BLASTX nr result
ID: Acanthopanax21_contig00025453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025453 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019161096.1| PREDICTED: protein SCO1 homolog 1, mitochond... 85 3e-16 ref|XP_020587653.1| protein SCO1 homolog 1, mitochondrial [Phala... 84 5e-16 gb|PIA48540.1| hypothetical protein AQUCO_01400851v1 [Aquilegia ... 83 1e-15 ref|XP_020697208.1| protein SCO1 homolog 1, mitochondrial isofor... 82 3e-15 ref|XP_017244438.1| PREDICTED: protein SCO1 homolog 1, mitochond... 82 3e-15 ref|XP_006366947.1| PREDICTED: protein SCO1 homolog 1, mitochond... 82 3e-15 ref|XP_020996299.1| protein SCO1 homolog 1, mitochondrial isofor... 81 4e-15 ref|XP_020697207.1| protein SCO1 homolog 1, mitochondrial isofor... 82 4e-15 ref|XP_010255751.1| PREDICTED: protein SCO1 homolog 1, mitochond... 82 5e-15 ref|XP_013648110.1| protein SCO1 homolog 1, mitochondrial isofor... 79 5e-15 ref|XP_013648109.1| protein SCO1 homolog 1, mitochondrial isofor... 79 5e-15 ref|XP_015961010.1| protein SCO1 homolog 1, mitochondrial isofor... 81 7e-15 ref|XP_016198597.1| protein SCO1 homolog 1, mitochondrial [Arach... 80 1e-14 emb|CDY07895.1| BnaC03g36280D [Brassica napus] 79 1e-14 gb|KFK38282.1| hypothetical protein AALP_AA3G094000 [Arabis alpina] 80 1e-14 gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thal... 79 2e-14 ref|XP_023760206.1| protein SCO1 homolog 1, mitochondrial [Lactu... 80 2e-14 ref|XP_022016199.1| protein SCO1 homolog 1, mitochondrial-like [... 80 2e-14 ref|XP_021970769.1| protein SCO1 homolog 1, mitochondrial-like [... 79 2e-14 ref|XP_009135077.1| PREDICTED: protein SCO1 homolog 1, mitochond... 79 2e-14 >ref|XP_019161096.1| PREDICTED: protein SCO1 homolog 1, mitochondrial [Ipomoea nil] Length = 335 Score = 84.7 bits (208), Expect = 3e-16 Identities = 37/43 (86%), Positives = 43/43 (100%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKKV 405 VDHSI+MYLMDPNM+FVKF+GKN+DVD+LTDG+IKEIKQYKKV Sbjct: 291 VDHSIVMYLMDPNMEFVKFFGKNNDVDSLTDGVIKEIKQYKKV 333 >ref|XP_020587653.1| protein SCO1 homolog 1, mitochondrial [Phalaenopsis equestris] Length = 287 Score = 83.6 bits (205), Expect = 5e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLMDPNM+FVKFYGKN+DVD+L DGIIKEIKQYKK Sbjct: 246 VDHSIVMYLMDPNMEFVKFYGKNYDVDSLADGIIKEIKQYKK 287 >gb|PIA48540.1| hypothetical protein AQUCO_01400851v1 [Aquilegia coerulea] Length = 325 Score = 83.2 bits (204), Expect = 1e-15 Identities = 36/42 (85%), Positives = 42/42 (100%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSIIMYLMDPNM++VKF+GKNHDVD+LTDGIIKEI++YKK Sbjct: 284 VDHSIIMYLMDPNMEYVKFFGKNHDVDSLTDGIIKEIREYKK 325 >ref|XP_020697208.1| protein SCO1 homolog 1, mitochondrial isoform X2 [Dendrobium catenatum] Length = 287 Score = 81.6 bits (200), Expect = 3e-15 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM+PNM+FVKFYGKN+DVD+L DGIIKEIKQYKK Sbjct: 246 VDHSIVMYLMNPNMEFVKFYGKNYDVDSLADGIIKEIKQYKK 287 >ref|XP_017244438.1| PREDICTED: protein SCO1 homolog 1, mitochondrial [Daucus carota subsp. sativus] gb|KZM97240.1| hypothetical protein DCAR_015398 [Daucus carota subsp. sativus] Length = 329 Score = 82.0 bits (201), Expect = 3e-15 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSIIMYLMDPNMQFVKFYGKNHDVD+LTDG+I+EI QY K Sbjct: 284 VDHSIIMYLMDPNMQFVKFYGKNHDVDSLTDGVIQEIHQYIK 325 >ref|XP_006366947.1| PREDICTED: protein SCO1 homolog 1, mitochondrial [Solanum tuberosum] Length = 336 Score = 82.0 bits (201), Expect = 3e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKKV 405 VDHSI+MYLMDP M+FVKF+GKN+DVD LTDGIIKEIKQYKKV Sbjct: 292 VDHSIVMYLMDPKMEFVKFFGKNNDVDMLTDGIIKEIKQYKKV 334 >ref|XP_020996299.1| protein SCO1 homolog 1, mitochondrial isoform X2 [Arachis duranensis] Length = 264 Score = 80.9 bits (198), Expect = 4e-15 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM PNM+FVKF+GKN+DVD+LTDGIIKEIKQYKK Sbjct: 223 VDHSIVMYLMGPNMEFVKFFGKNNDVDSLTDGIIKEIKQYKK 264 >ref|XP_020697207.1| protein SCO1 homolog 1, mitochondrial isoform X1 [Dendrobium catenatum] gb|PKU71858.1| Protein SCO1 like 1, mitochondrial [Dendrobium