BLASTX nr result
ID: Acanthopanax21_contig00026521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026521 (674 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012071032.1| uncharacterized protein LOC105633105 [Jatrop... 57 8e-06 >ref|XP_012071032.1| uncharacterized protein LOC105633105 [Jatropha curcas] gb|KDP39293.1| hypothetical protein JCGZ_01050 [Jatropha curcas] Length = 327 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 1/32 (3%) Frame = +2 Query: 2 RPSVGQWFGCAVGDLAGPIIVSFFLGKA-HTD 94 RPSVGQW GCAVGDLAGPI+VSF L KA HTD Sbjct: 295 RPSVGQWIGCAVGDLAGPIVVSFCLEKALHTD 326