BLASTX nr result
ID: Acanthopanax21_contig00024574
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00024574 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE53910.1| hypothetical protein CFP56_43376 [Quercus suber] 104 4e-25 gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlise... 82 2e-17 >gb|POE53910.1| hypothetical protein CFP56_43376 [Quercus suber] Length = 166 Score = 104 bits (260), Expect = 4e-25 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = -2 Query: 428 GKTQDRQVADITAIHRVYRPLVHVRALRRKGCVTVESNPSPHGGRGALPSEGGSPSD 258 G TQDRQV DITAIHRV RPL+HVRA+RRKGCV +ESNPSPHGGRGALPSEGGSPSD Sbjct: 45 GNTQDRQVVDITAIHRVPRPLIHVRAVRRKGCV-IESNPSPHGGRGALPSEGGSPSD 100 >gb|EPS59999.1| hypothetical protein M569_14806, partial [Genlisea aurea] Length = 74 Score = 82.0 bits (201), Expect = 2e-17 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -2 Query: 410 QVADITAIHRVYRPLVHVRALRRKGCVTVESNPSPHGGRGALPSEGGSPSD 258 +++ ITAI RV RP++HVRA+RRKGCV + +NPSPHGGRGALPSEGGSPSD Sbjct: 13 RLSTITAISRVIRPIIHVRAVRRKGCV-IGTNPSPHGGRGALPSEGGSPSD 62