BLASTX nr result
ID: Acanthopanax21_contig00024523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00024523 (503 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY39138.1| hypothetical protein CUMW_042100 [Citrus unshiu] 59 3e-08 ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 59 6e-08 gb|ONM06166.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] 57 6e-08 gb|ABG66102.1| Ubiquitin-conjugating enzyme E2-23 kDa, putative,... 59 6e-08 gb|KQJ96917.1| hypothetical protein BRADI_3g27780v3 [Brachypodiu... 59 7e-08 ref|XP_008787423.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 59 8e-08 ref|XP_021674665.1| ubiquitin-conjugating enzyme E2-23 kDa-like ... 59 9e-08 dbj|GAY39139.1| hypothetical protein CUMW_042090 [Citrus unshiu] 59 1e-07 ref|XP_006465385.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 59 1e-07 ref|XP_019705834.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 59 1e-07 ref|XP_020149520.1| ubiquitin-conjugating enzyme E2 4-like [Aegi... 58 1e-07 gb|PPR82062.1| hypothetical protein GOBAR_AA38653 [Gossypium bar... 58 1e-07 ref|XP_022757393.1| ubiquitin-conjugating enzyme E2 4 isoform X2... 58 2e-07 gb|AQK65228.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] 57 2e-07 gb|ESQ46814.1| hypothetical protein EUTSA_v10027948mg [Eutrema s... 58 2e-07 gb|KJB52143.1| hypothetical protein B456_008G248000 [Gossypium r... 58 2e-07 gb|ONM06169.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] 57 2e-07 ref|XP_021604322.1| ubiquitin-conjugating enzyme E2 4-like [Mani... 56 3e-07 ref|XP_015089730.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 57 3e-07 ref|XP_017187715.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 58 3e-07 >dbj|GAY39138.1| hypothetical protein CUMW_042100 [Citrus unshiu] Length = 94 Score = 58.5 bits (140), Expect = 3e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGSTS 394 LLLYPNPSDPLN +AA LMMRDR AY+Q+VKG + S Sbjct: 54 LLLYPNPSDPLNGEAAALMMRDRTAYDQRVKGNNPS 89 >ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 isoform X2 [Glycine max] gb|KRH06622.1| hypothetical protein GLYMA_16G035000 [Glycine max] Length = 155 Score = 59.3 bits (142), Expect = 6e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGS 400 LLLYPNPSDPLN +AA LMMRDR YEQ+VKGG+ Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRATYEQRVKGGT 143 >gb|ONM06166.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] Length = 82 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR YEQKVKG Sbjct: 31 LLLYPNPSDPLNGEAAALMMRDRPVYEQKVKG 62 >gb|ABG66102.1| Ubiquitin-conjugating enzyme E2-23 kDa, putative, expressed [Oryza sativa Japonica Group] dbj|BAF26633.1| Os10g0447100 [Oryza sativa Japonica Group] dbj|BAG90217.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAT11082.1| Os10g0447100 [Oryza sativa Japonica Group] Length = 144 Score = 58.9 bits (141), Expect = 6e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKG 141 >gb|KQJ96917.1| hypothetical protein BRADI_3g27780v3 [Brachypodium distachyon] Length = 145 Score = 58.9 bits (141), Expect = 7e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKG 141 >ref|XP_008787423.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like isoform X1 [Phoenix dactylifera] Length = 157 Score = 58.9 bits (141), Expect = 8e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKG 141 >ref|XP_021674665.1| ubiquitin-conjugating enzyme E2-23 kDa-like isoform X1 [Hevea brasiliensis] Length = 184 Score = 59.3 bits (142), Expect = 9e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRSAYEQKVKG 141 >dbj|GAY39139.1| hypothetical protein CUMW_042090 [Citrus unshiu] Length = 148 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGSTS 394 LLLYPNPSDPLN +AA LMMRDR AY+Q+VKG + S Sbjct: 108 LLLYPNPSDPLNGEAAALMMRDRTAYDQRVKGNNPS 143 >ref|XP_006465385.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Citrus sinensis] gb|KDO76261.1| hypothetical protein CISIN_1g029962mg [Citrus sinensis] Length = 150 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGSTS 394 LLLYPNPSDPLN +AA LMMRDR AY+Q+VKG + S Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRTAYDQRVKGNNPS 145 >ref|XP_019705834.1| PREDICTED: ubiquitin-conjugating enzyme E2 4 [Elaeis guineensis] Length = 177 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQKVKG 141 >ref|XP_020149520.1| ubiquitin-conjugating enzyme E2 4-like [Aegilops tauschii subsp. tauschii] Length = 140 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGST 397 LLLYPNPSDPLN +AA L+MRDR AYEQKVKG T Sbjct: 91 LLLYPNPSDPLNGEAAALLMRDRPAYEQKVKGTLT 125 >gb|PPR82062.1| hypothetical protein GOBAR_AA38653 [Gossypium barbadense] Length = 152 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYE+KVKG Sbjct: 117 LLLYPNPSDPLNGEAAALMMRDRTAYEEKVKG 148 >ref|XP_022757393.1| ubiquitin-conjugating enzyme E2 4 isoform X2 [Durio zibethinus] Length = 143 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQ+VKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRGAYEQRVKG 141 >gb|AQK65228.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] Length = 130 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR YEQKVKG Sbjct: 95 LLLYPNPSDPLNGEAAALMMRDRPVYEQKVKG 126 >gb|ESQ46814.1| hypothetical protein EUTSA_v10027948mg [Eutrema salsugineum] Length = 148 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQ+VKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQRVKG 141 >gb|KJB52143.1| hypothetical protein B456_008G248000 [Gossypium raimondii] Length = 171 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYE+KVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRTAYEEKVKG 141 >gb|ONM06169.1| Ubiquitin-conjugating enzyme E2 4 [Zea mays] Length = 145 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR YEQKVKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPVYEQKVKG 141 >ref|XP_021604322.1| ubiquitin-conjugating enzyme E2 4-like [Manihot esculenta] Length = 88 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVK 409 LLLYPNPSDPLN +AA LMMRDR AYEQ+VK Sbjct: 15 LLLYPNPSDPLNGEAAALMMRDRAAYEQRVK 45 >ref|XP_015089730.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Solanum pennellii] Length = 152 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKGGST 397 LLLYPNPSDPLN +AA LMMRDR AYEQ+VK +T Sbjct: 103 LLLYPNPSDPLNGEAAALMMRDRTAYEQRVKEAAT 137 >ref|XP_017187715.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 [Malus domestica] Length = 176 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 501 LLLYPNPSDPLNCKAAVLMMRDRRAYEQKVKG 406 LLLYPNPSDPLN +AA LMMRDR AYEQ+VKG Sbjct: 110 LLLYPNPSDPLNGEAAALMMRDRPAYEQRVKG 141