BLASTX nr result
ID: Acanthopanax21_contig00025100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025100 (491 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017218606.1| PREDICTED: protein trichome birefringence-li... 128 6e-32 ref|XP_021607982.1| protein trichome birefringence-like 11 [Mani... 127 1e-31 ref|XP_017256319.1| PREDICTED: protein trichome birefringence-li... 125 6e-31 ref|XP_006349228.1| PREDICTED: protein trichome birefringence-li... 125 6e-31 ref|XP_021681324.1| protein trichome birefringence-like 11 isofo... 124 1e-30 gb|AGE32506.1| hypothetical protein 816152, partial [Populus pru... 115 2e-30 ref|XP_021681323.1| protein trichome birefringence-like 11 isofo... 124 2e-30 gb|AQM54271.1| hypothetical protein 816152, partial [Populus pru... 115 2e-30 gb|AGE32507.1| hypothetical protein 816152, partial [Populus pru... 114 3e-30 ref|XP_002520761.1| PREDICTED: protein trichome birefringence-li... 123 4e-30 dbj|GAV60907.1| PC-Esterase domain-containing protein/PMR5N doma... 123 4e-30 ref|XP_011090776.1| protein trichome birefringence-like 10 [Sesa... 121 2e-29 gb|AQM54265.1| hypothetical protein 816152, partial [Populus pru... 112 2e-29 ref|XP_015067277.1| PREDICTED: protein trichome birefringence-li... 121 2e-29 ref|XP_004229426.1| PREDICTED: protein trichome birefringence-li... 121 2e-29 ref|XP_008343051.1| PREDICTED: protein trichome birefringence-li... 113 5e-29 ref|XP_012832475.1| PREDICTED: protein trichome birefringence-li... 120 5e-29 gb|PHT59898.1| Protein trichome birefringence-like 11 [Capsicum ... 120 6e-29 ref|XP_008222981.1| PREDICTED: protein trichome birefringence-li... 120 6e-29 ref|XP_008222980.1| PREDICTED: protein trichome birefringence-li... 120 6e-29 >ref|XP_017218606.1| PREDICTED: protein trichome birefringence-like 10 [Daucus carota subsp. sativus] gb|KZM87458.1| hypothetical protein DCAR_024592 [Daucus carota subsp. sativus] Length = 453 Score = 128 bits (321), Expect = 6e-32 Identities = 62/87 (71%), Positives = 72/87 (82%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSPPALLHRQDCSHWCLPGVPD 180 FK+VLS+Q +KS+ + L+VL V+NM+SRRKDGHSSIYYL P + RQDCSHWCLPGVPD Sbjct: 366 FKEVLSSQLSKSHGSQLEVLDVSNMTSRRKDGHSSIYYLVPHSSHSRQDCSHWCLPGVPD 425 Query: 181 SWNELLYALLLKREASHSMNSPALPTT 261 SWNELLYAL LKREAS MNS + TT Sbjct: 426 SWNELLYALFLKREASLVMNSSKMWTT 452 >ref|XP_021607982.1| protein trichome birefringence-like 11 [Manihot esculenta] gb|OAY61682.1| hypothetical protein MANES_01G208600 [Manihot esculenta] Length = 463 Score = 127 bits (319), Expect = 1e-31 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 3/84 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F DVL SN+S+ LD+L+VTNM++RRKDGH+S+YYL P PA LHRQDCSHWCLPG Sbjct: 372 FYDVLLEHSNESHVMNLDLLNVTNMAARRKDGHASVYYLGPGNGPASLHRQDCSHWCLPG 431 Query: 172 VPDSWNELLYALLLKREASHSMNS 243 VPDSWNELLYAL LKRE+ HS NS Sbjct: 432 VPDSWNELLYALFLKRESVHSQNS 455 >ref|XP_017256319.1| PREDICTED: protein trichome birefringence-like 10 [Daucus carota subsp. sativus] Length = 451 Score = 125 bits (314), Expect = 6e-31 Identities = 55/82 (67%), Positives = 68/82 (82%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSPPALLHRQDCSHWCLPGVPDSW 186 D LSA SN S N ++VL++T+M+SRRKDGHSSIY +PP+ L+RQDCSHWCLPGVPD+W Sbjct: 368 DALSAHSNTSNENTIEVLYITSMTSRRKDGHSSIYQSNPPSALNRQDCSHWCLPGVPDTW 427 Query: 187 NELLYALLLKREASHSMNSPAL 252 NELLY L +KR+A+HS NS L Sbjct: 428 NELLYTLFMKRQAAHSANSSTL 449 >ref|XP_006349228.1| PREDICTED: protein trichome birefringence-like 11 [Solanum tuberosum] Length = 451 Score = 125 bits (314), Expect = 6e-31 Identities = 57/87 (65%), Positives = 73/87 (83%), Gaps = 3/87 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F+DV+SA+SN S LDVL+VT+++SRRKDGHSS+YYL P PA ++RQDCSHWCLPG Sbjct: 362 FRDVMSARSNTSSQGALDVLNVTHLTSRRKDGHSSMYYLGPNVGPAPINRQDCSHWCLPG 421 Query: 172 VPDSWNELLYALLLKREASHSMNSPAL 252 VPD+WNELLYAL +KREA+ ++NS + Sbjct: 422 VPDAWNELLYALFMKREATQTLNSSTI 448 >ref|XP_021681324.1| protein trichome birefringence-like 11 isoform X2 [Hevea brasiliensis] Length = 428 Score = 124 bits (311), Expect = 1e-30 Identities = 57/82 (69%), Positives = 69/82 (84%), Gaps = 3/82 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVL SN+S+ LD+L+VTNM+++RKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 339 DVLLEHSNESHVMNLDLLNVTNMAAQRKDGHASVYYLEPGIGPASLHRQDCSHWCLPGVP 398 Query: 178 DSWNELLYALLLKREASHSMNS 243 DSWNELLYA LLKRE++H+ NS Sbjct: 399 DSWNELLYAFLLKRESAHAQNS 420 >gb|AGE32506.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32508.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32510.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32612.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32613.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32614.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32615.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32616.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32617.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32618.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32619.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32620.