BLASTX nr result
ID: Acanthopanax21_contig00028825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00028825 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN07778.1| hypothetical protein DCAR_008615 [Daucus carota s... 85 4e-16 ref|XP_017231116.1| PREDICTED: LOW QUALITY PROTEIN: AT-rich inte... 85 4e-16 gb|KZN06098.1| hypothetical protein DCAR_006935 [Daucus carota s... 82 8e-16 ref|XP_017232425.1| PREDICTED: AT-rich interactive domain-contai... 82 4e-15 ref|XP_017232424.1| PREDICTED: AT-rich interactive domain-contai... 82 4e-15 ref|XP_020547578.1| AT-rich interactive domain-containing protei... 82 5e-15 gb|PHU04546.1| hypothetical protein BC332_25368 [Capsicum chinense] 76 2e-13 gb|PHT35872.1| hypothetical protein CQW23_23572 [Capsicum baccatum] 76 4e-13 ref|XP_016545492.1| PREDICTED: AT-rich interactive domain-contai... 76 4e-13 gb|PIN18587.1| hypothetical protein CDL12_08741 [Handroanthus im... 76 5e-13 ref|XP_019158724.1| PREDICTED: AT-rich interactive domain-contai... 76 5e-13 emb|CDP08791.1| unnamed protein product [Coffea canephora] 75 9e-13 ref|XP_019252191.1| PREDICTED: AT-rich interactive domain-contai... 74 3e-12 ref|XP_009783361.1| PREDICTED: AT-rich interactive domain-contai... 74 3e-12 ref|XP_016440025.1| PREDICTED: AT-rich interactive domain-contai... 74 4e-12 ref|XP_009617230.1| PREDICTED: AT-rich interactive domain-contai... 74 4e-12 ref|XP_022999917.1| AT-rich interactive domain-containing protei... 73 5e-12 ref|XP_022002977.1| AT-rich interactive domain-containing protei... 73 5e-12 ref|XP_022002976.1| AT-rich interactive domain-containing protei... 73 6e-12 ref|XP_016472755.1| PREDICTED: AT-rich interactive domain-contai... 72 1e-11 >gb|KZN07778.1| hypothetical protein DCAR_008615 [Daucus carota subsp. sativus] Length = 634 Score = 85.1 bits (209), Expect = 4e-16 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS P EI SD D+ +TT+C G++KSP YCSPKK H Sbjct: 565 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLEFETTTNCSGHGAMKSPKFNYCSPKKTH 624 Query: 318 MNF 310 +NF Sbjct: 625 LNF 627 >ref|XP_017231116.1| PREDICTED: LOW QUALITY PROTEIN: AT-rich interactive domain-containing protein 2 [Daucus carota subsp. sativus] Length = 666 Score = 85.1 bits (209), Expect = 4e-16 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS P EI SD D+ +TT+C G++KSP YCSPKK H Sbjct: 597 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLEFETTTNCSGHGAMKSPKFNYCSPKKTH 656 Query: 318 MNF 310 +NF Sbjct: 657 LNF 659 >gb|KZN06098.1| hypothetical protein DCAR_006935 [Daucus carota subsp. sativus] Length = 269 Score = 82.4 bits (202), Expect = 8e-16 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS P EI SD D+ +TT+C Q ++SP YCSPKK H Sbjct: 206 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 265 Query: 318 MNF 310 +NF Sbjct: 266 LNF 268 >ref|XP_017232425.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Daucus carota subsp. sativus] Length = 628 Score = 82.4 bits (202), Expect = 4e-15 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS P EI SD D+ +TT+C Q ++SP YCSPKK H Sbjct: 565 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 624 Query: 318 MNF 310 +NF Sbjct: 625 LNF 627 >ref|XP_017232424.