BLASTX nr result
ID: Acanthopanax21_contig00025021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00025021 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007156013.1| hypothetical protein PHAVU_003G251300g [Phas... 84 3e-16 gb|PNY02187.1| elongation of fatty acids protein a-like [Trifoli... 81 7e-16 gb|KVH92569.1| GNS1/SUR4 membrane protein [Cynara cardunculus va... 82 9e-16 ref|XP_014507646.1| elongation of fatty acids protein 3-like [Vi... 82 1e-15 ref|XP_022009543.1| elongation of fatty acids protein 3-like [He... 82 2e-15 ref|XP_023746349.1| elongation of fatty acids protein 3-like [La... 81 2e-15 ref|XP_023754973.1| elongation of fatty acids protein 3-like [La... 81 3e-15 gb|OTG04068.1| putative ELO family [Helianthus annuus] 80 3e-15 ref|XP_022844803.1| elongation of fatty acids protein 3-like [Ol... 81 3e-15 gb|OTF97878.1| putative ELO family [Helianthus annuus] 82 4e-15 ref|XP_021996854.1| elongation of fatty acids protein 3-like [He... 80 4e-15 ref|XP_006338760.1| PREDICTED: elongation of fatty acids protein... 80 5e-15 ref|XP_017424151.1| PREDICTED: elongation of fatty acids protein... 80 5e-15 ref|XP_020205889.1| elongation of fatty acids protein 3-like [Ca... 80 5e-15 ref|XP_006346848.1| PREDICTED: elongation of fatty acids protein... 80 5e-15 ref|XP_019446776.1| PREDICTED: elongation of fatty acids protein... 79 1e-14 ref|XP_004232095.1| PREDICTED: elongation of fatty acids protein... 79 1e-14 ref|XP_010680921.1| PREDICTED: elongation of fatty acids protein... 79 1e-14 ref|XP_015065259.1| PREDICTED: elongation of fatty acids protein... 79 1e-14 ref|XP_017216376.1| PREDICTED: elongation of fatty acids protein... 79 1e-14 >ref|XP_007156013.1| hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] gb|ESW28007.1| hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] Length = 330 Score = 84.0 bits (206), Expect = 3e-16 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 +IYYLSEHPSIV FRWS QSWG+TW FLF SIASY+L+SLFLHLS Sbjct: 47 LIYYLSEHPSIVGFRWSHAQSWGATWSFLFSSIASYILLSLFLHLS 92 >gb|PNY02187.1| elongation of fatty acids protein a-like [Trifolium pratense] Length = 202 Score = 80.9 bits (198), Expect = 7e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 I YYLSEHPSI++FRWS T SWGSTW FLF SIA+Y+++SLFLHLS Sbjct: 14 IFYYLSEHPSIISFRWSHTHSWGSTWSFLFTSIATYLILSLFLHLS 59 >gb|KVH92569.1| GNS1/SUR4 membrane protein [Cynara cardunculus var. scolymus] Length = 309 Score = 82.4 bits (202), Expect = 9e-16 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +2 Query: 314 MTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 MT+ +IYYLSEHP IVNFRWS TQSWGSTW FLF SI +YV +SL LHL Sbjct: 1 MTRETLIYYLSEHPEIVNFRWSHTQSWGSTWSFLFTSIFTYVFLSLLLHL 50 >ref|XP_014507646.1| elongation of fatty acids protein 3-like [Vigna radiata var. radiata] Length = 290 Score = 82.0 bits (201), Expect = 1e-15 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 +IYYLSEHPSIV FRWS QSWG+TW FLF SIASY+L+SLFLHLS Sbjct: 8 LIYYLSEHPSIVGFRWSHAQSWGATWSFLFYSIASYLLLSLFLHLS 53 >ref|XP_022009543.1| elongation of fatty acids protein 3-like [Helianthus annuus] Length = 307 Score = 81.6 bits (200), Expect = 2e-15 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +2 Query: 308 IAMTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 + +TQ +IYYLSEHP IVNFRWS T SWGSTW FLF SI +Y+L+SL LHL Sbjct: 1 MTLTQKTLIYYLSEHPKIVNFRWSHTHSWGSTWSFLFTSIFAYLLLSLLLHL 52 >ref|XP_023746349.1| elongation of fatty acids protein 3-like [Lactuca sativa] gb|PLY96362.1| hypothetical protein LSAT_4X175741 [Lactuca sativa] Length = 309 Score = 81.3 bits (199), Expect = 2e-15 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 314 MTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 MTQ +IYYLSEHP+IV FRWS T+SWGSTW FLF SI++Y+L++L LHL Sbjct: 1 MTQQTLIYYLSEHPTIVKFRWSHTESWGSTWSFLFTSISAYLLLALLLHL 50 >ref|XP_023754973.1| elongation of fatty acids protein 3-like [Lactuca sativa] Length = 315 Score = 81.3 bits (199), Expect = 3e-15 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +2 Query: 314 MTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 M Q R++YYLSEHPSIVNFRW+ TQSWGSTW FLF SI++Y+ +SL L+L Sbjct: 1 MIQERLMYYLSEHPSIVNFRWNHTQSWGSTWSFLFTSISAYIFLSLLLNL 50 >gb|OTG04068.1| putative ELO family [Helianthus annuus] Length = 265 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +2 Query: 314 MTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 MT +IYYLSEHP+IVNFRWS TQSWGSTW FLF SI +Y+L S+ LHL Sbjct: 1 MTPKTLIYYLSEHPTIVNFRWSHTQSWGSTWSFLFTSILTYLLSSVILHL 50 >ref|XP_022844803.1| elongation