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32621.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32622.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32623.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32624.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32625.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32626.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32627.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32628.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32629.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32630.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32631.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32632.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32633.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32634.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32635.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32636.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32637.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32638.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32639.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32640.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32641.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32642.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32643.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32644.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32645.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32646.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32647.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32648.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32649.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32650.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32651.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32652.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32653.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32654.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32655.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54219.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54220.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54221.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54222.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54223.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54224.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54225.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54226.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54227.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54228.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54229.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54230.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54231.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54232.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54233.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54234.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54235.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54236.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54237.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54238.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54239.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54240.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54241.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54242.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54243.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54244.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54245.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54246.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54247.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54248.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54249.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54250.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54251.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54252.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54253.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54255.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54256.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54257.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54258.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54259.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54260.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54261.1| hypothetical protein 816152, partial [Populus euphratica] Length = 93 Score = 115 bits (288), Expect = 2e-30 Identities = 55/78 (70%), Positives = 63/78 (80%), Gaps = 3/78 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVLS SN+S L +L+VT+MS+RRKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 1 DVLSKHSNESQVMNLHLLNVTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVP 60 Query: 178 DSWNELLYALLLKREASH 231 DSWNELLY LLLK+E H Sbjct: 61 DSWNELLYTLLLKQELVH 78 >ref|XP_021681323.1| protein trichome birefringence-like 11 isoform X1 [Hevea brasiliensis] Length = 463 Score = 124 bits (311), Expect = 2e-30 Identities = 57/82 (69%), Positives = 69/82 (84%), Gaps = 3/82 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVL SN+S+ LD+L+VTNM+++RKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 374 DVLLEHSNESHVMNLDLLNVTNMAAQRKDGHASVYYLEPGIGPASLHRQDCSHWCLPGVP 433 Query: 178 DSWNELLYALLLKREASHSMNS 243 DSWNELLYA LLKRE++H+ NS Sbjct: 434 DSWNELLYAFLLKRESAHAQNS 455 >gb|AQM54271.