BLASTX nr result
ID: Acanthopanax21_contig00029370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00029370 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM82903.1| hypothetical protein DCAR_030472 [Daucus carota s... 58 6e-07 ref|XP_017227242.1| PREDICTED: protein high chlorophyll fluoresc... 58 6e-07 >gb|KZM82903.1| hypothetical protein DCAR_030472 [Daucus carota subsp. sativus] Length = 599 Score = 58.2 bits (139), Expect = 6e-07 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = -1 Query: 190 EENDKLTQEIRATKQSLEELLVVRRPVMXXXXXXXXXXXXXXSLSPSPIDASLSKFAKKM 11 E+ DKL +EIRA++QSLEELLVVRRPVM S +DASL+KFAKK+ Sbjct: 68 EDKDKLNEEIRASRQSLEELLVVRRPVMDSLVEDEEEEDEEEE-GLSSVDASLAKFAKKV 126 Query: 10 PYF 2 +F Sbjct: 127 AFF 129 >ref|XP_017227242.1| PREDICTED: protein high chlorophyll fluorescent 107 [Daucus carota subsp. sativus] Length = 636 Score = 58.2 bits (139), Expect = 6e-07 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = -1 Query: 190 EENDKLTQEIRATKQSLEELLVVRRPVMXXXXXXXXXXXXXXSLSPSPIDASLSKFAKKM 11 E+ DKL +EIRA++QSLEELLVVRRPVM S +DASL+KFAKK+ Sbjct: 68 EDKDKLNEEIRASRQSLEELLVVRRPVMDSLVEDEEEEDEEEE-GLSSVDASLAKFAKKV 126 Query: 10 PYF 2 +F Sbjct: 127 AFF 129