BLASTX nr result
ID: Acanthopanax21_contig00026633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026633 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW71531.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus g... 117 2e-28 ref|XP_010055050.1| PREDICTED: tubulin gamma-1 chain [Eucalyptus... 117 7e-28 gb|PON97520.1| Gamma tubulin [Trema orientalis] 115 2e-27 gb|PON71274.1| Gamma tubulin [Parasponia andersonii] 115 2e-27 ref|XP_021653324.1| tubulin gamma-1 chain [Hevea brasiliensis] >... 115 3e-27 ref|XP_011074284.1| tubulin gamma-1 chain [Sesamum indicum] 115 3e-27 ref|XP_012083257.1| tubulin gamma-1 chain [Jatropha curcas] >gi|... 115 3e-27 gb|PKI76620.1| hypothetical protein CRG98_002929 [Punica granatum] 115 3e-27 emb|CDP15053.1| unnamed protein product [Coffea canephora] 115 3e-27 ref|XP_022011258.1| tubulin gamma-1 chain [Helianthus annuus] 115 4e-27 gb|OTF94464.1| putative gamma-tubulin [Helianthus annuus] 115 4e-27 gb|OWM68683.1| hypothetical protein CDL15_Pgr023648 [Punica gran... 115 4e-27 ref|XP_018630825.1| PREDICTED: tubulin gamma-1 chain isoform X2 ... 114 5e-27 ref|XP_021612132.1| tubulin gamma-1 chain [Manihot esculenta] >g... 114 5e-27 ref|XP_021887540.1| LOW QUALITY PROTEIN: tubulin gamma-1 chain [... 114 7e-27 ref|XP_018827898.1| PREDICTED: tubulin gamma-1 chain [Juglans re... 114 7e-27 gb|KVH89050.1| hypothetical protein Ccrd_008966 [Cynara carduncu... 114 8e-27 gb|ABF19052.1| gamma-tubulin, partial [Nicotiana tabacum] 114 9e-27 ref|XP_022035745.1| tubulin gamma-1 chain-like [Helianthus annuu... 114 1e-26 ref|XP_015889384.1| PREDICTED: tubulin gamma-1 chain [Ziziphus j... 114 1e-26 >gb|KCW71531.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus grandis] Length = 356 Score = 117 bits (292), Expect = 2e-28 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKLA+ Sbjct: 302 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLAV 356 >ref|XP_010055050.1| PREDICTED: tubulin gamma-1 chain [Eucalyptus grandis] gb|KCW71530.1| hypothetical protein EUGRSUZ_E00075 [Eucalyptus grandis] Length = 474 Score = 117 bits (292), Expect = 7e-28 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKLA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLAV 474 >gb|PON97520.1| Gamma tubulin [Trema orientalis] Length = 467 Score = 115 bits (289), Expect = 2e-27 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA+GTVDPKLA+ Sbjct: 413 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLAV 467 >gb|PON71274.1| Gamma tubulin [Parasponia andersonii] Length = 474 Score = 115 bits (289), Expect = 2e-27 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA+GTVDPKLA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLAV 474 >ref|XP_021653324.1| tubulin gamma-1 chain [Hevea brasiliensis] ref|XP_021653326.1| tubulin gamma-1 chain [Hevea brasiliensis] Length = 474 Score = 115 bits (288), Expect = 3e-27 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKL + Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLTV 474 >ref|XP_011074284.1| tubulin gamma-1 chain [Sesamum indicum] Length = 474 Score = 115 bits (288), Expect = 3e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+L+GEGNATGTVDPKLA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILSGEGNATGTVDPKLAV 474 >ref|XP_012083257.1| tubulin gamma-1 chain [Jatropha curcas] gb|KDP28521.1| hypothetical protein JCGZ_14292 [Jatropha curcas] Length = 474 Score = 115 bits (288), Expect = 3e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDP LA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPNLAV 474 >gb|PKI76620.1| hypothetical protein CRG98_002929 [Punica granatum] Length = 456 Score = 115 bits (287), Expect = 3e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA GTVDPKLA+ Sbjct: 402 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNAMGTVDPKLAV 456 >emb|CDP15053.1| unnamed protein product [Coffea canephora] Length = 462 Score = 115 bits (287), Expect = 