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54273.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54278.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 115 bits (287), Expect = 2e-30 Identities = 54/78 (69%), Positives = 63/78 (80%), Gaps = 3/78 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVLS SN+S L +L+VT+MS+RRKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 1 DVLSKHSNESQVMNLHLLNVTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVP 60 Query: 178 DSWNELLYALLLKREASH 231 DSWNELLY L+LK+E H Sbjct: 61 DSWNELLYTLJLKQELVH 78 >gb|AGE32507.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32509.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32511.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32512.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32513.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32514.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32515.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32516.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32517.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32518.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32519.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32520.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32521.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32522.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32523.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32524.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32525.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32526.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32527.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32528.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32529.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32530.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32531.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32532.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32533.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AGE32610.1| hypothetical protein 816152, partial [Populus euphratica] gb|AGE32611.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54254.1| hypothetical protein 816152, partial [Populus euphratica] gb|AQM54262.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54263.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54264.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54266.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54268.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54269.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54270.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54272.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54274.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54275.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54276.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54277.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54279.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54280.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54281.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54282.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54283.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54284.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54285.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54286.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 114 bits (286), Expect = 3e-30 Identities = 54/78 (69%), Positives = 63/78 (80%), Gaps = 3/78 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVLS SN+S L +L+VT+MS+RRKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 1 DVLSKHSNESQVMNLHLLNVTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVP 60 Query: 178 DSWNELLYALLLKREASH 231 DSWNELLY L+LK+E H Sbjct: 61 DSWNELLYTLILKQELVH 78 >ref|XP_002520761.1| PREDICTED: protein trichome birefringence-like 10 [Ricinus communis] gb|EEF41723.1| conserved hypothetical protein [Ricinus communis] Length = 466 Score = 123 bits (309), Expect = 4e-30 Identities = 60/84 (71%), Positives = 73/84 (86%), Gaps = 3/84 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F D+L QSN+S+ N L++L+VTNM++RRKDGH+S+YYL P PA LHRQDCSHWCLPG Sbjct: 377 FFDMLK-QSNESHLN-LELLNVTNMAARRKDGHASVYYLEPEIGPASLHRQDCSHWCLPG 434 Query: 172 VPDSWNELLYALLLKREASHSMNS 243 VPDSWNELLYALLLK+EA+H+ NS Sbjct: 435 VPDSWNELLYALLLKKEAAHAQNS 458 >dbj|GAV60907.1| PC-Esterase domain-containing protein/PMR5N domain-containing protein [Cephalotus follicularis] Length = 449 Score = 123 bits (308), Expect = 4e-30 