BLASTX nr result
ID: Acanthopanax21_contig00025656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025656 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM99368.1| hypothetical protein DCAR_013270 [Daucus carota s... 57 1e-07 ref|XP_017243933.1| PREDICTED: ubiquitin domain-containing prote... 57 1e-07 ref|XP_006377742.1| hypothetical protein POPTR_0011s10900g [Popu... 55 5e-07 ref|XP_022847759.1| ubiquitin domain-containing protein 1-like [... 55 7e-07 ref|XP_002317449.1| hypothetical protein POPTR_0011s10900g [Popu... 55 7e-07 gb|PNT12803.1| hypothetical protein POPTR_011G107700v3 [Populus ... 55 8e-07 gb|PNT59051.1| hypothetical protein POPTR_001G387400v3 [Populus ... 54 1e-06 gb|OMO74705.1| hypothetical protein CCACVL1_16508 [Corchorus cap... 55 1e-06 ref|XP_007021914.2| PREDICTED: ubiquitin domain-containing prote... 55 1e-06 ref|XP_009342907.1| PREDICTED: ubiquitin domain-containing prote... 55 1e-06 gb|EOY13439.1| Ubiquitin domain-containing protein [Theobroma ca... 55 1e-06 ref|XP_021287840.1| ubiquitin domain-containing protein 1-like i... 55 1e-06 ref|XP_021814947.1| ubiquitin domain-containing protein 1-like [... 54 1e-06 ref|XP_019153934.1| PREDICTED: ubiquitin domain-containing prote... 54 1e-06 ref|XP_011002754.1| PREDICTED: ubiquitin domain-containing prote... 54 1e-06 ref|XP_008226386.1| PREDICTED: ubiquitin domain-containing prote... 54 1e-06 ref|XP_002524525.1| PREDICTED: ubiquitin domain-containing prote... 54 1e-06 ref|XP_006370109.1| hypothetical protein POPTR_0001s39570g [Popu... 54 1e-06 gb|PPR80415.1| hypothetical protein GOBAR_AA40298 [Gossypium bar... 54 1e-06 gb|KJB13011.1| hypothetical protein B456_002G050900 [Gossypium r... 54 1e-06 >gb|KZM99368.1| hypothetical protein DCAR_013270 [Daucus carota subsp. sativus] Length = 102 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WKLPQ IT+SQLMQMREEFW Sbjct: 11 GEVKKIRKPKPWKLPQVITQSQLMQMREEFW 41 >ref|XP_017243933.1| PREDICTED: ubiquitin domain-containing protein 1-like [Daucus carota subsp. sativus] Length = 112 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WKLPQ IT+SQLMQMREEFW Sbjct: 11 GEVKKIRKPKPWKLPQVITQSQLMQMREEFW 41 >ref|XP_006377742.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa] Length = 95 Score = 55.1 bits (131), Expect = 5e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQLMQMR+EFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLMQMRDEFW 43 >ref|XP_022847759.1| ubiquitin domain-containing protein 1-like [Olea europaea var. sylvestris] Length = 112 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 100 MAGGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 M G +KKIRKP WK PQ ITKSQL+Q+REEFW Sbjct: 9 MKGNVKKIRKPKPWKHPQLITKSQLIQLREEFW 41 >ref|XP_002317449.1| hypothetical protein POPTR_0011s10900g [Populus trichocarpa] ref|XP_011044053.1| PREDICTED: ubiquitin domain-containing protein 1-like [Populus euphratica] Length = 114 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQLMQMR+EFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLMQMRDEFW 43 >gb|PNT12803.1| hypothetical protein POPTR_011G107700v3 [Populus trichocarpa] Length = 115 Score = 55.1 bits (131), Expect = 8e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQLMQMR+EFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLMQMRDEFW 43 >gb|PNT59051.1| hypothetical protein POPTR_001G387400v3 [Populus trichocarpa] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GSAKKIRKPKPWKHPQPITKSQLLQMREEFW 43 >gb|OMO74705.1| hypothetical protein CCACVL1_16508 [Corchorus capsularis] Length = 114 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLVQMREEFW 43 >ref|XP_007021914.2| PREDICTED: ubiquitin domain-containing protein 1 [Theobroma cacao] ref|XP_021287841.1| ubiquitin domain-containing protein 1-like isoform X2 [Herrania umbratica] gb|OMO92527.1| hypothetical protein COLO4_17510 [Corchorus olitorius] Length = 114 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLVQMREEFW 43 >ref|XP_009342907.1| PREDICTED: ubiquitin domain-containing protein 1-like [Pyrus x bretschneideri] Length = 114 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ +TKSQL+QMREEFW Sbjct: 13 GALKKIRKPKPWKHPQPLTKSQLLQMREEFW 43 >gb|EOY13439.1| Ubiquitin domain-containing protein [Theobroma cacao] Length = 114 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLVQMREEFW 43 >ref|XP_021287840.1| ubiquitin domain-containing protein 1-like isoform X1 [Herrania umbratica] Length = 116 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GNVKKIRKPKPWKHPQPITKSQLVQMREEFW 43 >ref|XP_021814947.1| ubiquitin domain-containing protein 1-like [Prunus avium] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KK+RKP WK PQ +TKSQL+QMREEFW Sbjct: 13 GALKKVRKPKPWKHPQPLTKSQLLQMREEFW 43 >ref|XP_019153934.1| PREDICTED: ubiquitin domain-containing protein 1-like [Ipomoea nil] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KKIRKP WK PQ ITKSQLMQ+REEFW Sbjct: 13 GTVKKIRKPKPWKHPQPITKSQLMQLREEFW 43 >ref|XP_011002754.1| PREDICTED: ubiquitin domain-containing protein 1-like [Populus euphratica] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GNAKKIRKPKPWKHPQPITKSQLLQMREEFW 43 >ref|XP_008226386.1| PREDICTED: ubiquitin domain-containing protein 1 [Prunus mume] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G +KK+RKP WK PQ +TKSQL+QMREEFW Sbjct: 13 GALKKVRKPKPWKHPQPLTKSQLLQMREEFW 43 >ref|XP_002524525.1| PREDICTED: ubiquitin domain-containing protein 1 [Ricinus communis] gb|EEF37852.1| Ubiquitin domain-containing protein, putative [Ricinus communis] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G MKKIRKP WK PQ ITKSQL+QMR+EFW Sbjct: 13 GTMKKIRKPKPWKHPQPITKSQLVQMRDEFW 43 >ref|XP_006370109.1| hypothetical protein POPTR_0001s39570g [Populus trichocarpa] gb|PNT59052.1| hypothetical protein POPTR_001G387400v3 [Populus trichocarpa] Length = 114 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -3 Query: 94 GGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 G KKIRKP WK PQ ITKSQL+QMREEFW Sbjct: 13 GSAKKIRKPKPWKHPQPITKSQLLQMREEFW 43 >gb|PPR80415.1| hypothetical protein GOBAR_AA40298 [Gossypium barbadense] Length = 115 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 100 MAGGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 + G +KKIRKP WK PQ ITKSQL QMREEFW Sbjct: 12 LGGNVKKIRKPKPWKHPQPITKSQLEQMREEFW 44 >gb|KJB13011.1| hypothetical protein B456_002G050900 [Gossypium raimondii] Length = 115 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 100 MAGGMKKIRKPTAWKLPQAITKSQLMQMREEFW 2 + G +KKIRKP WK PQ ITKSQL QMREEFW Sbjct: 12 LGGNVKKIRKPKPWKHPQPITKSQLEQMREEFW 44