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Daucus carota subsp. sativus] Length = 629 Score = 82.4 bits (202), Expect = 4e-15 Identities = 40/63 (63%), Positives = 46/63 (73%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS P EI SD D+ +TT+C Q ++SP YCSPKK H Sbjct: 566 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 625 Query: 318 MNF 310 +NF Sbjct: 626 LNF 628 >ref|XP_020547578.1| AT-rich interactive domain-containing protein 1 [Sesamum indicum] Length = 590 Score = 82.0 bits (201), Expect = 5e-15 Identities = 40/62 (64%), Positives = 47/62 (75%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNRS+ S+IDSD +E G + Q + KSPGSI+CSPKK+H Sbjct: 527 LVSYYFNVFLLRRRGQQNRSSTSKIDSDDEESEFGPIANKFGQIAAKSPGSIFCSPKKSH 586 Query: 318 MN 313 N Sbjct: 587 SN 588 >gb|PHU04546.1| hypothetical protein BC332_25368 [Capsicum chinense] Length = 286 Score = 76.3 bits (186), Expect = 2e-13 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRG QNR+T S IDSD DEP G T+C + S SI+CSPKKAH Sbjct: 226 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 282 Query: 318 MN 313 ++ Sbjct: 283 LD 284 >gb|PHT35872.1| hypothetical protein CQW23_23572 [Capsicum baccatum] Length = 456 Score = 76.3 bits (186), Expect = 4e-13 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRG QNR+T S IDSD DEP G T+C + S SI+CSPKKAH Sbjct: 396 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 452 Query: 318 MN 313 ++ Sbjct: 453 LD 454 >ref|XP_016545492.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Capsicum annuum] gb|PHT70015.1| hypothetical protein T459_25119 [Capsicum annuum] Length = 456 Score = 76.3 bits (186), Expect = 4e-13 Identities = 39/62 (62%), Positives = 46/62 (74%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRG QNR+T S IDSD DEP G T+C + S SI+CSPKKAH Sbjct: 396 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 452 Query: 318 MN 313 ++ Sbjct: 453 LD 454 >gb|PIN18587.1| hypothetical protein CDL12_08741 [Handroanthus impetiginosus] Length = 570 Score = 76.3 bits (186), Expect = 5e-13 Identities = 37/62 (59%), Positives = 43/62 (69%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRR H NRS IDSD +E G + Q + SPGSI+CSPKK+H Sbjct: 507 LVSYYFNVFLLRRRIHHNRSNAGNIDSDDEESEFGPIANRFGQMAATSPGSIFCSPKKSH 566 Query: 318 MN 313 +N Sbjct: 567 LN 568 >ref|XP_019158724.1| PREDICTED: AT-rich interactive domain-containing protein 1 [Ipomoea nil] Length = 584 Score = 76.3 bits (186), Expect = 5e-13 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKA 322 LVSY+FNVFLLRRRGHQNR TP+EIDSD DE G T + +KS SI+CSP KA Sbjct: 522 LVSYHFNVFLLRRRGHQNRFTPTEIDSDDDESRYGPRTKSFGREVVKSSNSIFCSPAKA 580 >emb|CDP08791.1| unnamed protein product [Coffea canephora] Length = 614 Score = 75.5 bits (184), Expect = 9e-13 Identities = 38/62 (61%), Positives = 44/62 (70%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLL RRG+QNR TP++I+SD DE GS K PGSI+CSPKK H Sbjct: 558 LVSYYFNVFLLHRRGYQNRVTPTDINSDDDESE-------SSYGSAKPPGSIFCSPKKPH 610 Query: 318 MN 313 +N Sbjct: 611 LN 612 >ref|XP_019252191.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] ref|XP_019252192.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] ref|XP_019252193.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] gb|OIS99460.1| at-rich interactive domain-containing protein 1 [Nicotiana attenuata] Length = 465 Score = 73.9 bits (180), Expect = 3e-12 Identities = 37/62 (59%), Positives = 45/62 (72%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRGHQNR+ S IDSD DEP G T+C + S SI+CSP+K H Sbjct: 405 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKEH 461 Query: 318 MN 313 ++ Sbjct: 462 LD 463 >ref|XP_009783361.