BLASTX nr result
ID: Acanthopanax21_contig00029357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00029357 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017241523.1| PREDICTED: aluminum-activated malate transpo... 74 4e-12 emb|CDP04954.1| unnamed protein product [Coffea canephora] 72 1e-11 ref|XP_011075828.1| aluminum-activated malate transporter 4 [Ses... 71 2e-11 ref|XP_022890439.1| aluminum-activated malate transporter 9-like... 70 8e-11 ref|XP_022890438.1| aluminum-activated malate transporter 4-like... 70 8e-11 ref|XP_022890437.1| aluminum-activated malate transporter 4-like... 70 8e-11 ref|XP_010094774.1| aluminum-activated malate transporter 9 [Mor... 70 9e-11 ref|XP_022890435.1| aluminum-activated malate transporter 4-like... 69 1e-10 ref|XP_022135510.1| aluminum-activated malate transporter 9 [Mom... 69 1e-10 ref|XP_008243200.1| PREDICTED: aluminum-activated malate transpo... 67 5e-10 ref|XP_007222460.1| aluminum-activated malate transporter 4 [Pru... 67 5e-10 gb|PON36824.1| Aluminum-activated malate transporter [Parasponia... 67 5e-10 gb|PON36820.1| Aluminum-activated malate transporter [Parasponia... 67 7e-10 gb|KVI07595.1| Aluminum-activated malate transporter [Cynara car... 67 7e-10 ref|XP_014633361.1| PREDICTED: aluminum-activated malate transpo... 66 1e-09 gb|PIN02783.1| putative membrane protein [Handroanthus impetigin... 66 1e-09 gb|PIN03455.1| putative membrane protein [Handroanthus impetigin... 66 1e-09 gb|PON94478.1| Aluminum-activated malate transporter [Trema orie... 66 1e-09 gb|KHN20718.1| Aluminum-activated malate transporter 9 [Glycine ... 66 1e-09 ref|XP_003530009.2| PREDICTED: aluminum-activated malate transpo... 66 1e-09 >ref|XP_017241523.1| PREDICTED: aluminum-activated malate transporter 4-like [Daucus carota subsp. sativus] gb|KZN01798.1| hypothetical protein DCAR_010552 [Daucus carota subsp. sativus] Length = 577 Score = 73.6 bits (179), Expect = 4e-12 Identities = 37/46 (80%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTAT-TEPVGFWTRLCNWIC 137 FVARLQNLVNSFE LSEKAKF EPV+ TA TE VGFWTRL WIC Sbjct: 532 FVARLQNLVNSFEALSEKAKFVEPVEQTAAPTEAVGFWTRLYKWIC 577 >emb|CDP04954.1| unnamed protein product [Coffea canephora] Length = 496 Score = 72.0 bits (175), Expect = 1e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWI 134 FVARLQN+V+SFEELSEKAKFKEPVDPT T EP+ FW RL I Sbjct: 453 FVARLQNIVHSFEELSEKAKFKEPVDPTETKEPLNFWRRLLKCI 496 >ref|XP_011075828.1| aluminum-activated malate transporter 4 [Sesamum indicum] Length = 582 Score = 71.2 bits (173), Expect = 2e-11 Identities = 35/48 (72%), Positives = 37/48 (77%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVNSFEELSEKA+F EPVD T T VGFW +L IC KD Sbjct: 535 FVARLQNLVNSFEELSEKAQFSEPVDSTETKVVVGFWAKLLKRICCKD 582 >ref|XP_022890439.1| aluminum-activated malate transporter 9-like isoform X3 [Olea europaea var. sylvestris] Length = 543 Score = 69.7 bits (169), Expect = 8e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVNSFEELS+KAKFK+PVD T VG WTRL +IC+KD Sbjct: 497 FVARLQNLVNSFEELSKKAKFKDPVD-IIDTPVVGIWTRLFKFICYKD 543 >ref|XP_022890438.1| aluminum-activated malate transporter 4-like isoform X2 [Olea europaea var. sylvestris] Length = 565 Score = 69.7 bits (169), Expect = 8e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVNSFEELS+KAKFK+PVD T VG WTRL +IC+KD Sbjct: 519 FVARLQNLVNSFEELSKKAKFKDPVD-IIDTPVVGIWTRLFKFICYKD 565 >ref|XP_022890437.1| aluminum-activated malate transporter 4-like isoform X1 [Olea europaea var. sylvestris] Length = 572 Score = 69.7 bits (169), Expect = 8e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVNSFEELS+KAKFK+PVD T VG WTRL +IC+KD Sbjct: 526 FVARLQNLVNSFEELSKKAKFKDPVD-IIDTPVVGIWTRLFKFICYKD 572 >ref|XP_010094774.1| aluminum-activated malate transporter 9 [Morus notabilis] gb|EXB56939.1| Aluminum-activated malate transporter 9 [Morus notabilis] Length = 608 Score = 69.7 bits (169), Expect = 9e-11 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICF 140 FVARLQ+LV+SFEELSEKAKFKEPV+ TTE GFWTRL N + F Sbjct: 561 FVARLQHLVDSFEELSEKAKFKEPVESLETTESTGFWTRLFNCLKF 606 >ref|XP_022890435.1| aluminum-activated malate transporter 4-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022890436.1| aluminum-activated malate transporter 4-like isoform X2 [Olea europaea var. sylvestris] Length = 572 Score = 69.3 bits (168), Expect = 1e-10 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVNSFEELSEKAKFK+PVD T VG WTRL +IC KD Sbjct: 526 FVARLQNLVNSFEELSEKAKFKDPVD-IIDTPVVGIWTRLFKFICCKD 572 >ref|XP_022135510.1| aluminum-activated malate transporter 9 [Momordica charantia] Length = 584 Score = 69.3 bits (168), Expect = 1e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFK 143 FVARLQNLV+S+EELSE+AKFK+PV+ +T++P GFW R CN CFK Sbjct: 539 FVARLQNLVDSYEELSERAKFKDPVELISTSKPPGFWRRFCN--CFK 583 >ref|XP_008243200.1| PREDICTED: aluminum-activated malate transporter 4 [Prunus mume] Length = 571 Score = 67.4 bits (163), Expect = 5e-10 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDP-TATTEPVGFWTRLCNWICFKD 146 FVARLQNLV+ F+ELSEKAKFK+PVDP E VGFWTRL W+ K+ Sbjct: 523 FVARLQNLVDEFKELSEKAKFKDPVDPFEVKEEVVGFWTRLLRWLRLKN 571 >ref|XP_007222460.1| aluminum-activated malate transporter 4 [Prunus persica] gb|ONI31353.1| hypothetical protein PRUPE_1G308100 [Prunus persica] Length = 571 Score = 67.4 bits (163), Expect = 5e-10 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDP-TATTEPVGFWTRLCNWICFKD 146 FVARLQNLV+ F+ELSEKAKFK+PVDP E VGFWTRL W+ K+ Sbjct: 523 FVARLQNLVDEFKELSEKAKFKDPVDPFEVKDEVVGFWTRLLRWLRLKN 571 >gb|PON36824.1| Aluminum-activated malate transporter [Parasponia andersonii] Length = 610 Score = 67.4 bits (163), Expect = 5e-10 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFK 143 +VARLQNLV+SFEELSEKAKFKEPVD T E GFWTR+ N C K Sbjct: 565 YVARLQNLVDSFEELSEKAKFKEPVDSPETVESNGFWTRIFN--CLK 609 >gb|PON36820.1| Aluminum-activated malate transporter [Parasponia andersonii] Length = 444 Score = 67.0 bits (162), Expect = 7e-10 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFK 143 FVARLQNLV+SFEELSEKAKFKEPV+ T E GFWTR+ N C K Sbjct: 399 FVARLQNLVDSFEELSEKAKFKEPVESPETVESNGFWTRVVN--CLK 443 >gb|KVI07595.1| Aluminum-activated malate transporter [Cynara cardunculus var. scolymus] Length = 489 Score = 67.0 bits (162), Expect = 7e-10 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNL++SFEELSEKAKF EPV+P E VG WTRL I KD Sbjct: 442 FVARLQNLLSSFEELSEKAKFSEPVNPLEAKEEVGIWTRLLKCIGIKD 489 >ref|XP_014633361.1| PREDICTED: aluminum-activated malate transporter 9 isoform X2 [Glycine max] Length = 550 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLV+SFEEL EKAKFK+P++ T GFW RLCN + FKD Sbjct: 504 FVARLQNLVDSFEELGEKAKFKDPLEQAPPTSG-GFWNRLCNCLTFKD 550 >gb|PIN02783.1| putative membrane protein [Handroanthus impetiginosus] Length = 579 Score = 66.2 bits (160), Expect = 1e-09 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFK 143 FVARLQNLVNSFEELSEKA+F+EPV T T W RL W+C K Sbjct: 533 FVARLQNLVNSFEELSEKAQFREPVGSTETQASNSLWARLLRWVCRK 579 >gb|PIN03455.1| putative membrane protein [Handroanthus impetiginosus] Length = 582 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLVN+FE+LSEKAKF EP++ T T E +GFW +L +C +D Sbjct: 535 FVARLQNLVNAFEDLSEKAKFSEPLEGTETKEVLGFWGQLLRCLCCRD 582 >gb|PON94478.1| Aluminum-activated malate transporter [Trema orientalis] Length = 584 Score = 66.2 bits (160), Expect = 1e-09 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFK 143 FVARLQNL++SFEELSEKAKFKEPV+ T E GFWTR+ N C K Sbjct: 539 FVARLQNLIDSFEELSEKAKFKEPVESPETVESNGFWTRVFN--CLK 583 >gb|KHN20718.1| Aluminum-activated malate transporter 9 [Glycine soja] Length = 596 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLV+SFEEL EKAKFK+P++ T GFW RLCN + FKD Sbjct: 550 FVARLQNLVDSFEELGEKAKFKDPLEQAPPTSG-GFWNRLCNCLTFKD 596 >ref|XP_003530009.2| PREDICTED: aluminum-activated malate transporter 9 isoform X1 [Glycine max] gb|KRH48465.1| hypothetical protein GLYMA_07G090300 [Glycine max] Length = 596 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +3 Query: 3 FVARLQNLVNSFEELSEKAKFKEPVDPTATTEPVGFWTRLCNWICFKD 146 FVARLQNLV+SFEEL EKAKFK+P++ T GFW RLCN + FKD Sbjct: 550 FVARLQNLVDSFEELGEKAKFKDPLEQAPPTSG-GFWNRLCNCLTFKD 596