BLASTX nr result
ID: Acanthopanax21_contig00025714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025714 (636 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045776.1| orf115b (mitochondrion) [Batis maritima] >gi... 75 5e-14 >ref|YP_009045776.1| orf115b (mitochondrion) [Batis maritima] gb|AIC83379.1| orf115b (mitochondrion) [Batis maritima] Length = 115 Score = 75.5 bits (184), Expect = 5e-14 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = -3 Query: 634 KITPHPFSYMRYRQKKELLILETDP*PPHGAVHSKLRTKERLNKD 500 KITPHPFSYMRY QKKELLIL + P GAVHSKLRTKERLNKD Sbjct: 71 KITPHPFSYMRYHQKKELLILVLETDPSLGAVHSKLRTKERLNKD 115