BLASTX nr result
ID: Acanthopanax21_contig00026558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026558 (558 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV71540.1| Chromo domain-containing protein, partial [Cepha... 53 8e-06 >dbj|GAV71540.1| Chromo domain-containing protein, partial [Cephalotus follicularis] Length = 100 Score = 52.8 bits (125), Expect = 8e-06 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 4/58 (6%) Frame = +3 Query: 3 VQWENLPLEESTWMDYHLLKQLYPTLHLEGKVSLKGVGIVTEE----NEGQTVDEDGI 164 VQW N+P EE+TW + L+ L+PTLHLE KVS G G T + NE + ED + Sbjct: 24 VQWTNMPPEEATWENLRELQDLFPTLHLEDKVSFVGSGNDTNQQTQLNEEEVTAEDEV 81