catenatum] Length = 325 Score = 81.6 bits (200), Expect = 4e-15 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM+PNM+FVKFYGKN+DVD+L DGIIKEIKQYKK Sbjct: 284 VDHSIVMYLMNPNMEFVKFYGKNYDVDSLADGIIKEIKQYKK 325 >ref|XP_010255751.1| PREDICTED: protein SCO1 homolog 1, mitochondrial [Nelumbo nucifera] Length = 394 Score = 82.0 bits (201), Expect = 5e-15 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKKV 405 VDHSIIMYLM P+M+FVKF+GKNHDVDTLT G+IKEIKQYKKV Sbjct: 352 VDHSIIMYLMGPDMEFVKFFGKNHDVDTLTGGVIKEIKQYKKV 394 >ref|XP_013648110.1| protein SCO1 homolog 1, mitochondrial isoform X2 [Brassica napus] ref|XP_013648115.1| protein SCO1 homolog 1, mitochondrial-like [Brassica napus] Length = 207 Score = 79.3 bits (194), Expect = 5e-15 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QY+K Sbjct: 166 VDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 207 >ref|XP_013648109.1| protein SCO1 homolog 1, mitochondrial isoform X1 [Brassica napus] Length = 207 Score = 79.3 bits (194), Expect = 5e-15 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QY+K Sbjct: 166 VDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 207 >ref|XP_015961010.1| protein SCO1 homolog 1, mitochondrial isoform X1 [Arachis duranensis] ref|XP_015961011.1| protein SCO1 homolog 1, mitochondrial isoform X1 [Arachis duranensis] ref|XP_015961012.1| protein SCO1 homolog 1, mitochondrial isoform X1 [Arachis duranensis] Length = 320 Score = 80.9 bits (198), Expect = 7e-15 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM PNM+FVKF+GKN+DVD+LTDGIIKEIKQYKK Sbjct: 279 VDHSIVMYLMGPNMEFVKFFGKNNDVDSLTDGIIKEIKQYKK 320 >ref|XP_016198597.1| protein SCO1 homolog 1, mitochondrial [Arachis ipaensis] Length = 320 Score = 80.5 bits (197), Expect = 1e-14 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM PNM+FVKF+GKN+D+D+LTDGIIKEIKQYKK Sbjct: 279 VDHSIVMYLMGPNMEFVKFFGKNNDIDSLTDGIIKEIKQYKK 320 >emb|CDY07895.1| BnaC03g36280D [Brassica napus] Length = 246 Score = 79.3 bits (194), Expect = 1e-14 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QY+K Sbjct: 205 VDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 246 >gb|KFK38282.1| hypothetical protein AALP_AA3G094000 [Arabis alpina] Length = 328 Score = 80.5 bits (197), Expect = 1e-14 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QYKK Sbjct: 287 VDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYKK 328 >gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thaliana] Length = 273 Score = 79.3 bits (194), Expect = 2e-14 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QY+K Sbjct: 232 VDHSIVMYLMSPEMNFVKFYGKNHDVDSLTDGVVKEIRQYRK 273 >ref|XP_023760206.1| protein SCO1 homolog 1, mitochondrial [Lactuca sativa] gb|PLY88236.1| hypothetical protein LSAT_8X101621 [Lactuca sativa] Length = 315 Score = 79.7 bits (195), Expect = 2e-14 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSIIMYLMDPNM+F+KF+GKN+DVD LT+GII EIKQYKK Sbjct: 271 VDHSIIMYLMDPNMEFIKFFGKNNDVDALTEGIINEIKQYKK 312 >ref|XP_022016199.1| protein SCO1 homolog 1, mitochondrial-like [Helianthus annuus] gb|OTF91243.1| putative electron transport SCO1/SenC family protein [Helianthus annuus] Length = 317 Score = 79.7 bits (195), Expect = 2e-14 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKKV 405 VDHSIIMYLMDPNM+F+KF+GKN+D+D LT+GII EIKQY+KV Sbjct: 273 VDHSIIMYLMDPNMEFIKFFGKNNDIDALTEGIINEIKQYRKV 315 >ref|XP_021970769.1| protein SCO1 homolog 1, mitochondrial-like [Helianthus annuus] gb|OTG23412.1| putative SCO1-like protein [Helianthus annuus] Length = 309 Score = 79.3 bits (194), Expect = 2e-14 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSIIMYLMDPNM+FVKF+GKN+DVD LT+GI+ EIKQYKK Sbjct: 265 VDHSIIMYLMDPNMEFVKFFGKNNDVDALTEGILNEIKQYKK 306 >ref|XP_009135077.1| PREDICTED: protein SCO1 homolog 1, mitochondrial-like [Brassica rapa] Length = 316 Score = 79.3 bits (194), Expect = 2e-14 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -1 Query: 533 VDHSIIMYLMDPNMQFVKFYGKNHDVDTLTDGIIKEIKQYKK 408 VDHSI+MYLM P M FVKFYGKNHDVD+LTDG++KEI+QY+K Sbjct: 275 VDHSIVMYLMSPEMSFVKFYGKNHDVDSLTDGVVKEIRQYRK 316