BLASTX nr result
ID: Acanthopanax21_contig00025349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025349 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024024142.1| uncharacterized protein LOC21406235 isoform ... 59 3e-07 dbj|GAV58500.1| LRAT domain-containing protein [Cephalotus folli... 55 7e-06 >ref|XP_024024142.1| uncharacterized protein LOC21406235 isoform X1 [Morus notabilis] Length = 297 Score = 58.5 bits (140), Expect = 3e-07 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = +3 Query: 30 CRFYIRAEHFAAEGEGNREMEILTNRV*KSEIKSGDHIYTYKVFFIYSHH 179 C Y R E E REM +LTNRV +SEIK GDHIYTY+ F YSHH Sbjct: 21 CFNYNRLLRGRREREREREMGLLTNRVERSEIKPGDHIYTYRAIFAYSHH 70 >dbj|GAV58500.1| LRAT domain-containing protein [Cephalotus follicularis] Length = 270 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +3 Query: 72 EGNREMEILTNRV*KSEIKSGDHIYTYKVFFIYSHH 179 +G R+M +LTN V +SEIK+GDHIYTY+ F YSHH Sbjct: 9 QGERKMGLLTNSVERSEIKAGDHIYTYRAVFTYSHH 44