BLASTX nr result
ID: Acanthopanax21_contig00028370
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00028370 (594 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF24270.1| conserved hypothetical protein [Ricinus communis] 62 2e-08 gb|OMO59865.1| hypothetical protein COLO4_34030 [Corchorus olito... 55 3e-07 gb|EEF30422.1| conserved hypothetical protein [Ricinus communis] 55 6e-06 >gb|EEF24270.1| conserved hypothetical protein [Ricinus communis] Length = 224 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +1 Query: 325 MRSKRVPGHHHSTPFLVYFGYNFIYGAIRPSARLD 429 MRSKRVPGHHHSTPFLVYFGYNFIY R + LD Sbjct: 1 MRSKRVPGHHHSTPFLVYFGYNFIYDQGRKPSPLD 35 >gb|OMO59865.1| hypothetical protein COLO4_34030 [Corchorus olitorius] Length = 53 Score = 55.5 bits (132), Expect = 3e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 313 LLQTMRSKRVPGHHHSTPFLVYFG 384 LLQTMRSKRVPGHHHSTPFLVYFG Sbjct: 10 LLQTMRSKRVPGHHHSTPFLVYFG 33 >gb|EEF30422.1| conserved hypothetical protein [Ricinus communis] Length = 178 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 364 EWNDDDRALSWISWFGASGAFLSL 293 EWNDDDRALSWISWFGASG FLSL Sbjct: 21 EWNDDDRALSWISWFGASGVFLSL 44