3e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTG+GNATGTVDPKLA+ Sbjct: 408 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHLLTGDGNATGTVDPKLAV 462 >ref|XP_022011258.1| tubulin gamma-1 chain [Helianthus annuus] Length = 474 Score = 115 bits (287), Expect = 4e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKLA+ Sbjct: 420 DLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLAM 474 >gb|OTF94464.1| putative gamma-tubulin [Helianthus annuus] Length = 475 Score = 115 bits (287), Expect = 4e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKLA+ Sbjct: 420 DLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLAM 474 >gb|OWM68683.1| hypothetical protein CDL15_Pgr023648 [Punica granatum] Length = 483 Score = 115 bits (287), Expect = 4e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA GTVDPKLA+ Sbjct: 429 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNAMGTVDPKLAV 483 >ref|XP_018630825.1| PREDICTED: tubulin gamma-1 chain isoform X2 [Nicotiana tomentosiformis] Length = 408 Score = 114 bits (284), Expect = 5e-27 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRD+IESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA+GTVDPKL++ Sbjct: 354 DLSEFDESRDVIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLSL 408 >ref|XP_021612132.1| tubulin gamma-1 chain [Manihot esculenta] gb|OAY62195.1| hypothetical protein MANES_01G249000 [Manihot esculenta] Length = 473 Score = 114 bits (286), Expect = 5e-27 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLA 163 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGTVDPKL+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTVDPKLS 473 >ref|XP_021887540.1| LOW QUALITY PROTEIN: tubulin gamma-1 chain [Carica papaya] Length = 474 Score = 114 bits (285), Expect = 7e-27 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDI+ESLVDEYKACESPDYIKWGMEDPDH+LTGEGNA GTVDPKLA+ Sbjct: 420 DLSEFDESRDILESLVDEYKACESPDYIKWGMEDPDHILTGEGNAAGTVDPKLAV 474 >ref|XP_018827898.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] ref|XP_018827899.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] ref|XP_018827900.1| PREDICTED: tubulin gamma-1 chain [Juglans regia] Length = 474 Score = 114 bits (285), Expect = 7e-27 Identities = 53/55 (96%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPD VLTGEGNATGTVDPKLA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDQVLTGEGNATGTVDPKLAV 474 >gb|KVH89050.1| hypothetical protein Ccrd_008966 [Cynara cardunculus var. scolymus] Length = 485 Score = 114 bits (285), Expect = 8e-27 Identities = 52/55 (94%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEG+ATGTVDPKLA+ Sbjct: 431 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGSATGTVDPKLAM 485 >gb|ABF19052.1| gamma-tubulin, partial [Nicotiana tabacum] Length = 464 Score = 114 bits (284), Expect = 9e-27 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRD+IESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA+GTVDPKL++ Sbjct: 410 DLSEFDESRDVIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPKLSL 464 >ref|XP_022035745.1| tubulin gamma-1 chain-like [Helianthus annuus] gb|OTG29325.1| putative tubulin gamma-2 chain [Helianthus annuus] Length = 474 Score = 114 bits (284), Expect = 1e-26 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDE+RDIIESLVDEYKACESPDYIKWGMEDPDH+LTGEGNATGT+DPKLA+ Sbjct: 420 DLSEFDEARDIIESLVDEYKACESPDYIKWGMEDPDHILTGEGNATGTLDPKLAM 474 >ref|XP_015889384.1| PREDICTED: tubulin gamma-1 chain [Ziziphus jujuba] ref|XP_015889385.1| PREDICTED: tubulin gamma-1 chain [Ziziphus jujuba] ref|XP_015889386.1| PREDICTED: tubulin gamma-1 chain [Ziziphus jujuba] Length = 474 Score = 114 bits (284), Expect = 1e-26 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = +2 Query: 2 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNATGTVDPKLAI 166 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNA+GTVDP LA+ Sbjct: 420 DLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPDHVLTGEGNASGTVDPNLAV 474