BLASTX nr result
ID: Acanthopanax21_contig00026703
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026703 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF38886.1| pentatricopeptide repeat-containing protein, puta... 66 1e-09 ref|XP_015577464.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-09 ref|XP_002313273.1| hypothetical protein POPTR_0009s07140g [Popu... 62 2e-08 gb|PNT19994.1| hypothetical protein POPTR_009G067000v3 [Populus ... 62 2e-08 ref|XP_011036383.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-08 emb|CAN64573.1| hypothetical protein VITISV_010383 [Vitis vinifera] 59 2e-07 ref|XP_012071427.1| pentatricopeptide repeat-containing protein ... 59 4e-07 dbj|GAV76980.1| PPR domain-containing protein/PPR_2 domain-conta... 59 4e-07 gb|OMO53340.1| hypothetical protein CCACVL1_28711 [Corchorus cap... 58 8e-07 gb|OAY52018.1| hypothetical protein MANES_04G050600 [Manihot esc... 58 8e-07 ref|XP_021609392.1| pentatricopeptide repeat-containing protein ... 58 8e-07 gb|POF19798.1| pentatricopeptide repeat-containing protein, chlo... 57 1e-06 ref|XP_018833103.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-06 ref|XP_021671979.1| pentatricopeptide repeat-containing protein ... 57 1e-06 ref|XP_018833102.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-06 ref|XP_023905342.1| putative pentatricopeptide repeat-containing... 57 1e-06 ref|XP_018856948.1| PREDICTED: pentatricopeptide repeat-containi... 56 2e-06 ref|XP_017227669.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_010673794.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|PON74123.1| Tetratricopeptide-like helical domain containing ... 57 2e-06 >gb|EEF38886.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 555 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 ++VFDEM ER++V WNT +GA S++ +Y KA+DLF EM LRSG +PN Sbjct: 65 KKVFDEMLERDVVSWNTLLGAFSVNGFYLKALDLFYEMNLRSGFRPN 111 >ref|XP_015577464.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Ricinus communis] Length = 810 Score = 65.9 bits (159), Expect = 1e-09 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 ++VFDEM ER++V WNT +GA S++ +Y KA+DLF EM LRSG +PN Sbjct: 192 KKVFDEMLERDVVSWNTLLGAFSVNGFYLKALDLFYEMNLRSGFRPN 238 >ref|XP_002313273.1| hypothetical protein POPTR_0009s07140g [Populus trichocarpa] Length = 680 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVFDEM ER++V WN+ IG S+ +YA+A+ LF EM LRSG +PN Sbjct: 62 KRVFDEMLERDVVSWNSVIGVFSVHGFYAEAIHLFCEMNLRSGFRPN 108 >gb|PNT19994.1| hypothetical protein POPTR_009G067000v3 [Populus trichocarpa] Length = 774 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVFDEM ER++V WN+ IG S+ +YA+A+ LF EM LRSG +PN Sbjct: 156 KRVFDEMLERDVVSWNSVIGVFSVHGFYAEAIHLFCEMNLRSGFRPN 202 >ref|XP_011036383.1| PREDICTED: pentatricopeptide repeat-containing protein At1g18485-like [Populus euphratica] Length = 804 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVFDEM ER++V WN+ IG S+ +YA+A+ LF EM LRSG +PN Sbjct: 186 KRVFDEMLERDVVSWNSVIGVFSVHGFYAEAIHLFCEMNLRSGFRPN 232 >emb|CAN64573.1| hypothetical protein VITISV_010383 [Vitis vinifera] Length = 672 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 RVFDEM E+++V WNT IG S++ + + +DLF EM+LRSGL+PN Sbjct: 97 RVFDEMPEKDLVSWNTMIGVFSVNGCWXEVLDLFGEMRLRSGLRPN 142 >ref|XP_012071427.1| pentatricopeptide repeat-containing protein At4g14170 [Jatropha curcas] Length = 795 Score = 58.5 bits (140), Expect = 4e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 RVFDEM ER++V WNT + S++ +Y +A+DLF M LRSG +PN Sbjct: 180 RVFDEMLERDVVSWNTVLRMFSVNGFYVEAIDLFCGMNLRSGFRPN 225 >dbj|GAV76980.