BLASTX nr result
ID: Acanthopanax21_contig00028678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00028678 (625 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017241772.1| PREDICTED: pentatricopeptide repeat-containi... 103 8e-22 ref|XP_009598735.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-20 gb|PHT98865.1| Pentatricopeptide repeat-containing protein [Caps... 99 2e-20 gb|PHT51245.1| Pentatricopeptide repeat-containing protein [Caps... 99 2e-20 gb|KGN49793.1| hypothetical protein Csa_5G129290 [Cucumis sativus] 92 2e-20 ref|XP_016568498.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-20 ref|XP_016568497.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-20 ref|XP_016472065.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-19 ref|XP_009603001.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-19 ref|XP_009761051.1| PREDICTED: pentatricopeptide repeat-containi... 95 5e-19 ref|XP_014502595.1| pentatricopeptide repeat-containing protein ... 95 5e-19 ref|XP_015073891.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-18 ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-18 ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-18 ref|XP_015902571.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-18 ref|XP_017429218.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-18 ref|XP_015872729.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-18 ref|XP_015871475.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-18 ref|XP_015871421.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 92 4e-18 ref|XP_015870454.1| PREDICTED: pentatricopeptide repeat-containi... 92 4e-18 >ref|XP_017241772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Daucus carota subsp. sativus] gb|KZN01203.1| hypothetical protein DCAR_009957 [Daucus carota subsp. sativus] Length = 882 Score = 103 bits (256), Expect = 8e-22 Identities = 44/59 (74%), Positives = 47/59 (79%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VGS T Q IR+LKSLRMCE CH T KY+SKAY REIY+ DS CLHH KDG CSCGDYW Sbjct: 824 VGSAHTCQPIRILKSLRMCEDCHATIKYVSKAYEREIYICDSNCLHHFKDGSCSCGDYW 882 >ref|XP_009598735.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] ref|XP_009598736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] Length = 251 Score = 96.3 bits (238), Expect = 1e-20 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + + Q+S+ IR++K+LRMCE CHRT K+IS+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 193 IKNPQSSRVIRIVKNLRMCEDCHRTAKFISQKYEREIYIHDSKCLHHFKDGYCSCGNYW 251 >gb|PHT98865.1| Pentatricopeptide repeat-containing protein [Capsicum chinense] Length = 899 Score = 99.4 bits (246), Expect = 2e-20 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + Q+SQ IR++K+LRMCE CHRT K++S+ Y REIYV DSKCLHH KDG+CSCGDYW Sbjct: 841 INHPQSSQVIRIVKNLRMCEDCHRTAKFVSQKYEREIYVHDSKCLHHFKDGNCSCGDYW 899 >gb|PHT51245.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 899 Score = 99.4 bits (246), Expect = 2e-20 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + Q+SQ IR++K+LRMCE CHRT K++S+ Y REIYV DSKCLHH KDG+CSCGDYW Sbjct: 841 INHPQSSQVIRIVKNLRMCEDCHRTAKFVSQKYEREIYVHDSKCLHHFKDGNCSCGDYW 899 >gb|KGN49793.1| hypothetical protein Csa_5G129290 [Cucumis sativus] Length = 134 Score = 92.4 bits (228), Expect = 2e-20 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 +GS+ T ++I+++K+LRMC CH+ KYIS AY EIY+ DSKCLHH K+GHCSCGDYW Sbjct: 76 IGSSHTRKSIKIVKNLRMCVDCHQMAKYISAAYECEIYLSDSKCLHHFKNGHCSCGDYW 134 >ref|XP_016568498.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 isoform X2 [Capsicum annuum] Length = 767 Score = 97.8 bits (242), Expect = 6e-20 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + Q+SQ IR++K+LRMCE CHRT K++S+ Y REIYV DSKCLHH K+G+CSCGDYW Sbjct: 709 INHPQSSQVIRIVKNLRMCEDCHRTAKFVSQKYEREIYVHDSKCLHHFKEGNCSCGDYW 767 >ref|XP_016568497.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 isoform X1 [Capsicum annuum] gb|PHT84864.1| Pentatricopeptide repeat-containing protein [Capsicum annuum] Length = 899 Score = 97.8 bits (242), Expect = 6e-20 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + Q+SQ IR++K+LRMCE CHRT K++S+ Y REIYV DSKCLHH K+G+CSCGDYW Sbjct: 841 INHPQSSQVIRIVKNLRMCEDCHRTAKFVSQKYEREIYVHDSKCLHHFKEGNCSCGDYW 899 >ref|XP_016472065.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tabacum] ref|XP_016472066.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tabacum] Length = 879 Score = 96.3 bits (238), Expect = 2e-19 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + + Q+S+ IR++K+LRMCE CHRT K+IS+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 821 IKNPQSSRVIRIVKNLRMCEDCHRTAKFISQKYEREIYIHDSKCLHHFKDGYCSCGNYW 879 >ref|XP_009603001.