BLASTX nr result
ID: Acanthopanax21_contig00028074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00028074 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19926.3| unnamed protein product, partial [Vitis vinifera] 102 2e-22 ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containi... 102 3e-22 emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] 100 2e-21 gb|KZN08566.1| hypothetical protein DCAR_001096 [Daucus carota s... 99 7e-21 ref|XP_017238179.1| PREDICTED: pentatricopeptide repeat-containi... 99 7e-21 ref|XP_022851435.1| pentatricopeptide repeat-containing protein ... 97 2e-20 gb|KVH99623.1| Pentatricopeptide repeat-containing protein [Cyna... 95 2e-19 gb|PRQ24939.1| putative pentatricopeptide [Rosa chinensis] 91 1e-18 dbj|GAU39230.1| hypothetical protein TSUD_396770 [Trifolium subt... 92 2e-18 ref|XP_013461348.1| PPR containing plant-like protein [Medicago ... 92 2e-18 ref|XP_018808024.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-18 ref|XP_024162425.1| pentatricopeptide repeat-containing protein ... 91 5e-18 gb|KDP43089.1| hypothetical protein JCGZ_25275 [Jatropha curcas] 89 6e-18 ref|XP_012066124.1| pentatricopeptide repeat-containing protein ... 89 2e-17 ref|XP_023872385.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 88 3e-17 ref|XP_004503044.1| PREDICTED: pentatricopeptide repeat-containi... 88 3e-17 gb|PNX71757.1| pentatricopeptide repeat-containing protein mitoc... 87 7e-17 ref|XP_021284736.1| pentatricopeptide repeat-containing protein ... 87 1e-16 ref|XP_022039589.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_020206172.1| pentatricopeptide repeat-containing protein ... 86 1e-16 >emb|CBI19926.3| unnamed protein product, partial [Vitis vinifera] Length = 486 Score = 102 bits (254), Expect = 2e-22 Identities = 50/82 (60%), Positives = 66/82 (80%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA+AYE G E LVRVR+ M+E+G +K++GCSWIGI+N V++F EN+ Sbjct: 315 EPQSSLPY--LVLAQAYEMRGRWESLVRVRRAMKEKGVRKVIGCSWIGIKNHVFVFKENQ 372 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 LLH GKD Y +LRLL+Q++E+ Sbjct: 373 LLHIGGKDIYFILRLLIQEIED 394 >ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Vitis vinifera] Length = 665 Score = 102 bits (254), Expect = 3e-22 Identities = 50/82 (60%), Positives = 66/82 (80%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA+AYE G E LVRVR+ M+E+G +K++GCSWIGI+N V++F EN+ Sbjct: 568 EPQSSLPY--LVLAQAYEMRGRWESLVRVRRAMKEKGVRKVIGCSWIGIKNHVFVFKENQ 625 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 LLH GKD Y +LRLL+Q++E+ Sbjct: 626 LLHIGGKDIYFILRLLIQEIED 647 >emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] Length = 1796 Score = 100 bits (248), Expect = 2e-21 Identities = 49/82 (59%), Positives = 65/82 (79%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA+AYE G E LVRV + M+E+G +K++GCSWIGI+N V++F EN+ Sbjct: 1241 EPQSSLPY--LVLAQAYEMRGRWESLVRVXRAMKEKGVRKVIGCSWIGIKNHVFVFKENQ 1298 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 