BLASTX nr result
ID: Acanthopanax21_contig00025427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025427 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236494.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-22 gb|KZN06977.1| hypothetical protein DCAR_007814 [Daucus carota s... 79 2e-22 ref|XP_018826801.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-17 ref|XP_019077990.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-17 emb|CAN66615.1| hypothetical protein VITISV_022030 [Vitis vinifera] 72 2e-17 emb|CBI31086.3| unnamed protein product, partial [Vitis vinifera] 72 2e-17 ref|XP_011096747.1| pentatricopeptide repeat-containing protein ... 70 3e-16 ref|XP_022845877.1| pentatricopeptide repeat-containing protein ... 72 3e-16 ref|XP_022022504.1| pentatricopeptide repeat-containing protein ... 62 1e-15 ref|XP_016448989.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-15 ref|XP_009605798.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-15 ref|XP_023901197.1| pentatricopeptide repeat-containing protein ... 66 2e-15 gb|PIN17740.1| hypothetical protein CDL12_09585 [Handroanthus im... 69 2e-15 gb|POE49844.1| pentatricopeptide repeat-containing protein [Quer... 66 2e-15 gb|KZV29380.1| pentatricopeptide repeat-containing protein [Dorc... 65 4e-15 ref|XP_023750169.1| pentatricopeptide repeat-containing protein ... 63 6e-15 ref|XP_015063761.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-14 gb|OVA14993.1| Pentatricopeptide repeat [Macleaya cordata] 69 2e-14 ref|XP_019238217.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-14 ref|XP_023901196.1| pentatricopeptide repeat-containing protein ... 66 2e-14 >ref|XP_017236494.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236495.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236497.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236498.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236500.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236501.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236502.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236503.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236505.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236506.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236507.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236508.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236509.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236510.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236511.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] ref|XP_017236512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Daucus carota subsp. sativus] Length = 842 Score = 79.0 bits (193), Expect(2) = 1e-22 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 YSFPYVIKAC GLHAVKLGKL+H M++L GFELDV+VSSSLIK Sbjct: 136 YSFPYVIKACSGLHAVKLGKLVHDMVRLRGFELDVYVSSSLIK 178 Score = 55.5 bits (132), Expect(2) = 1e-22 Identities = 35/82 (42%), Positives = 46/82 (56%), Gaps = 2/82 (2%) Frame = -3 Query: 376 SQLV--GRRGLVGALVSSPIAKNG*IFMPSCVTELSETTRVLLWPW*STCIVAYYADIMG 203 SQ+V G +GL+G + G F + + + W W I+ + +MG Sbjct: 60 SQIVVNGIKGLLGTRILGMYILCGKYFDAKSLFFQLDLSYASPWNW----IIRGFT-MMG 