BLASTX nr result
ID: Acanthopanax21_contig00026533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026533 (655 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO96327.1| hypothetical protein COLO4_15341 [Corchorus olito... 54 1e-06 gb|OMO57607.1| cystic fibrosis transmembrane conductance regulat... 54 2e-06 >gb|OMO96327.1| hypothetical protein COLO4_15341 [Corchorus olitorius] Length = 42 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 575 DCADSGIPPMLGV**SPDSISSVAQIECST 486 DCAD GIPPMLGV SPDSI SVAQIECST Sbjct: 13 DCADCGIPPMLGVWESPDSIKSVAQIECST 42 >gb|OMO57607.1| cystic fibrosis transmembrane conductance regulator-like protein [Corchorus olitorius] Length = 65 Score = 53.9 bits (128), Expect = 2e-06 Identities = 28/43 (65%), Positives = 30/43 (69%), Gaps = 2/43 (4%) Frame = -2 Query: 558 HSSNAGSMIKPRFDQFRCPNRMFYLTQSP--SSGMAAWHGLRV 436 H SNAGSM KPRF+QF CPNRMFYLTQ + GMA G V Sbjct: 18 HYSNAGSMGKPRFNQFHCPNRMFYLTQISFRNGGMAYKRGFPV 60