LLH GKD Y +LRLL+Q++E+ Sbjct: 1299 LLHIGGKDIYFILRLLIQEIED 1320 >gb|KZN08566.1| hypothetical protein DCAR_001096 [Daucus carota subsp. sativus] Length = 605 Score = 98.6 bits (244), Expect = 7e-21 Identities = 55/84 (65%), Positives = 61/84 (72%) Frame = -3 Query: 378 DPEPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNE 199 D EPQ LPY LVLAKAYER G E LVRVRK ME R K+MVG S +GIRNRVYLF E Sbjct: 516 DLEPQLSLPY--LVLAKAYERRGRWESLVRVRKAMEARHVKEMVGFSSVGIRNRVYLFRE 573 Query: 198 NKLLHHVGKDTYRLLRLLMQDMEN 127 N+LLH G D Y LRLL +D+E+ Sbjct: 574 NQLLHCGGNDIYSTLRLLQEDVEH 597 >ref|XP_017238179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Daucus carota subsp. sativus] ref|XP_017238187.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Daucus carota subsp. sativus] Length = 633 Score = 98.6 bits (244), Expect = 7e-21 Identities = 55/84 (65%), Positives = 61/84 (72%) Frame = -3 Query: 378 DPEPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNE 199 D EPQ LPY LVLAKAYER G E LVRVRK ME R K+MVG S +GIRNRVYLF E Sbjct: 544 DLEPQLSLPY--LVLAKAYERRGRWESLVRVRKAMEARHVKEMVGFSSVGIRNRVYLFRE 601 Query: 198 NKLLHHVGKDTYRLLRLLMQDMEN 127 N+LLH G D Y LRLL +D+E+ Sbjct: 602 NQLLHCGGNDIYSTLRLLQEDVEH 625 >ref|XP_022851435.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Olea europaea var. sylvestris] ref|XP_022851436.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Olea europaea var. sylvestris] Length = 639 Score = 97.4 bits (241), Expect = 2e-20 Identities = 48/81 (59%), Positives = 62/81 (76%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA AYE+ G E LVRVRKVME+ KK+VGCSWIG+++ VY F N+ Sbjct: 548 EPQSSLPY--LVLADAYEQRGKWESLVRVRKVMEKMPTKKVVGCSWIGLKDHVYAFEANQ 605 Query: 192 LLHHVGKDTYRLLRLLMQDME 130 ++ H GKD Y +L+LLMQ+++ Sbjct: 606 MIQHGGKDVYLILKLLMQEVQ 626 >gb|KVH99623.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 632 Score = 94.7 bits (234), Expect = 2e-19 Identities = 46/81 (56%), Positives = 60/81 (74%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EP S LPY LVL KAYE G E L RV+K M +R K++GCSWIGI++R++LF EN+ Sbjct: 549 EPMSSLPY--LVLGKAYEVRGRWESLARVKKAMNDRNITKVMGCSWIGIKSRLFLFKENE 606 Query: 192 LLHHVGKDTYRLLRLLMQDME 130 ++HH G+D + LRLLMQD+E Sbjct: 607 VVHHGGEDVFSTLRLLMQDIE 627 >gb|PRQ24939.1| putative pentatricopeptide [Rosa chinensis] Length = 319 Score = 90.5 bits (223), Expect = 1e-18 Identities = 45/81 (55%), Positives = 57/81 (70%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA+AYE G E ++RV K M+ +G K ++GCSWI I+N VY F ++ Sbjct: 229 EPQSSLPY--LVLARAYEMRGRWESMIRVTKEMKHKGVKNVIGCSWIEIQNHVYTFKADQ 286 Query: 192 LLHHVGKDTYRLLRLLMQDME 130 L HH GKD Y +LRLL +ME Sbjct: 287 LQHHRGKDIYMILRLLSWEME 307 >dbj|GAU39230.1| hypothetical protein TSUD_396770 [Trifolium subterraneum] Length = 524 Score = 91.7 bits (226), Expect = 2e-18 Identities = 44/80 (55%), Positives = 58/80 (72%) Frame = -3 Query: 369 PQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENKL 190 PQ+ LPY LVL++ Y+ G E VRVRK ME RG+K+++GCSW+GI+N VY F N+L Sbjct: 441 PQTTLPY--LVLSQIYQMNGRWESKVRVRKAMENRGSKELIGCSWVGIKNHVYTFESNQL 498 Query: 189 LHHVGKDTYRLLRLLMQDME 130 H+ GKD Y LL LL+ +ME Sbjct: 499 QHYGGKDIYLLLNLLVWEME 518 >ref|XP_013461348.