114 Query: 202 CFDFALLVYFKMLSYGTLPDKY 137 CFDFAL+VYFKMLSYGTLPDKY Sbjct: 115 CFDFALVVYFKMLSYGTLPDKY 136 >gb|KZN06977.1| hypothetical protein DCAR_007814 [Daucus carota subsp. sativus] Length = 515 Score = 79.0 bits (193), Expect(2) = 2e-22 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 YSFPYVIKAC GLHAVKLGKL+H M++L GFELDV+VSSSLIK Sbjct: 25 YSFPYVIKACSGLHAVKLGKLVHDMVRLRGFELDVYVSSSLIK 67 Score = 54.7 bits (130), Expect(2) = 2e-22 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MGCFDFAL+VYFKMLSYGTLPDKY Sbjct: 1 MMGCFDFALVVYFKMLSYGTLPDKY 25 >ref|XP_018826801.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Juglans regia] Length = 850 Score = 71.6 bits (174), Expect(2) = 2e-17 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FPYVIKAC GL+ V LGKL+HG I+LMGFELDVFV SSLIK Sbjct: 151 YTFPYVIKACIGLNNVNLGKLVHGTIQLMGFELDVFVGSSLIK 193 Score = 45.1 bits (105), Expect(2) = 2e-17 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 ++G FDFALL YFKML YGT PDKY Sbjct: 127 VLGRFDFALLFYFKMLGYGTSPDKY 151 >ref|XP_019077990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Vitis vinifera] Length = 853 Score = 72.0 bits (175), Expect(2) = 2e-17 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKACGGL++V LG+++H I+ MGFELDVFV SSLIKF Sbjct: 148 YTFPYVIKACGGLNSVALGRVVHDKIQFMGFELDVFVGSSLIKF 191 Score = 44.3 bits (103), Expect(2) = 2e-17 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG FDFALL YFKML GTLPDKY Sbjct: 124 MMGQFDFALLFYFKMLGCGTLPDKY 148 >emb|CAN66615.1| hypothetical protein VITISV_022030 [Vitis vinifera] Length = 818 Score = 72.0 bits (175), Expect(2) = 2e-17 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKACGGL++V LG+++H I+ MGFELDVFV SSLIKF Sbjct: 148 YTFPYVIKACGGLNSVALGRVVHDKIQFMGFELDVFVGSSLIKF 191 Score = 44.3 bits (103), Expect(2) = 2e-17 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG FDFALL YFKML GTLPDKY Sbjct: 124 MMGQFDFALLFYFKMLGCGTLPDKY 148 >emb|CBI31086.3| unnamed protein product, partial [Vitis vinifera] Length = 766 Score = 72.0 bits (175), Expect(2) = 2e-17 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKACGGL++V LG+++H I+ MGFELDVFV SSLIKF Sbjct: 148 YTFPYVIKACGGLNSVALGRVVHDKIQFMGFELDVFVGSSLIKF 191 Score = 44.3 bits (103), Expect(2) = 2e-17 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG FDFALL YFKML GTLPDKY Sbjct: 124 MMGQFDFALLFYFKMLGCGTLPDKY 148 >ref|XP_011096747.1| pentatricopeptide repeat-containing protein At4g21300 [Sesamum indicum] Length = 845 Score = 70.5 bits (171), Expect(2) = 3e-16 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKAC LHAV L KL+HGMIK GFELDV+V S+L+KF Sbjct: 150 YTFPYVIKACSALHAVDLLKLVHGMIKEFGFELDVYVGSALVKF 193 Score = 42.4 bits (98), Expect(2) = 3e-16 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG +D+ALL YFKML++GT PDKY Sbjct: 126 MMGYYDYALLFYFKMLTFGTSPDKY 150 >ref|XP_022845877.1| pentatricopeptide repeat-containing protein At4g21300 [Olea europaea var. sylvestris] ref|XP_022845878.1| pentatricopeptide repeat-containing protein At4g21300 [Olea europaea var. sylvestris] Length = 857 Score = 71.6 bits (174), Expect(2) = 3e-16 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKACGGL +VKLG IHG+IK +GFE+DV+V S+L+KF Sbjct: 150 YTFPYVIKACGGLRSVKLGTYIHGLIKDLGFEMDVYVGSALVKF 193 Score = 40.8 bits (94), Expect(2) = 3e-16 Identities = 19/39 (48%), Positives = 22/39 (56%) Frame = -3 Query: 253 WPW*STCIVAYYADIMGCFDFALLVYFKMLSYGTLPDKY 137 W W C + G F FA+L YFKML +GT PDKY Sbjct: 117 WNWMIRCFT-----MAGYFGFAILFYFKMLDFGTWPDKY 150 >ref|XP_022022504.1| pentatricopeptide repeat-containing protein At4g21300 [Helianthus annuus] gb|OTF85227.