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 3/81 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVLSA SNKS LD+L+VT M+++RKDGHSS+YYL P PA +HRQDCSHWCLPGVP Sbjct: 368 DVLSAHSNKSVDMKLDILNVTQMTAQRKDGHSSLYYLGPSEGPASIHRQDCSHWCLPGVP 427 Query: 178 DSWNELLYALLLKREASHSMN 240 DSWNELLYA LKREA+ + N Sbjct: 428 DSWNELLYAFFLKREATRTTN 448 >ref|XP_011090776.1| protein trichome birefringence-like 10 [Sesamum indicum] Length = 456 Score = 121 bits (304), Expect = 2e-29 Identities = 58/84 (69%), Positives = 68/84 (80%), Gaps = 3/84 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F V++A SN S S DVL+VT+M+SRRKDGHSS+YYL P PA L RQDCSHWCLPG Sbjct: 366 FSQVITAHSNVSNSRTFDVLNVTHMTSRRKDGHSSLYYLGPKVGPAPLRRQDCSHWCLPG 425 Query: 172 VPDSWNELLYALLLKREASHSMNS 243 VPD+WNELLYAL+LKREA+ + NS Sbjct: 426 VPDAWNELLYALVLKREANKTSNS 449 >gb|AQM54265.1| hypothetical protein 816152, partial [Populus pruinosa] gb|AQM54267.1| hypothetical protein 816152, partial [Populus pruinosa] Length = 93 Score = 112 bits (281), Expect = 2e-29 Identities = 53/78 (67%), Positives = 62/78 (79%), Gaps = 3/78 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 DVLS SN+S L +L+VT+MS+RRKDGH+S+YYL P PA LHRQDCSHWCLPGVP Sbjct: 1 DVLSKHSNESQVMNLHLLNVTSMSARRKDGHASLYYLGPGRGPASLHRQDCSHWCLPGVP 60 Query: 178 DSWNELLYALLLKREASH 231 DSWNELLY L+ K+E H Sbjct: 61 DSWNELLYTLIXKQELVH 78 >ref|XP_015067277.1| PREDICTED: protein trichome birefringence-like 11 [Solanum pennellii] Length = 451 Score = 121 bits (303), Expect = 2e-29 Identities = 55/87 (63%), Positives = 71/87 (81%), Gaps = 3/87 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F+DV+S +SN S L VL+VT+++SRRKDGHSS+YYL P PA ++RQDCSHWCLPG Sbjct: 362 FRDVMSTRSNMSNQGALHVLNVTHLTSRRKDGHSSMYYLGPNVGPAPINRQDCSHWCLPG 421 Query: 172 VPDSWNELLYALLLKREASHSMNSPAL 252 VPD+WNELLYAL +KREA+ ++NS + Sbjct: 422 VPDAWNELLYALFMKREATQTLNSSTI 448 >ref|XP_004229426.1| PREDICTED: protein trichome birefringence-like 11 [Solanum lycopersicum] Length = 451 Score = 121 bits (303), Expect = 2e-29 Identities = 55/87 (63%), Positives = 71/87 (81%), Gaps = 3/87 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F+DV+S +SN S L VL+VT+++SRRKDGHSS+YYL P PA ++RQDCSHWCLPG Sbjct: 362 FRDVMSTRSNMSNQGALHVLNVTHLTSRRKDGHSSMYYLGPNVGPAPINRQDCSHWCLPG 421 Query: 172 VPDSWNELLYALLLKREASHSMNSPAL 252 VPD+WNELLYAL +KREA+ ++NS + Sbjct: 422 VPDAWNELLYALFMKREATQTLNSSTI 448 >ref|XP_008343051.1| PREDICTED: protein trichome birefringence-like 10 [Malus domestica] Length = 148 Score = 113 bits (283), Expect = 5e-29 Identities = 52/76 (68%), Positives = 63/76 (82%), Gaps = 3/76 (3%) Frame = +1 Query: 7 DVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVP 177 D++S +SN+S+ LD+L+VTNMS RKDGH+S+YYL P PA +H QDCSHWCLPGVP Sbjct: 70 DLISERSNESHVRKLDLLNVTNMSLWRKDGHASLYYLGPETGPASVHHQDCSHWCLPGVP 129 Query: 178 DSWNELLYALLLKREA 225 DSWNELLYAL LKRE+ Sbjct: 130 DSWNELLYALFLKRES 145 >ref|XP_012832475.1| PREDICTED: protein trichome birefringence-like 11 [Erythranthe guttata] gb|EYU41525.1| hypothetical protein MIMGU_mgv1a021660mg [Erythranthe guttata] Length = 468 Score = 120 bits (301), Expect = 5e-29 Identities = 59/91 (64%), Positives = 69/91 (75%), Gaps = 3/91 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F VLS+ SN S S L VL++T+M+SRRKDGHSS+YYL P PA LHRQDCSHWCLPG Sbjct: 378 FSRVLSSHSNLSDSKSLGVLNITHMTSRRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPG 437 Query: 172 VPDSWNELLYALLLKREASHSMNSPALPTTV 264 VPD+WNELLYAL+LKRE + NS + V Sbjct: 438 VPDAWNELLYALVLKREITGKSNSSSFHAQV 468 >gb|PHT59898.1| Protein trichome birefringence-like 11 [Capsicum baccatum] Length = 454 Score = 120 bits (300), Expect = 6e-29 Identities = 54/87 (62%), Positives = 72/87 (82%), Gaps = 3/87 (3%) Frame = +1 Query: 1 FKDVLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPG 171 F+DV+S++SN S L VL+VT+++SRRKDGHSS+YYL P PA ++RQDCSHWCLPG Sbjct: 365 FRDVMSSRSNTSNQGALHVLNVTHLTSRRKDGHSSMYYLGPTVGPAPINRQDCSHWCLPG 424 Query: 172 VPDSWNELLYALLLKREASHSMNSPAL 252 VPD+WNELLYAL +KR+A+ S+N+ + Sbjct: 425 VPDTWNELLYALFMKRKATQSLNTSTI 451 >ref|XP_008222981.1| PREDICTED: protein trichome birefringence-like 10 isoform X2 [Prunus mume] Length = 455 Score = 120 bits (300), Expect = 6e-29 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 3/81 (3%) Frame = +1 Query: 10 VLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVPD 180 VLSA SN S + +D+L+VT M++RRKDGHSS+YYL P PA LHRQDCSHWCLPGVPD Sbjct: 368 VLSAHSNTSKATEIDILNVTRMTARRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPD 427 Query: 181 SWNELLYALLLKREASHSMNS 243 +WNELLYAL LKRE + NS Sbjct: 428 TWNELLYALFLKREMTSKFNS 448 >ref|XP_008222980.1| PREDICTED: protein trichome birefringence-like 10 isoform X1 [Prunus mume] Length = 456 Score = 120 bits (300), Expect = 6e-29 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 3/81 (3%) Frame = +1 Query: 10 VLSAQSNKSYSNPLDVLHVTNMSSRRKDGHSSIYYLSP---PALLHRQDCSHWCLPGVPD 180 VLSA SN S + +D+L+VT M++RRKDGHSS+YYL P PA LHRQDCSHWCLPGVPD Sbjct: 369 VLSAHSNTSKATEIDILNVTRMTARRKDGHSSLYYLGPKVGPAPLHRQDCSHWCLPGVPD 428 Query: 181 SWNELLYALLLKREASHSMNS 243 +WNELLYAL LKRE + NS Sbjct: 429 TWNELLYALFLKREMTSKFNS 449