BLASTX nr result
ID: Acanthopanax21_contig00026761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026761 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa] 56 9e-06 >gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa] Length = 581 Score = 55.8 bits (133), Expect = 9e-06 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +2 Query: 392 IKRDREREKGEXXXXXXXXXXXXGKGKICVEEQPDVGGMDELLAVLGYKVRSSD 553 +KRDR+R+K E KGK+ EQ DVGGMDELLAVLGYKV++SD Sbjct: 1 MKRDRDRDKAESSSMAATAAE---KGKMWTAEQADVGGMDELLAVLGYKVKASD 51