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 832 Score = 62.4 bits (150), Expect(2) = 1e-15 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FPYV+KACG L AV L K +H I++MGFE+DV+V SSLIK Sbjct: 135 YTFPYVVKACGRLGAVGLAKSVHRTIRIMGFEMDVYVGSSLIK 177 Score = 48.5 bits (114), Expect(2) = 1e-15 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MGCFD A+LVYFKML YGT PDKY Sbjct: 111 MMGCFDSAILVYFKMLGYGTCPDKY 135 >ref|XP_016448989.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Nicotiana tabacum] Length = 852 Score = 67.4 bits (163), Expect(2) = 2e-15 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYV+KAC G+++VKLGK +HGM++ +GFE DVFV S+ IKF Sbjct: 151 YTFPYVVKACAGINSVKLGKWLHGMVQSLGFEDDVFVGSAFIKF 194 Score = 42.7 bits (99), Expect(2) = 2e-15 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 IMGCF+ A+L++FKML +GT PDKY Sbjct: 127 IMGCFNLAILLFFKMLVFGTNPDKY 151 >ref|XP_009605798.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Nicotiana tomentosiformis] Length = 852 Score = 67.4 bits (163), Expect(2) = 2e-15 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYV+KAC G+++VKLGK +HGM++ +GFE DVFV S+ IKF Sbjct: 151 YTFPYVVKACAGINSVKLGKWLHGMVQSLGFEDDVFVGSAFIKF 194 Score = 42.7 bits (99), Expect(2) = 2e-15 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 IMGCF+ A+L++FKML +GT PDKY Sbjct: 127 IMGCFNLAILLFFKMLVFGTNPDKY 151 >ref|XP_023901197.1| pentatricopeptide repeat-containing protein At4g21300-like [Quercus suber] Length = 836 Score = 66.2 bits (160), Expect(2) = 2e-15 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FP VIKACGGL+ V+LGKL+H I+L GFE DVFV SSLIK Sbjct: 132 YTFPCVIKACGGLNNVRLGKLVHQTIRLTGFEFDVFVGSSLIK 174 Score = 43.5 bits (101), Expect(2) = 2e-15 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -3 Query: 253 WPW*STCIVAYYADIMGCFDFALLVYFKMLSYGTLPDKY 137 WPW + I A+ +MG FDFALL YFKML G PDKY Sbjct: 97 WPW-NWMIRAF--TMMGWFDFALLFYFKMLGCGISPDKY 132 >gb|PIN17740.1| hypothetical protein CDL12_09585 [Handroanthus impetiginosus] Length = 815 Score = 69.3 bits (168), Expect(2) = 2e-15 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPY+IKACGGLHAV L K +HGMIK + FELDV+V S+L+KF Sbjct: 148 YTFPYLIKACGGLHAVDLVKYVHGMIKDLCFELDVYVGSALVKF 191 Score = 40.4 bits (93), Expect(2) = 2e-15 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG +D+A+L YFKML +GT PDKY Sbjct: 124 MMGYYDYAILFYFKMLIFGTRPDKY 148 >gb|POE49844.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 533 Score = 66.2 bits (160), Expect(2) = 2e-15 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FP VIKACGGL+ V+LGKL+H I+L GFE DVFV SSLIK Sbjct: 153 YTFPCVIKACGGLNNVRLGKLVHQTIRLTGFEFDVFVGSSLIK 195 Score = 43.5 bits (101), Expect(2) = 2e-15 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -3 Query: 253 WPW*STCIVAYYADIMGCFDFALLVYFKMLSYGTLPDKY 137 WPW + I A+ +MG FDFALL YFKML G PDKY Sbjct: 118 WPW-NWMIRAF--TMMGWFDFALLFYFKMLGCGISPDKY 153 >gb|KZV29380.