BLASTX nr result
ID: Acanthopanax21_contig00027408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00027408 (703 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM91229.1| hypothetical protein DCAR_021406 [Daucus carota s... 94 4e-18 ref|XP_017258264.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-18 ref|XP_021984226.1| pentatricopeptide repeat-containing protein ... 70 3e-10 gb|ONI07853.1| hypothetical protein PRUPE_5G142900 [Prunus persica] 67 4e-09 ref|XP_020419301.1| pentatricopeptide repeat-containing protein ... 67 4e-09 ref|XP_008374170.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_021814561.1| pentatricopeptide repeat-containing protein ... 67 6e-09 ref|XP_019169899.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_008239557.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_011040265.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|XP_011040263.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 dbj|GAV60182.1| PPR domain-containing protein/PPR_1 domain-conta... 63 1e-07 ref|XP_002321748.2| pentatricopeptide repeat-containing family p... 62 2e-07 gb|PNT01502.1| hypothetical protein POPTR_015G105400v3 [Populus ... 62 2e-07 ref|XP_011463221.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_024170855.1| pentatricopeptide repeat-containing protein ... 62 3e-07 ref|XP_019243407.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_018505647.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_018499034.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_008392706.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 >gb|KZM91229.1| hypothetical protein DCAR_021406 [Daucus carota subsp. sativus] Length = 846 Score = 93.6 bits (231), Expect = 4e-18 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 GKQGL L ATC T+VH LYN+ +E++VA +L+ MV+FGWVP ST+ +DL ++HKK+S S Sbjct: 775 GKQGLMLSFATCKTVVHGLYNSKHENEVAQVLKSMVKFGWVPRSTSLADLTDDHKKNSVS 834 Query: 522 GDVRHVSSQVAY 487 GDV VS QVAY Sbjct: 835 GDVMRVSEQVAY 846 >ref|XP_017258264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Daucus carota subsp. sativus] ref|XP_017258266.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Daucus carota subsp. sativus] Length = 1015 Score = 93.6 bits (231), Expect = 4e-18 Identities = 44/72 (61%), Positives = 57/72 (79%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 GKQGL L ATC T+VH LYN+ +E++VA +L+ MV+FGWVP ST+ +DL ++HKK+S S Sbjct: 944 GKQGLMLSFATCKTVVHGLYNSKHENEVAQVLKSMVKFGWVPRSTSLADLTDDHKKNSVS 1003 Query: 522 GDVRHVSSQVAY 487 GDV VS QVAY Sbjct: 1004 GDVMRVSEQVAY 1015 >ref|XP_021984226.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Helianthus annuus] gb|OTG16669.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 915 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/57 (52%), Positives = 45/57 (78%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKD 532 GK+G+ L ATCSTLVH+L++AGY++K+A +LE M FGWVP +++ +D I +H+ D Sbjct: 844 GKRGVMLSFATCSTLVHKLHSAGYKNKLAEVLESMEGFGWVPQASSLTDFIQQHEAD 900 >gb|ONI07853.1| hypothetical protein PRUPE_5G142900 [Prunus persica] Length = 981 Score = 67.0 bits (162), Expect = 4e-09 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A ILE M+ FGWV ST+ SDLINE + ++ S Sbjct: 919 GEQGFALSLATCSTLVRGFYRLGNVEKAARILESMLSFGWVSQSTSLSDLINEDRNEASS 978 Query: 522 G 520 G Sbjct: 979 G 979 >ref|XP_020419301.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Prunus persica] gb|ONI07854.1| hypothetical protein PRUPE_5G142900 [Prunus persica] Length = 1019 Score = 67.0 bits (162), Expect = 4e-09 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A ILE M+ FGWV ST+ SDLINE + ++ S Sbjct: 957 GEQGFALSLATCSTLVRGFYRLGNVEKAARILESMLSFGWVSQSTSLSDLINEDRNEASS 1016 Query: 522 G 520 G Sbjct: 1017 G 1017 >ref|XP_008374170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Malus domestica] Length = 1026 Score = 67.0 bits (162), Expect = 4e-09 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLVH Y G +K A I E M+RFGWV ST+ DLI+E + ++ S Sbjct: 964 GEQGFVLSLATCSTLVHGFYKLGNGEKAARIFESMLRFGWVSQSTSLDDLIHEDQSEASS 1023 Query: 522 G 520 G Sbjct: 1024 G 1024 >ref|XP_021814561.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Prunus avium] Length = 1019 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A ILE M+ FGWV ST+ SDLINE + ++ S Sbjct: 957 GEQGFALSLATCSTLVRGFYRLGNVEKAARILESMLSFGWVSPSTSLSDLINEDRNEASS 1016 Query: 522 G 520 G Sbjct: 1017 G 1017 >ref|XP_019169899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] ref|XP_019169900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] ref|XP_019169901.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] Length = 1031 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEH 541 GKQG CSTLVH L AGY +K+A LE MVRF WVP STT SDLI+++ Sbjct: 954 GKQGFVPSVTMCSTLVHGLNKAGYSEKLAAALETMVRFSWVPKSTTLSDLISQY 1007 >ref|XP_008239557.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Prunus mume] ref|XP_016651361.