BLASTX nr result
ID: Acanthopanax21_contig00022551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00022551 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO52598.1| hypothetical protein COLO4_37081 [Corchorus olito... 53 2e-06 gb|KDO36372.1| hypothetical protein CISIN_1g030964mg [Citrus sin... 53 7e-06 gb|KDO36370.1| hypothetical protein CISIN_1g030964mg [Citrus sin... 53 7e-06 gb|KDO36371.1| hypothetical protein CISIN_1g030964mg [Citrus sin... 53 7e-06 >gb|OMO52598.1| hypothetical protein COLO4_37081 [Corchorus olitorius] Length = 74 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 479 GENPG*KWPVLSPLKTKKYSLFIKIWMTCHASAPVMAKA 363 GENPG K+P P K KK FIK+W+TCHASAPVMAKA Sbjct: 18 GENPG-KFPCELPSKHKKDVDFIKLWVTCHASAPVMAKA 55 >gb|KDO36372.1| hypothetical protein CISIN_1g030964mg [Citrus sinensis] gb|KDO36373.1| hypothetical protein CISIN_1g030964mg [Citrus sinensis] Length = 115 Score = 52.8 bits (125), Expect = 7e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = +3 Query: 363 GLCHDRCACMAGHPNFNK*AIFFGFEGRKHG-----PFLTWVL 476 GLCH RCACMAGH N NK +F G EGR HG P L+ VL Sbjct: 26 GLCHGRCACMAGHQNLNKKYLFCGPEGRSHGSCPGSPLLSVVL 68 >gb|KDO36370.1| hypothetical protein CISIN_1g030964mg [Citrus sinensis] Length = 115 Score = 52.8 bits (125), Expect = 7e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = +3 Query: 363 GLCHDRCACMAGHPNFNK*AIFFGFEGRKHG-----PFLTWVL 476 GLCH RCACMAGH N NK +F G EGR HG P L+ VL Sbjct: 26 GLCHGRCACMAGHQNLNKKYLFCGPEGRSHGSCPGSPLLSVVL 68 >gb|KDO36371.1| hypothetical protein CISIN_1g030964mg [Citrus sinensis] Length = 116 Score = 52.8 bits (125), Expect = 7e-06 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 5/43 (11%) Frame = +3 Query: 363 GLCHDRCACMAGHPNFNK*AIFFGFEGRKHG-----PFLTWVL 476 GLCH RCACMAGH N NK +F G EGR HG P L+ VL Sbjct: 26 GLCHGRCACMAGHQNLNKKYLFCGPEGRSHGSCPGSPLLSVVL 68