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 752 Score = 64.7 bits (156), Expect(2) = 4e-15 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y++P+VIK+CGGLHAV L K IH MI+ + FELDVFV S+L+KF Sbjct: 59 YTYPFVIKSCGGLHAVDLMKYIHAMIRDLCFELDVFVGSALVKF 102 Score = 44.3 bits (103), Expect(2) = 4e-15 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -3 Query: 208 MGCFDFALLVYFKMLSYGTLPDKYRL*FSI 119 MG FD A+L YFKML++GTLPDKY F I Sbjct: 36 MGYFDLAILFYFKMLAFGTLPDKYTYPFVI 65 >ref|XP_023750169.1| pentatricopeptide repeat-containing protein At4g21300 [Lactuca sativa] ref|XP_023750170.1| pentatricopeptide repeat-containing protein At4g21300 [Lactuca sativa] gb|PLY95771.1| hypothetical protein LSAT_3X20980 [Lactuca sativa] Length = 837 Score = 62.8 bits (151), Expect(2) = 6e-15 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FPYVIKACG L A++L K IH I++MGFE DV+V SSLIK Sbjct: 143 YTFPYVIKACGRLGAIRLAKSIHKTIQMMGFETDVYVGSSLIK 185 Score = 45.4 bits (106), Expect(2) = 6e-15 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MGCFD+A+LVYFKML + T PDKY Sbjct: 119 MMGCFDYAILVYFKMLGHETCPDKY 143 >ref|XP_015063761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Solanum pennellii] Length = 854 Score = 66.6 bits (161), Expect(2) = 1e-14 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKAC G++AV LGK IHG+++ +GFE DVFV S+ IKF Sbjct: 151 YTFPYVIKACAGINAVNLGKWIHGLVQSLGFEDDVFVGSAFIKF 194 Score = 40.8 bits (94), Expect(2) = 1e-14 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 IMG FD A+L++FKML +GT PDKY Sbjct: 127 IMGRFDLAILLFFKMLVFGTYPDKY 151 >gb|OVA14993.1| Pentatricopeptide repeat [Macleaya cordata] Length = 802 Score = 68.9 bits (167), Expect(2) = 2e-14 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKACG L A+ LG+LIH I LMGFE+D+FV SSLIKF Sbjct: 103 YTFPYVIKACGNLSALNLGRLIHEEIFLMGFEMDIFVGSSLIKF 146 Score = 37.7 bits (86), Expect(2) = 2e-14 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG F FALL YFKML G PDKY Sbjct: 79 MMGWFKFALLFYFKMLGCGVSPDKY 103 >ref|XP_019238217.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Nicotiana attenuata] gb|OIT21882.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 856 Score = 67.8 bits (164), Expect(2) = 2e-14 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIKF 1 Y+FPYVIKAC G++AVKLGK +HGM++ GFE DVFV S+ IKF Sbjct: 151 YTFPYVIKACAGINAVKLGKWLHGMVQSSGFEDDVFVGSAFIKF 194 Score = 38.5 bits (88), Expect(2) = 2e-14 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = -3 Query: 253 WPW*STCIVAYYADIMGCFDFALLVYFKMLSYGTLPDKY 137 W W ++ Y IMG F+ A+L++FKML +GT PDKY Sbjct: 118 WNW----LIRGYT-IMGRFNLAILLFFKMLVFGTNPDKY 151 >ref|XP_023901196.1| pentatricopeptide repeat-containing protein At4g21300-like [Quercus suber] Length = 855 Score = 66.2 bits (160), Expect(2) = 2e-14 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 132 YSFPYVIKACGGLHAVKLGKLIHGMIKLMGFELDVFVSSSLIK 4 Y+FP VIKACGGL+ V+LGKL+H I+L GFE DVFV SSLIK Sbjct: 156 YTFPCVIKACGGLNNVRLGKLVHQTIRLTGFEFDVFVGSSLIK 198 Score = 40.0 bits (92), Expect(2) = 2e-14 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -3 Query: 211 IMGCFDFALLVYFKMLSYGTLPDKY 137 +MG FDFALL YFKML G PDKY Sbjct: 132 MMGWFDFALLFYFKMLGCGISPDKY 156