BLASTX nr result
ID: Acanthopanax21_contig00022910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00022910 (610 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37190.3| unnamed protein product, partial [Vitis vinifera] 59 1e-07 ref|XP_010652413.1| PREDICTED: uncharacterized protein LOC100254... 59 1e-06 gb|EOX94324.1| Tetratricopeptide repeat-like superfamily protein... 59 1e-06 dbj|GAV62211.1| TPR_11 domain-containing protein [Cephalotus fol... 57 5e-06 dbj|GAV87988.1| TPR_11 domain-containing protein [Cephalotus fol... 57 5e-06 >emb|CBI37190.3| unnamed protein product, partial [Vitis vinifera] Length = 121 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 139 ILEKYAKLMWELHHDQDRASSYFE*ATPAAPKDRY 35 IL +YAKL+WELHHDQDRASSYFE A AAP+D + Sbjct: 46 ILSQYAKLVWELHHDQDRASSYFERAVQAAPEDSH 80 >ref|XP_010652413.1| PREDICTED: uncharacterized protein LOC100254834 [Vitis vinifera] Length = 370 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 139 ILEKYAKLMWELHHDQDRASSYFE*ATPAAPKDRY 35 IL +YAKL+WELHHDQDRASSYFE A AAP+D + Sbjct: 295 ILSQYAKLVWELHHDQDRASSYFERAVQAAPEDSH 329 >gb|EOX94324.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 3 [Theobroma cacao] Length = 406 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 136 LEKYAKLMWELHHDQDRASSYFE*ATPAAPKDRY 35 L +YAKL+WELHHDQ+RASSYFE A A+P+DRY Sbjct: 342 LSQYAKLVWELHHDQERASSYFERAVQASPQDRY 375 >dbj|GAV62211.1| TPR_11 domain-containing protein [Cephalotus follicularis] Length = 403 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 139 ILEKYAKLMWELHHDQDRASSYFE*ATPAAPKDRY 35 IL KYAKL+WE+HHDQDRA SYFE A AAP+D + Sbjct: 183 ILSKYAKLIWEIHHDQDRALSYFEQAAEAAPQDSH 217 >dbj|GAV87988.1| TPR_11 domain-containing protein [Cephalotus follicularis] Length = 454 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 139 ILEKYAKLMWELHHDQDRASSYFE*ATPAAPKDRY 35 IL +YAKL+WELHHDQDRASSYFE A A+P+D + Sbjct: 377 ILTQYAKLVWELHHDQDRASSYFERAVQASPEDSH 411