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Prunus mume] Length = 1019 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A ILE M+ FGWV ST+ SDLINE + ++ S Sbjct: 957 GEQGFALSLATCSTLVCGFYRLGNVEKAARILESMLSFGWVSQSTSLSDLINEDQNEASS 1016 Query: 522 G 520 G Sbjct: 1017 G 1017 >ref|XP_011040265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X2 [Populus euphratica] Length = 803 Score = 63.2 bits (152), Expect = 9e-08 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 699 KQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYSG 520 +QGL L ATCS LV + AG D A +L+ MVRF WVPDST +DLINE + + S Sbjct: 725 EQGLNLSLATCSALVRCFHKAGKMDSAARVLKSMVRFKWVPDSTGLNDLINEEQGSTDSE 784 Query: 519 DVRHVSSQVAYQ 484 + Q+A++ Sbjct: 785 NAGDFLKQMAWE 796 >ref|XP_011040263.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X1 [Populus euphratica] ref|XP_011040264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial isoform X1 [Populus euphratica] Length = 1041 Score = 63.2 bits (152), Expect = 9e-08 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 699 KQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYSG 520 +QGL L ATCS LV + AG D A +L+ MVRF WVPDST +DLINE + + S Sbjct: 963 EQGLNLSLATCSALVRCFHKAGKMDSAARVLKSMVRFKWVPDSTGLNDLINEEQGSTDSE 1022 Query: 519 DVRHVSSQVAYQ 484 + Q+A++ Sbjct: 1023 NAGDFLKQMAWE 1034 >dbj|GAV60182.1| PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 1000 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -2 Query: 696 QGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLIN 547 QGL L ATCS LV Y AG DK A ++E MVRFGWVPDS+ +D++N Sbjct: 927 QGLKLSPATCSNLVRGFYEAGSMDKAARVVEGMVRFGWVPDSSDVNDMVN 976 >ref|XP_002321748.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1026 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 699 KQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYSG 520 +QGL L ATCSTLV + AG D A +L+ MVRF WVPDST +DLIN + + S Sbjct: 948 EQGLNLSLATCSTLVRCFHKAGKMDGAARVLKSMVRFKWVPDSTELNDLINVEQDSTDSE 1007 Query: 519 DVRHVSSQVAYQ 484 + Q+A++ Sbjct: 1008 NAGDFLKQMAWE 1019 >gb|PNT01502.1| hypothetical protein POPTR_015G105400v3 [Populus trichocarpa] Length = 1041 Score = 62.4 bits (150), Expect = 2e-07 Identities = 33/72 (45%), Positives = 44/72 (61%) Frame = -2 Query: 699 KQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYSG 520 +QGL L ATCSTLV + AG D A +L+ MVRF WVPDST +DLIN + + S Sbjct: 963 EQGLNLSLATCSTLVRCFHKAGKMDGAARVLKSMVRFKWVPDSTELNDLINVEQDSTDSE 1022 Query: 519 DVRHVSSQVAYQ 484 + Q+A++ Sbjct: 1023 NAGDFLKQMAWE 1034 >ref|XP_011463221.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Fragaria vesca subsp. vesca] ref|XP_011463222.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Fragaria vesca subsp. vesca] Length = 1019 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHEL-YNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSY 526 G+QG L ATC TLVH Y +G +K A ILE M+R GWV +ST+ SDLIN+ + Sbjct: 955 GEQGFVLSLATCKTLVHGFFYKSGNTEKAARILESMLRLGWVSESTSMSDLINDEDQSEA 1014 Query: 525 SGDV 514 S + Sbjct: 1015 SSGI 1018 >ref|XP_024170855.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Rosa chinensis] gb|PRQ16862.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 1019 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHEL-YNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSY 526 G+QG L TC TLVH Y +G ++ A ILE M+RFGWV +ST+ SDLIN +++ Sbjct: 955 GEQGFVLSLTTCKTLVHGFFYKSGNAERAARILESMLRFGWVSESTSISDLINNEEQNEA 1014 Query: 525 SGDV 514 S + Sbjct: 1015 SSGI 1018 >ref|XP_019243407.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana attenuata] ref|XP_019243408.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Nicotiana attenuata] gb|OIT04662.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 921 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/73 (41%), Positives = 43/73 (58%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG G A CSTL L AGY +K+ LE MV+F W+ +S TS+DLI + D ++ Sbjct: 844 GEQGFVPGIAMCSTLAQGLDKAGYSEKLPMALETMVKFSWISNSMTSTDLITRCQMDGHT 903 Query: 522 GDVRHVSSQVAYQ 484 V + Q A++ Sbjct: 904 ESVSNPPKQSAFE 916 >ref|XP_018505647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X1 [Pyrus x bretschneideri] ref|XP_018505648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 1026 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A I M+RFGWV ST DLI+E + ++ S Sbjct: 964 GEQGFMLSLATCSTLVRGFYKLGNVEKAARIFGSMLRFGWVSQSTRLDDLIHEDRSEASS 1023 Query: 522 G 520 G Sbjct: 1024 G 1024 >ref|XP_018499034.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Pyrus x bretschneideri] Length = 1026 Score = 60.5 bits (145), Expect = 7e-07 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -2 Query: 702 GKQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYS 523 G+QG L ATCSTLV Y G +K A I M+RFGWV ST DLI+E + ++ S Sbjct: 964 GEQGFMLSLATCSTLVRGFYKLGNVEKAARIFGSMLRFGWVSQSTRLDDLIHEDRSEASS 1023 Query: 522 G 520 G Sbjct: 1024 G 1024 >ref|XP_008392706.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Malus domestica] Length = 214 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = -2 Query: 699 KQGLTLGRATCSTLVHELYNAGYEDKVAGILERMVRFGWVPDSTTSSDLINEHKKDSYSG 520 + G L ATCSTLV Y G +K A I E M+RFGWV ST+ DLI+E + + SG Sbjct: 153 EHGFVLSLATCSTLVRGFYKLGNAEKAARIFESMLRFGWVSHSTSLDDLIHEDQSEVSSG 212