BLASTX nr result
ID: Acanthopanax21_contig00026552
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026552 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN02906.1| hypothetical protein DCAR_011662 [Daucus carota s... 63 2e-08 ref|XP_017238322.1| PREDICTED: KH domain-containing protein At4g... 63 2e-08 ref|XP_017238321.1| PREDICTED: KH domain-containing protein At4g... 63 2e-08 emb|CDP01585.1| unnamed protein product [Coffea canephora] 59 4e-07 ref|XP_011099966.1| KH domain-containing protein HEN4 isoform X2... 57 2e-06 ref|XP_019185695.1| PREDICTED: KH domain-containing protein HEN4... 57 2e-06 ref|XP_019185694.1| PREDICTED: KH domain-containing protein HEN4... 57 2e-06 ref|XP_011099964.1| KH domain-containing protein HEN4 isoform X1... 57 2e-06 >gb|KZN02906.1| hypothetical protein DCAR_011662 [Daucus carota subsp. sativus] Length = 475 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFILPEL 322 +ISGASI VEDPC KS+ VIISGTL I +A SLLQAF+LP+L Sbjct: 431 QISGASIVVEDPCAGKSYRNVIISGTLHSIMVARSLLQAFVLPQL 475 >ref|XP_017238322.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X2 [Daucus carota subsp. sativus] Length = 542 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFILPEL 322 +ISGASI VEDPC KS+ VIISGTL I +A SLLQAF+LP+L Sbjct: 498 QISGASIVVEDPCAGKSYRNVIISGTLHSIMVARSLLQAFVLPQL 542 >ref|XP_017238321.1| PREDICTED: KH domain-containing protein At4g18375-like isoform X1 [Daucus carota subsp. sativus] Length = 560 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFILPEL 322 +ISGASI VEDPC KS+ VIISGTL I +A SLLQAF+LP+L Sbjct: 516 QISGASIVVEDPCAGKSYRNVIISGTLHSIMVARSLLQAFVLPQL 560 >emb|CDP01585.1| unnamed protein product [Coffea canephora] Length = 607 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFIL 331 EISGA+I +EDP P K GKVIISGT +RIQIA SLLQAF+L Sbjct: 565 EISGATILLEDPAPGKCDGKVIISGTPERIQIAQSLLQAFML 606 >ref|XP_011099966.1| KH domain-containing protein HEN4 isoform X2 [Sesamum indicum] Length = 518 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFI 334 EISGA+I ++DP P +S GKVIISGT RIQIA SLLQAFI Sbjct: 476 EISGATIVLQDPSPGESSGKVIISGTPGRIQIAQSLLQAFI 516 >ref|XP_019185695.1| PREDICTED: KH domain-containing protein HEN4 isoform X2 [Ipomoea nil] Length = 596 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFI 334 EISG +T+EDP P ++ GKVII+GT DRIQIA SLLQAFI Sbjct: 554 EISGTKVTLEDPHPGENNGKVIITGTPDRIQIARSLLQAFI 594 >ref|XP_019185694.1| PREDICTED: KH domain-containing protein HEN4 isoform X1 [Ipomoea nil] Length = 600 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFI 334 EISG +T+EDP P ++ GKVII+GT DRIQIA SLLQAFI Sbjct: 558 EISGTKVTLEDPHPGENNGKVIITGTPDRIQIARSLLQAFI 598 >ref|XP_011099964.1| KH domain-containing protein HEN4 isoform X1 [Sesamum indicum] Length = 660 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 456 EISGASITVEDPCPDKSFGKVIISGTLDRIQIACSLLQAFI 334 EISGA+I ++DP P +S GKVIISGT RIQIA SLLQAFI Sbjct: 618 EISGATIVLQDPSPGESSGKVIISGTPGRIQIAQSLLQAFI 658