BLASTX nr result
ID: Acanthopanax21_contig00027726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00027726 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018851682.1| PREDICTED: uncharacterized protein LOC109013... 54 1e-06 >ref|XP_018851682.1| PREDICTED: uncharacterized protein LOC109013892 [Juglans regia] Length = 88 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -3 Query: 363 KEQ*QRERNMVCQEA*QVVQGLPSESSSPYVKYNDLDDYKRRGYGTSTQTTP 208 K+Q QRER + +E ++ +GLP E S PYVKYNDL+DYKR+GYGT P Sbjct: 3 KQQEQRERKLENEEKGKL-EGLPWEES-PYVKYNDLEDYKRQGYGTEGHIQP 52