VNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 607
+NLNATILGQAIAFVLFVLFCMKYVWPPLMA IEKRQKEIADGLASAERAHKDLDLAKAS
Sbjct: 1 MNLNATILGQAIAFVLFVLFCMKYVWPPLMAVIEKRQKEIADGLASAERAHKDLDLAKAS 60
Query: 606 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVXXXXXXXXXXXXXXXXXX 427
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIV
Sbjct: 61 ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120
Query: 426 XXQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 322
QVAILAVAGAEKIIERSVDEAANSDIVDKLVAE
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAE 155