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana tomentosiformis] ref|XP_018626895.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana tomentosiformis] Length = 879 Score = 96.3 bits (238), Expect = 2e-19 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + + Q+S+ IR++K+LRMCE CHRT K+IS+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 821 IKNPQSSRVIRIVKNLRMCEDCHRTAKFISQKYEREIYIHDSKCLHHFKDGYCSCGNYW 879 >ref|XP_009761051.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana sylvestris] ref|XP_016468116.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tabacum] Length = 879 Score = 95.1 bits (235), Expect = 5e-19 Identities = 38/59 (64%), Positives = 49/59 (83%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + + Q+S+ IR++K+LRMCE CHRT K IS+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 821 INNPQSSRVIRIVKNLRMCEDCHRTAKCISQEYEREIYIHDSKCLHHFKDGYCSCGNYW 879 >ref|XP_014502595.1| pentatricopeptide repeat-containing protein At1g19720 [Vigna radiata var. radiata] Length = 893 Score = 95.1 bits (235), Expect = 5e-19 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 +GS T Q +R++K+LRMC+ CH T KYIS AYG EIY+ DS CLHH KDGHCSC DYW Sbjct: 835 IGSHHTPQILRIVKNLRMCKDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCNDYW 893 >ref|XP_015073891.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Solanum pennellii] Length = 884 Score = 94.0 bits (232), Expect = 1e-18 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + S Q+S+ IR++K+LRMCE CHR K +S+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 826 INSPQSSRVIRIVKNLRMCEDCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGNYW 884 >ref|XP_006341986.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Solanum tuberosum] Length = 884 Score = 94.0 bits (232), Expect = 1e-18 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + S Q+S+ IR++K+LRMCE CHR K +S+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 826 INSPQSSRVIRIVKNLRMCEDCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGNYW 884 >ref|XP_004238610.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Solanum lycopersicum] Length = 884 Score = 94.0 bits (232), Expect = 1e-18 Identities = 37/59 (62%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 + S Q+S+ IR++K+LRMCE CHR K +S+ Y REIY+ DSKCLHH KDG+CSCG+YW Sbjct: 826 INSPQSSRVIRIVKNLRMCEDCHRIAKLVSQKYEREIYIHDSKCLHHFKDGYCSCGNYW 884 >ref|XP_015902571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Ziziphus jujuba] Length = 393 Score = 92.4 bits (228), Expect = 2e-18 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VG + +TIR++K+LRMC CH+T KYIS AYG EIY++DSKCLH+ +GHCSCGDYW Sbjct: 335 VGFSSKPRTIRMVKNLRMCGDCHKTAKYISVAYGCEIYLKDSKCLHYFSNGHCSCGDYW 393 >ref|XP_017429218.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Vigna angularis] dbj|BAT81530.1| hypothetical protein VIGAN_03127100 [Vigna angularis var. angularis] Length = 893 Score = 93.2 bits (230), Expect = 2e-18 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 +GS Q +R++K+LRMC+ CH T KYIS AYG EIY+ DS CLHH KDGHCSC DYW Sbjct: 835 IGSHHAPQILRIVKNLRMCKDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCNDYW 893 >ref|XP_015872729.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, partial [Ziziphus jujuba] Length = 578 Score = 92.4 bits (228), Expect = 4e-18 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VG + +TIR++K+LRMC CH+T KYIS AYG EIY++DSKCLH+ +GHCSCGDYW Sbjct: 520 VGFSSKPRTIRMVKNLRMCGDCHKTAKYISVAYGCEIYLKDSKCLHYFSNGHCSCGDYW 578 >ref|XP_015871475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Ziziphus jujuba] Length = 883 Score = 92.4 bits (228), Expect = 4e-18 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VG + +TIR++K+LRMC CH+T KYIS AYG EIY++DSKCLH+ +GHCSCGDYW Sbjct: 825 VGFSSKPRTIRMVKNLRMCGDCHKTAKYISVAYGCEIYLKDSKCLHYFSNGHCSCGDYW 883 >ref|XP_015871421.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g19720-like [Ziziphus jujuba] Length = 883 Score = 92.4 bits (228), Expect = 4e-18 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VG + +TIR++K+LRMC CH+T KYIS AYG EIY++DSKCLH+ +GHCSCGDYW Sbjct: 825 VGFSSKPRTIRMVKNLRMCGDCHKTAKYISVAYGCEIYLKDSKCLHYFSNGHCSCGDYW 883 >ref|XP_015870454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Ziziphus jujuba] Length = 889 Score = 92.4 bits (228), Expect = 4e-18 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +1 Query: 1 VGSTQTSQTIRVLKSLRMCEGCHRTFKYISKAYGREIYVRDSKCLHHIKDGHCSCGDYW 177 VG + +TIR++K+LRMC CH+T KYIS AYG EIY++DSKCLH+ +GHCSCGDYW Sbjct: 831 VGFSSKPRTIRMVKNLRMCGDCHKTAKYISVAYGCEIYLKDSKCLHYFSNGHCSCGDYW 889