BLASTX nr result
ID: Acanthopanax21_contig00029415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00029415 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB41434.1| hypothetical protein L484_007584 [Morus notabilis] 55 2e-07 >gb|EXB41434.1| hypothetical protein L484_007584 [Morus notabilis] Length = 61 Score = 55.5 bits (132), Expect = 2e-07 Identities = 30/44 (68%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 462 FLLWARVDSSRGSNVPEPGYR-PEAPSHKGTLNVILEGRYHKNQ 334 FLLWARVDSS GSN R + SHKGTLNVILEGRYH N+ Sbjct: 10 FLLWARVDSSCGSNGARLLTRGADRESHKGTLNVILEGRYHNNK 53