BLASTX nr result
ID: Acanthopanax21_contig00023529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00023529 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN09006.1| hypothetical protein DCAR_001662 [Daucus carota s... 62 8e-10 ref|XP_017230606.1| PREDICTED: peamaclein-like [Daucus carota su... 62 2e-09 emb|CDO97247.1| unnamed protein product [Coffea canephora] 58 3e-08 gb|PIN01342.1| hypothetical protein CDL12_26153 [Handroanthus im... 56 1e-07 ref|XP_017225828.1| PREDICTED: peamaclein-like [Daucus carota su... 56 1e-07 gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina] 55 3e-07 gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [... 55 3e-07 gb|PKI71352.1| hypothetical protein CRG98_008211 [Punica granatum] 55 5e-07 ref|XP_012836782.1| PREDICTED: peamaclein [Erythranthe guttata] ... 55 6e-07 ref|XP_021735074.1| peamaclein-like [Chenopodium quinoa] 55 6e-07 emb|CDY50148.1| BnaA01g26080D [Brassica napus] 55 6e-07 ref|XP_006406493.2| peamaclein [Eutrema salsugineum] 55 7e-07 ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa] >... 55 7e-07 emb|CDY22975.1| BnaC03g40940D [Brassica napus] 55 7e-07 ref|XP_013675079.1| peamaclein-like [Brassica napus] 55 7e-07 gb|OMO63301.1| Gibberellin regulated protein [Corchorus olitorius] 54 7e-07 ref|XP_022553918.1| peamaclein-like [Brassica napus] 55 7e-07 gb|PHT41735.1| Gibberellin-regulated protein 8 [Capsicum baccatum] 54 1e-06 ref|XP_010028389.1| PREDICTED: peamaclein [Eucalyptus grandis] >... 54 1e-06 ref|XP_021618047.1| peamaclein-like [Manihot esculenta] >gi|1035... 54 1e-06 >gb|KZN09006.1| hypothetical protein DCAR_001662 [Daucus carota subsp. sativus] Length = 89 Score = 62.0 bits (149), Expect = 8e-10 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 8/82 (9%) Frame = -1 Query: 369 LFLLLLATYFIEPTM--------GTS*GNAREGGPXXXXXXXXXXXXXXXXXKRVPSGTY 214 +F LLLAT IEPTM G G + G VPSGTY Sbjct: 10 VFALLLATCLIEPTMAQDSLNCGGKCKGRCSKAGVSDRCMKYCGICCQKCKC--VPSGTY 67 Query: 213 WNRHQCPCYRVTVSSKGEPKCP 148 N+HQCPCYR VSSKG+PKCP Sbjct: 68 GNKHQCPCYRDMVSSKGKPKCP 89 >ref|XP_017230606.1| PREDICTED: peamaclein-like [Daucus carota subsp. sativus] Length = 116 Score = 62.0 bits (149), Expect = 2e-09 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 8/82 (9%) Frame = -1 Query: 369 LFLLLLATYFIEPTM--------GTS*GNAREGGPXXXXXXXXXXXXXXXXXKRVPSGTY 214 +F LLLAT IEPTM G G + G VPSGTY Sbjct: 37 VFALLLATCLIEPTMAQDSLNCGGKCKGRCSKAGVSDRCMKYCGICCQKCKC--VPSGTY 94 Query: 213 WNRHQCPCYRVTVSSKGEPKCP 148 N+HQCPCYR VSSKG+PKCP Sbjct: 95 GNKHQCPCYRDMVSSKGKPKCP 116 >emb|CDO97247.1| unnamed protein product [Coffea canephora] Length = 89 Score = 58.2 bits (139), Expect = 3e-08 Identities = 35/79 (44%), Positives = 41/79 (51%), Gaps = 5/79 (6%) Frame = -1 Query: 369 LFLLLLATYFIEPTMGTS*GNARE-----GGPXXXXXXXXXXXXXXXXXKRVPSGTYWNR 205 +F LLL+ FIEPTMG S ARE K VPSGT+ N+ Sbjct: 11 IFALLLSNSFIEPTMGVSVYCARECKARCAKAGVRDRCLRYCKICCGKCKCVPSGTHGNK 70 Query: 204 HQCPCYRVTVSSKGEPKCP 148 HQCPCYR +SKG+ KCP Sbjct: 71 HQCPCYRDMKNSKGKAKCP 89 >gb|PIN01342.1| hypothetical protein CDL12_26153 [Handroanthus impetiginosus] Length = 89 Score = 56.2 bits (134), Expect = 1e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR V+SKG+PKCP Sbjct: 62 VPSGTYGNKHQCPCYRDMVNSKGKPKCP 89 >ref|XP_017225828.1| PREDICTED: peamaclein-like [Daucus carota subsp. sativus] gb|KZM81487.1| hypothetical protein DCAR_029100 [Daucus carota subsp. sativus] Length = 89 Score = 56.2 bits (134), Expect = 1e-07 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+H+CPCYR VSSKG+PKCP Sbjct: 62 VPSGTYGNKHECPCYRDMVSSKGKPKCP 89 >gb|KFK39277.1| hypothetical protein AALP_AA3G223500 [Arabis alpina] Length = 63 Score = 54.7 bits (130), Expect = 3e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 36 VPSGTFGNKHQCPCYRDKLSSKGKPKCP 63 >gb|ESQ47946.1| hypothetical protein EUTSA_v10022254mg, partial [Eutrema salsugineum] Length = 67 Score = 54.7 bits (130), Expect = 3e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 40 VPSGTFGNKHQCPCYRDMLSSKGKPKCP 67 >gb|PKI71352.1| hypothetical protein CRG98_008211 [Punica granatum] Length = 88 Score = 54.7 bits (130), Expect = 5e-07 Identities = 32/75 (42%), Positives = 39/75 (52%), Gaps = 5/75 (6%) Frame = -1 Query: 357 LLATYFIEPTMGTS*G-----NAREGGPXXXXXXXXXXXXXXXXXKRVPSGTYWNRHQCP 193 LL++ F+EP M +S N R G K VPSGTY N+HQCP Sbjct: 14 LLSSTFMEPVMASSVYCTKKCNERCGKAGVKDRCLKYCNICCAECKCVPSGTYGNKHQCP 73 Query: 192 CYRVTVSSKGEPKCP 148 CYR +SKG+PKCP Sbjct: 74 CYRDKKNSKGKPKCP 88 >ref|XP_012836782.1| PREDICTED: peamaclein [Erythranthe guttata] gb|EYU37603.1| hypothetical protein MIMGU_mgv1a024675mg [Erythranthe guttata] Length = 93 Score = 54.7 bits (130), Expect = 6e-07 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR SSKG+PKCP Sbjct: 66 VPSGTYGNKHQCPCYRDMRSSKGKPKCP 93 >ref|XP_021735074.1| peamaclein-like [Chenopodium quinoa] Length = 95 Score = 54.7 bits (130), Expect = 6e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+H+CPCYR V+SKG PKCP Sbjct: 68 VPSGTYGNKHECPCYRDMVNSKGNPKCP 95 >emb|CDY50148.1| BnaA01g26080D [Brassica napus] Length = 96 Score = 54.7 bits (130), Expect = 6e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 69 VPSGTFGNKHQCPCYRDKLSSKGKPKCP 96 >ref|XP_006406493.2| peamaclein [Eutrema salsugineum] Length = 97 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 70 VPSGTFGNKHQCPCYRDMLSSKGKPKCP 97 >ref|XP_009135633.1| PREDICTED: peamaclein-like [Brassica rapa] ref|XP_013736428.1| peamaclein-like [Brassica napus] Length = 97 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 70 VPSGTFGNKHQCPCYRDMLSSKGKPKCP 97 >emb|CDY22975.1| BnaC03g40940D [Brassica napus] Length = 97 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 70 VPSGTFGNKHQCPCYRDMLSSKGKPKCP 97 >ref|XP_013675079.1| peamaclein-like [Brassica napus] Length = 98 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 71 VPSGTFGNKHQCPCYRDKLSSKGKPKCP 98 >gb|OMO63301.1| Gibberellin regulated protein [Corchorus olitorius] Length = 88 Score = 54.3 bits (129), Expect = 7e-07 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR ++ KG+PKCP Sbjct: 61 VPSGTYGNKHQCPCYRDKINKKGKPKCP 88 >ref|XP_022553918.1| peamaclein-like [Brassica napus] Length = 103 Score = 54.7 bits (130), Expect = 7e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGT+ N+HQCPCYR +SSKG+PKCP Sbjct: 76 VPSGTFGNKHQCPCYRDMLSSKGKPKCP 103 >gb|PHT41735.1| Gibberellin-regulated protein 8 [Capsicum baccatum] Length = 89 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR +SKG+PKCP Sbjct: 62 VPSGTYGNKHQCPCYRDLKNSKGKPKCP 89 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 322 YLVRKCKGRWSRAGVWD 272 Y +KCKGR S+AG+ D Sbjct: 30 YCAQKCKGRCSKAGLMD 46 >ref|XP_010028389.1| PREDICTED: peamaclein [Eucalyptus grandis] gb|KCW55129.1| hypothetical protein EUGRSUZ_I01086 [Eucalyptus grandis] Length = 87 Score = 53.9 bits (128), Expect = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR +SKG+PKCP Sbjct: 60 VPSGTYGNKHQCPCYRNKKNSKGKPKCP 87 >ref|XP_021618047.1| peamaclein-like [Manihot esculenta] gb|OAY45495.1| hypothetical protein MANES_07G065400 [Manihot esculenta] Length = 88 Score = 53.9 bits (128), Expect = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 231 VPSGTYWNRHQCPCYRVTVSSKGEPKCP 148 VPSGTY N+HQCPCYR +SKG+PKCP Sbjct: 61 VPSGTYGNKHQCPCYRDKKNSKGKPKCP 88