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana sylvestris] ref|XP_016471354.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana tabacum] Length = 465 Score = 73.9 bits (180), Expect = 3e-12 Identities = 37/62 (59%), Positives = 45/62 (72%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRGHQNR+ S IDSD DEP G T+C + S SI+CSP+K H Sbjct: 405 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKEH 461 Query: 318 MN 313 ++ Sbjct: 462 LD 463 >ref|XP_016440025.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Nicotiana tabacum] Length = 463 Score = 73.6 bits (179), Expect = 4e-12 Identities = 37/62 (59%), Positives = 45/62 (72%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRGHQNR+ S IDSD DEP G T+C + S SI+CSP+K H Sbjct: 403 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKDH 459 Query: 318 MN 313 ++ Sbjct: 460 LD 461 >ref|XP_009617230.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana tomentosiformis] ref|XP_016440024.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Nicotiana tabacum] Length = 466 Score = 73.6 bits (179), Expect = 4e-12 Identities = 37/62 (59%), Positives = 45/62 (72%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSY+FNVFLLRRRGHQNR+ S IDSD DEP G T+C + S SI+CSP+K H Sbjct: 406 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKDH 462 Query: 318 MN 313 ++ Sbjct: 463 LD 464 >ref|XP_022999917.1| AT-rich interactive domain-containing protein 1-like isoform X2 [Cucurbita maxima] Length = 399 Score = 73.2 bits (178), Expect = 5e-12 Identities = 39/62 (62%), Positives = 44/62 (70%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYY+NVFLLRRRGHQNR TP++IDSD DE G TT+ SPGSI+ SPKK Sbjct: 338 LVSYYYNVFLLRRRGHQNRVTPNKIDSD-DESESGITTNGFGHEVHNSPGSIFYSPKKPR 396 Query: 318 MN 313 N Sbjct: 397 CN 398 >ref|XP_022002977.1| AT-rich interactive domain-containing protein 1 isoform X2 [Helianthus annuus] Length = 487 Score = 73.2 bits (178), Expect = 5e-12 Identities = 37/62 (59%), Positives = 41/62 (66%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNV+L RRR HQNRS PS IDSD DE + S PGSI+CSPKK H Sbjct: 429 LVSYYFNVYLNRRRAHQNRSDPSNIDSDDDE-----LEKAGNEASSNDPGSIFCSPKKVH 483 Query: 318 MN 313 +N Sbjct: 484 LN 485 >ref|XP_022002976.1| AT-rich interactive domain-containing protein 1 isoform X1 [Helianthus annuus] gb|OTG03669.1| putative ARID/BRIGHT DNA-binding domain,ELM2 domain protein [Helianthus annuus] Length = 554 Score = 73.2 bits (178), Expect = 6e-12 Identities = 37/62 (59%), Positives = 41/62 (66%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNV+L RRR HQNRS PS IDSD DE + S PGSI+CSPKK H Sbjct: 496 LVSYYFNVYLNRRRAHQNRSDPSNIDSDDDE-----LEKAGNEASSNDPGSIFCSPKKVH 550 Query: 318 MN 313 +N Sbjct: 551 LN 552 >ref|XP_016472755.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X3 [Nicotiana tabacum] Length = 594 Score = 72.0 bits (175), Expect = 1e-11 Identities = 37/62 (59%), Positives = 42/62 (67%) Frame = -3 Query: 498 LVSYYFNVFLLRRRGHQNRSTPSEIDSDYDEPGIGSTTDCIKQGSLKSPGSIYCSPKKAH 319 LVSYYFNVFLLRRRG QNR S+IDSD DE G G + C + SI CSPKKAH Sbjct: 535 LVSYYFNVFLLRRRGQQNRMNASDIDSDDDESGCGPRSICFGRDKF----SILCSPKKAH 590 Query: 318 MN 313 ++ Sbjct: 591 LD 592