BLASTX nr result
ID: Acanthopanax21_contig00026795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026795 (614 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVE30686.1| hypothetical protein Ccrd_024021 [Cynara carduncu... 53 5e-06 >gb|KVE30686.1| hypothetical protein Ccrd_024021 [Cynara cardunculus var. scolymus] Length = 80 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 612 IHNVVYTRRRGEKLEGKLQIVLQSIIKSGV 523 IHNVVYT R+GEKLEGKLQIVLQS+I GV Sbjct: 30 IHNVVYTPRKGEKLEGKLQIVLQSVINDGV 59