of fatty acids protein 3-like [Olea europaea var. sylvestris] Length = 305 Score = 80.9 bits (198), Expect = 3e-15 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 I YYLSEHPSIV FRWS TQSWGSTW FLF SIA+YV VS+FLHL Sbjct: 7 IRYYLSEHPSIVGFRWSHTQSWGSTWSFLFSSIAAYVAVSVFLHL 51 >gb|OTF97878.1| putative ELO family [Helianthus annuus] Length = 419 Score = 81.6 bits (200), Expect = 4e-15 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = +2 Query: 308 IAMTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 + +TQ +IYYLSEHP IVNFRWS T SWGSTW FLF SI +Y+L+SL LHL Sbjct: 1 MTLTQKTLIYYLSEHPKIVNFRWSHTHSWGSTWSFLFTSIFAYLLLSLLLHL 52 >ref|XP_021996854.1| elongation of fatty acids protein 3-like [Helianthus annuus] Length = 301 Score = 80.5 bits (197), Expect = 4e-15 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +2 Query: 314 MTQSRIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 MT +IYYLSEHP+IVNFRWS TQSWGSTW FLF SI +Y+L S+ LHL Sbjct: 1 MTPKTLIYYLSEHPTIVNFRWSHTQSWGSTWSFLFTSILTYLLSSVILHL 50 >ref|XP_006338760.1| PREDICTED: elongation of fatty acids protein 3-like [Solanum tuberosum] Length = 284 Score = 80.1 bits (196), Expect = 5e-15 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 335 YYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 YYLSEHPS+VNFRWS +QSWG+TW FLF SIA+YV+ SLFLHL Sbjct: 7 YYLSEHPSVVNFRWSHSQSWGNTWFFLFTSIAAYVIFSLFLHL 49 >ref|XP_017424151.1| PREDICTED: elongation of fatty acids protein 3-like [Vigna angularis] gb|KOM32324.1| hypothetical protein LR48_Vigan01g188000 [Vigna angularis] dbj|BAT75501.1| hypothetical protein VIGAN_01337300 [Vigna angularis var. angularis] Length = 290 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 +IYYLSEHPSIV FRWS QSWG+TW FLF SIA+Y+++SLFLHLS Sbjct: 8 LIYYLSEHPSIVGFRWSHAQSWGATWSFLFYSIATYLILSLFLHLS 53 >ref|XP_020205889.1| elongation of fatty acids protein 3-like [Cajanus cajan] gb|KYP36005.1| Putative elongation of fatty acids protein 1 [Cajanus cajan] Length = 291 Score = 80.1 bits (196), Expect = 5e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +2 Query: 332 IYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 IYYLSEHP+IV +RWS QSWG+TW FLF SIASY+L+SLFLHLS Sbjct: 6 IYYLSEHPAIVEYRWSHAQSWGATWSFLFSSIASYLLLSLFLHLS 50 >ref|XP_006346848.1| PREDICTED: elongation of fatty acids protein 3-like [Solanum tuberosum] Length = 291 Score = 80.1 bits (196), Expect = 5e-15 Identities = 36/54 (66%), Positives = 47/54 (87%), Gaps = 4/54 (7%) Frame = +2 Query: 314 MTQSRII----YYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 MT+SR+I YYLSEHPSIV FRW+ +QSWG+TW+FLF SI+SY+++S+FLHL Sbjct: 1 MTESRMIQTLRYYLSEHPSIVGFRWTDSQSWGNTWVFLFISISSYIILSVFLHL 54 >ref|XP_019446776.1| PREDICTED: elongation of fatty acids protein 3-like [Lupinus angustifolius] gb|OIW09729.1| hypothetical protein TanjilG_09402 [Lupinus angustifolius] Length = 294 Score = 79.3 bits (194), Expect = 1e-14 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHLS 466 II+YLSEHP+IV FRW+ QSWGSTW FLF SIA+Y+L+SLFLHLS Sbjct: 12 IIFYLSEHPAIVGFRWNHVQSWGSTWSFLFTSIATYLLLSLFLHLS 57 >ref|XP_004232095.1| PREDICTED: elongation of fatty acids protein 3-like [Solanum lycopersicum] Length = 277 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 335 YYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 YYLS+HPS+VNFRWS +QSWG+TW FLF SIA+YV+ SLFLHL Sbjct: 7 YYLSQHPSVVNFRWSHSQSWGNTWFFLFTSIAAYVIFSLFLHL 49 >ref|XP_010680921.1| PREDICTED: elongation of fatty acids protein 3-like [Beta vulgaris subsp. vulgaris] Length = 306 Score = 79.3 bits (194), Expect = 1e-14 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +2 Query: 329 IIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 I YYLSEHPSI+NFRWS++QSWGSTW FLF SI+ Y+++SLFLHL Sbjct: 11 ITYYLSEHPSILNFRWSSSQSWGSTWSFLFTSISLYLILSLFLHL 55 >ref|XP_015065259.1| PREDICTED: elongation of fatty acids protein 3-like [Solanum pennellii] Length = 279 Score = 79.0 bits (193), Expect = 1e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 335 YYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 YYLS+HPS+VNFRWS +QSWG+TW FLF SIA+YV+ SLFLHL Sbjct: 7 YYLSQHPSVVNFRWSHSQSWGNTWFFLFTSIAAYVIFSLFLHL 49 >ref|XP_017216376.1| PREDICTED: elongation of fatty acids protein 3-like [Daucus carota subsp. sativus] Length = 294 Score = 79.0 bits (193), Expect = 1e-14 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +2 Query: 326 RIIYYLSEHPSIVNFRWSATQSWGSTWLFLFGSIASYVLVSLFLHL 463 +I+YYL+EHP I+NFRWS TQSWG+TW FLF SI+ Y+L+S+FLHL Sbjct: 3 KILYYLTEHPLIINFRWSPTQSWGATWSFLFTSISCYILLSVFLHL 48