BLASTX nr result
ID: Acanthopanax21_contig00025181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025181 (585 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272799.2| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 gb|PKI53793.1| hypothetical protein CRG98_025799 [Punica granatum] 59 5e-08 ref|XP_020106848.1| pentatricopeptide repeat-containing protein ... 61 1e-07 gb|OAY71773.1| Pentatricopeptide repeat-containing protein [Anan... 61 1e-07 ref|XP_015902092.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_015869106.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 gb|PLY72643.1| hypothetical protein LSAT_3X109820 [Lactuca sativa] 60 1e-07 ref|XP_023735347.1| pentatricopeptide repeat-containing protein ... 60 1e-07 ref|XP_022002411.1| pentatricopeptide repeat-containing protein ... 58 4e-07 ref|XP_022002413.1| pentatricopeptide repeat-containing protein ... 58 4e-07 ref|XP_022002410.1| pentatricopeptide repeat-containing protein ... 58 1e-06 ref|XP_022002412.1| pentatricopeptide repeat-containing protein ... 58 1e-06 gb|OTG03035.1| putative pentatricopeptide repeat protein [Helian... 58 2e-06 gb|PKA56257.1| Pentatricopeptide repeat-containing protein [Apos... 57 2e-06 ref|XP_018724634.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_009413433.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 ref|XP_018685382.1| PREDICTED: uncharacterized protein LOC103994... 56 5e-06 >ref|XP_002272799.2| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X3 [Vitis vinifera] emb|CBI24637.3| unnamed protein product, partial [Vitis vinifera] Length = 242 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEEELAA VKK+ EY+D PKKFL+E+ +KYPKRRS+NLV Sbjct: 203 GEEELAAGVKKECEEYVDYPKKFLEEIEKKYPKRRSVNLV 242 >gb|PKI53793.1| hypothetical protein CRG98_025799 [Punica granatum] Length = 118 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEE LAA+VKK+ EY+D P+KFL+E RKYPKR+S+NLV Sbjct: 79 GEEALAANVKKECYEYMDSPRKFLEEAQRKYPKRKSINLV 118 >ref|XP_020106848.1| pentatricopeptide repeat-containing protein At3g46870-like [Ananas comosus] Length = 246 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GE ELA+SV+KD EY+D P+KFL+EV RKYPKRRSL LV Sbjct: 207 GESELASSVRKDCEEYIDFPEKFLEEVDRKYPKRRSLKLV 246 >gb|OAY71773.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 246 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GE ELA+SV+KD EY+D P+KFL+EV RKYPKRRSL LV Sbjct: 207 GESELASSVRKDCEEYIDFPEKFLEEVDRKYPKRRSLKLV 246 >ref|XP_015902092.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEEEL AS+KK+ +EY+D P++FL+EV +K+PKRRSLNLV Sbjct: 213 GEEELLASIKKEVAEYVDSPEQFLREVAKKHPKRRSLNLV 252 >ref|XP_015869106.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEEEL AS+KK+ +EY+D P++FL+EV +K+PKRRSLNLV Sbjct: 213 GEEELLASIKKEVAEYVDSPEQFLREVAKKHPKRRSLNLV 252 >gb|PLY72643.1| hypothetical protein LSAT_3X109820 [Lactuca sativa] Length = 242 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEEELA+ +K D EYLD PKKFLKEV RKYP+R LNLV Sbjct: 203 GEEELASIIKNDCVEYLDSPKKFLKEVARKYPRRLRLNLV 242 >ref|XP_023735347.1| pentatricopeptide repeat-containing protein At1g62350-like [Lactuca sativa] Length = 246 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEEELA+ +K D EYLD PKKFLKEV RKYP+R LNLV Sbjct: 207 GEEELASIIKNDCVEYLDSPKKFLKEVARKYPRRLRLNLV 246 >ref|XP_022002411.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Helianthus annuus] Length = 161 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G ++LAA VK D EYLD PKKFLKEV R+YPKR LNLV Sbjct: 122 GRDDLAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 161 >ref|XP_022002413.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Helianthus annuus] Length = 161 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G ++LAA VK D EYLD PKKFLKEV R+YPKR LNLV Sbjct: 122 GRDDLAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 161 >ref|XP_022002410.1| pentatricopeptide repeat-containing protein At1g62350-like isoform X1 [Helianthus annuus] Length = 244 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G ++LAA VK D EYLD PKKFLKEV R+YPKR LNLV Sbjct: 205 GRDDLAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 244 >ref|XP_022002412.1| pentatricopeptide repeat-containing protein At1g62350-like isoform X1 [Helianthus annuus] Length = 244 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G ++LAA VK D EYLD PKKFLKEV R+YPKR LNLV Sbjct: 205 GRDDLAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 244 >gb|OTG03035.1| putative pentatricopeptide repeat protein [Helianthus annuus] Length = 306 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G ++LAA VK D EYLD PKKFLKEV R+YPKR LNLV Sbjct: 267 GRDDLAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 306 >gb|PKA56257.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 296 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GEE+LA +++ D +YLD P+KFL+EV +KYPKRRSL LV Sbjct: 257 GEEDLAVAIRSDCEQYLDSPEKFLEEVDKKYPKRRSLKLV 296 >ref|XP_018724634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Eucalyptus grandis] gb|KCW87631.1| hypothetical protein EUGRSUZ_A00034 [Eucalyptus grandis] Length = 236 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 GE++L VK+D EYLD PKKFL+EV RKYPKRRS +LV Sbjct: 197 GEKDLVEFVKRDCVEYLDSPKKFLEEVERKYPKRRSFDLV 236 >ref|XP_009413433.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 247 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G E+LA+ V+KD +EY+D P+KFLKEV +K+PKRRSL LV Sbjct: 208 GLEDLASDVRKDCAEYMDFPEKFLKEVDKKFPKRRSLKLV 247 >ref|XP_018685382.1| PREDICTED: uncharacterized protein LOC103994732 isoform X1 [Musa acuminata subsp. malaccensis] Length = 265 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 583 GEEELAASVKKDGSEYLDPPKKFLKEVGRKYPKRRSLNLV 464 G E+LA+ V+KD +EY+D P+KFLKEV +K+PKRRSL LV Sbjct: 226 GLEDLASDVRKDCAEYMDFPEKFLKEVDKKFPKRRSLKLV 265