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 798 Score = 58.5 bits (140), Expect = 4e-07 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPNS 161 RVFDEM ER++V WNT IG LS++ Y +A+ +R+M RS +KPN+ Sbjct: 192 RVFDEMLERDVVSWNTLIGVLSVNGLYLEALHFYRKMNFRSDIKPNA 238 >gb|OMO53340.1| hypothetical protein CCACVL1_28711 [Corchorus capsularis] Length = 744 Score = 57.8 bits (138), Expect = 8e-07 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +VFDEM ER++V WNT +G +S + +Y +A+ LF +M L SG++PN Sbjct: 120 KVFDEMLERDVVSWNTALGVVSANGFYLEALTLFSQMNLSSGIRPN 165 >gb|OAY52018.1| hypothetical protein MANES_04G050600 [Manihot esculenta] Length = 759 Score = 57.8 bits (138), Expect = 8e-07 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVF+EM ER++V WN+ +G S++ +Y +A+D F +M LRSG +PN Sbjct: 193 KRVFEEMLERDVVSWNSVLGVFSVNGFYVEALDFFCKMHLRSGFRPN 239 >ref|XP_021609392.1| pentatricopeptide repeat-containing protein At4g14170-like [Manihot esculenta] Length = 811 Score = 57.8 bits (138), Expect = 8e-07 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVF+EM ER++V WN+ +G S++ +Y +A+D F +M LRSG +PN Sbjct: 193 KRVFEEMLERDVVSWNSVLGVFSVNGFYVEALDFFCKMHLRSGFRPN 239 >gb|POF19798.1| pentatricopeptide repeat-containing protein, chloroplastic [Quercus suber] Length = 452 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +VFDEM ER+ V WNT IG LS++ Y +A D+F+EM L SG +PN Sbjct: 117 KVFDEMPERDAVSWNTIIGVLSVNGCYGEAHDIFKEMNLDSGFRPN 162 >ref|XP_018833103.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial isoform X2 [Juglans regia] Length = 787 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 RVFDEM ER+ V WNT IG S++ YA+A++LF+EM SG +PN Sbjct: 196 RVFDEMPERDAVSWNTIIGVFSVNCCYAEALNLFKEMNFGSGFRPN 241 >ref|XP_021671979.1| pentatricopeptide repeat-containing protein At4g14170-like [Hevea brasiliensis] Length = 811 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +RVFDEM ER++V WNT +G S++ +Y +A DLF EM L S +PN Sbjct: 193 KRVFDEMLERDVVSWNTVLGVFSVNGFYVEARDLFCEMNLTSRFRPN 239 >ref|XP_018833102.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial isoform X1 [Juglans regia] Length = 814 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 RVFDEM ER+ V WNT IG S++ YA+A++LF+EM SG +PN Sbjct: 196 RVFDEMPERDAVSWNTIIGVFSVNCCYAEALNLFKEMNFGSGFRPN 241 >ref|XP_023905342.1| putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial [Quercus suber] Length = 825 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 +VFDEM ER+ V WNT IG LS++ Y +A D+F+EM L SG +PN Sbjct: 207 KVFDEMPERDAVSWNTIIGVLSVNGCYGEAHDIFKEMNLDSGFRPN 252 >ref|XP_018856948.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like, partial [Juglans regia] Length = 219 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 RVFDEM ER+ V WNT IG S++ Y +A++LF+EM SG +PN Sbjct: 117 RVFDEMPERDAVSWNTIIGVFSVNCCYVEALNLFKEMNFGSGFRPN 162 >ref|XP_017227669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like isoform X1 [Daucus carota subsp. sativus] ref|XP_017227670.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14170-like isoform X2 [Daucus carota subsp. sativus] Length = 787 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = +3 Query: 18 ERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPNS 161 ERVFDEM ER++V WNT IG S S Y KAV FREM LR+ K NS Sbjct: 196 ERVFDEMLERDVVSWNTVIGVFSGSGLYEKAVMGFREMNLRALCKGNS 243 >ref|XP_010673794.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] ref|XP_010673795.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] gb|KMT14638.1| hypothetical protein BVRB_4g074060 [Beta vulgaris subsp. vulgaris] Length = 812 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +3 Query: 6 FV*GERVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPN 158 FV VF+EM ER++V WNT IG S + W +AV++F EMK+ SGL PN Sbjct: 198 FVGARNVFEEMPERDVVSWNTMIGVFSDNGWSKEAVEVFLEMKIWSGLLPN 248 >gb|PON74123.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 817 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +3 Query: 21 RVFDEMFEREIVLWNTGIGALSISAWYAKAVDLFREMKLRSGLKPNS 161 +VFDEM ER++V WN+ IG S++ W +A++ +REM SG KPNS Sbjct: 199 KVFDEMPERDVVTWNSVIGVFSVNRWNIEALESYREMNSTSGFKPNS 245