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH35383.1| PPR containing plant-like protein [Medicago truncatula] Length = 629 Score = 91.7 bits (226), Expect = 2e-18 Identities = 45/80 (56%), Positives = 56/80 (70%) Frame = -3 Query: 369 PQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENKL 190 PQ LPY LVLA+ Y+ G E VRVRK ME RG+K+ +GCSW+GI+N VY F N+L Sbjct: 547 PQISLPY--LVLAQVYQMSGRWESAVRVRKAMENRGSKEFIGCSWVGIKNHVYTFESNQL 604 Query: 189 LHHVGKDTYRLLRLLMQDME 130 H+ GKD Y LL LL+ +ME Sbjct: 605 QHYGGKDIYLLLNLLVWEME 624 >ref|XP_018808024.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Juglans regia] Length = 646 Score = 91.7 bits (226), Expect = 2e-18 Identities = 46/82 (56%), Positives = 61/82 (74%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY +VLA+AYE G E + RV K M+++ KK+ GCSWIGI+N +Y F E++ Sbjct: 547 EPQSSLPY--MVLARAYEMRGRWESMARVIKSMKQKVIKKVSGCSWIGIKNLIYTFEEDQ 604 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 LLHH GKD Y +LRLL+ +ME+ Sbjct: 605 LLHHGGKDIYLVLRLLIFEMED 626 >ref|XP_024162425.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Rosa chinensis] ref|XP_024162426.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Rosa chinensis] ref|XP_024162427.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Rosa chinensis] ref|XP_024162428.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Rosa chinensis] Length = 637 Score = 90.5 bits (223), Expect = 5e-18 Identities = 45/81 (55%), Positives = 57/81 (70%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVLA+AYE G E ++RV K M+ +G K ++GCSWI I+N VY F ++ Sbjct: 547 EPQSSLPY--LVLARAYEMRGRWESMIRVTKEMKHKGVKNVIGCSWIEIQNHVYTFKADQ 604 Query: 192 LLHHVGKDTYRLLRLLMQDME 130 L HH GKD Y +LRLL +ME Sbjct: 605 LQHHRGKDIYMILRLLSWEME 625 >gb|KDP43089.1| hypothetical protein JCGZ_25275 [Jatropha curcas] Length = 317 Score = 88.6 bits (218), Expect = 6e-18 Identities = 45/82 (54%), Positives = 57/82 (69%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY VLA+ Y E +VRV+K +E + K+++GCSWIGIRN VY F ++ Sbjct: 228 EPQSSLPY--FVLARIYGSRSQWEGMVRVKKTVERKKMKRVIGCSWIGIRNHVYTFKADQ 285 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 L HH GKDTY LLRLL ++EN Sbjct: 286 LQHHGGKDTYLLLRLLDWEIEN 307 >ref|XP_012066124.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Jatropha curcas] Length = 636 Score = 88.6 bits (218), Expect = 2e-17 Identities = 45/82 (54%), Positives = 57/82 (69%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY VLA+ Y E +VRV+K +E + K+++GCSWIGIRN VY F ++ Sbjct: 547 EPQSSLPY--FVLARIYGSRSQWEGMVRVKKTVERKKMKRVIGCSWIGIRNHVYTFKADQ 604 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 L HH GKDTY LLRLL ++EN Sbjct: 605 LQHHGGKDTYLLLRLLDWEIEN 626 >ref|XP_023872385.