BLASTX nr result
ID: Acanthopanax21_contig00026173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00026173 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017231283.1| PREDICTED: uncharacterized protein LOC108205... 57 2e-06 >ref|XP_017231283.1| PREDICTED: uncharacterized protein LOC108205744 isoform X2 [Daucus carota subsp. sativus] Length = 505 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 VGNLIRIRAPWKEVRIMAKDEIVILSTYFSQL 96 VGN IRI +PWKEVR+M KDEIVILSTYFSQ+ Sbjct: 468 VGNSIRIYSPWKEVRVMEKDEIVILSTYFSQI 499