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Quercus suber] Length = 637 Score = 88.2 bits (217), Expect = 3e-17 Identities = 44/82 (53%), Positives = 58/82 (70%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVL+ AYE G E +VRVR M + KK+ GCSWIGI+N +Y+F ++ Sbjct: 547 EPQSSLPY--LVLSLAYEMRGRWESIVRVRNSMXHKLVKKVTGCSWIGIKNHIYMFKADQ 604 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 +LHH G+D Y +LRLL +ME+ Sbjct: 605 VLHHGGEDIYLVLRLLTGEMED 626 >ref|XP_004503044.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Cicer arietinum] Length = 643 Score = 88.2 bits (217), Expect = 3e-17 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -3 Query: 369 PQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENKL 190 P++ LPY LVLA+AY+ G E +VRVRK M+ RG K+ GCSW+GI+N +Y F N+L Sbjct: 547 PKTTLPY--LVLAQAYQMRGRWESMVRVRKAMKNRGTKEFTGCSWVGIKNHLYTFESNQL 604 Query: 189 LHHVGKDTYRLLRLLMQDME 130 H+ GKD Y LL LL +ME Sbjct: 605 QHYGGKDLYLLLNLLAWEME 624 >gb|PNX71757.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 524 Score = 87.0 bits (214), Expect = 7e-17 Identities = 43/80 (53%), Positives = 55/80 (68%) Frame = -3 Query: 369 PQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENKL 190 PQ+ LPY LVLA Y+ E VRVRK ME RG K+++GCSW+GIRN VY F ++L Sbjct: 441 PQTTLPY--LVLAHIYQMSDRWESTVRVRKAMENRGTKELIGCSWVGIRNHVYTFESDQL 498 Query: 189 LHHVGKDTYRLLRLLMQDME 130 H+ GKD Y LL LL+ ++E Sbjct: 499 QHYGGKDIYLLLNLLVWEIE 518 >ref|XP_021284736.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Herrania umbratica] Length = 645 Score = 86.7 bits (213), Expect = 1e-16 Identities = 46/81 (56%), Positives = 58/81 (71%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EPQS LPY LVL +AYE G E ++RVRK M+ R KK+VGCSWIGI+N VY+F ++ Sbjct: 546 EPQSSLPY--LVLNRAYEMRGRWEGMIRVRKAMKSR-LKKIVGCSWIGIKNHVYMFQADQ 602 Query: 192 LLHHVGKDTYRLLRLLMQDME 130 L H G+D Y +LRLL D+E Sbjct: 603 LHHDGGRDIYLILRLLTWDLE 623 >ref|XP_022039589.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Helianthus annuus] gb|OTG35808.1| putative pentatricopeptide repeat-containing protein [Helianthus annuus] Length = 620 Score = 86.3 bits (212), Expect = 1e-16 Identities = 42/82 (51%), Positives = 60/82 (73%) Frame = -3 Query: 372 EPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNENK 193 EP S + Y+ L KAYE G E + RV+KVM++R K+VGCSWIG+ + +++FNEN+ Sbjct: 537 EPMSL--FAYMALVKAYEARGRWESVARVKKVMKDRNVAKVVGCSWIGV-DGLFVFNENE 593 Query: 192 LLHHVGKDTYRLLRLLMQDMEN 127 ++HH G+D Y LRLLMQD+E+ Sbjct: 594 VVHHGGEDVYSALRLLMQDIED 615 >ref|XP_020206172.1| pentatricopeptide repeat-containing protein At1g43980, mitochondrial [Cajanus cajan] Length = 631 Score = 86.3 bits (212), Expect = 1e-16 Identities = 45/84 (53%), Positives = 59/84 (70%) Frame = -3 Query: 378 DPEPQSCLPYNYLVLAKAYERGGI*ERLVRVRKVMEERGAKKMVGCSWIGIRNRVYLFNE 199 D E Q+ LPY LVLA+AY+ G E +VR+RK +E RG K+ +G SWIGI+N VY F Sbjct: 546 DRESQTYLPY--LVLAQAYQIRGRWETMVRMRKAVENRGTKEFIGHSWIGIKNNVYTFAS 603 Query: 198 NKLLHHVGKDTYRLLRLLMQDMEN 127 N+L H+ GKD Y LL LL+ +ME+ Sbjct: 604 NQLQHYGGKDLYLLLNLLVWEMES 627