BLASTX nr result
ID: Acanthopanax21_contig00021117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax21_contig00021117 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019225632.1| PREDICTED: growth-regulating factor 4-like i... 58 1e-06 ref|XP_009605690.1| PREDICTED: growth-regulating factor 4-like i... 58 1e-06 gb|POE93782.1| growth-regulating factor 3 [Quercus suber] 56 5e-06 ref|XP_023925977.1| growth-regulating factor 4-like [Quercus suber] 56 5e-06 ref|XP_019260216.1| PREDICTED: growth-regulating factor 4-like [... 56 5e-06 ref|XP_006342493.1| PREDICTED: growth-regulating factor 4-like i... 56 5e-06 ref|XP_015162064.1| PREDICTED: growth-regulating factor 5-like i... 56 5e-06 ref|XP_019225630.1| PREDICTED: growth-regulating factor 4-like i... 56 7e-06 ref|XP_009605689.1| PREDICTED: growth-regulating factor 4-like i... 56 7e-06 >ref|XP_019225632.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana attenuata] Length = 355 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDD 444 LDD+ NKN FSTTQLSIS+PM PS++S+RSA SP+D Sbjct: 318 LDDEESNKNNFSTTQLSISIPMAPSDFSSRSACSPND 354 >ref|XP_009605690.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana tomentosiformis] ref|XP_016481859.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana tabacum] Length = 355 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDD 444 LDD+ NKN FSTTQLSIS+PM PS++S+RSA SP+D Sbjct: 318 LDDEESNKNNFSTTQLSISIPMAPSDFSSRSACSPND 354 >gb|POE93782.1| growth-regulating factor 3 [Quercus suber] Length = 310 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDDN 441 L+D+R N+ +FSTTQLSIS+PMT S++SA S+RSP DN Sbjct: 273 LEDERSNQTSFSTTQLSISIPMTTSDFSATSSRSPHDN 310 >ref|XP_023925977.1| growth-regulating factor 4-like [Quercus suber] Length = 332 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDDN 441 L+D+R N+ +FSTTQLSIS+PMT S++SA S+RSP DN Sbjct: 295 LEDERSNQTSFSTTQLSISIPMTTSDFSATSSRSPHDN 332 >ref|XP_019260216.1| PREDICTED: growth-regulating factor 4-like [Nicotiana attenuata] gb|OIT39313.1| growth-regulating factor 4 [Nicotiana attenuata] Length = 349 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDD 444 LDD+ CNKN FS+TQLSIS+PM PS++ +RS+ SP+D Sbjct: 312 LDDEGCNKNNFSSTQLSISIPMAPSDFFSRSSCSPND 348 >ref|XP_006342493.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Solanum tuberosum] Length = 352 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDD 444 LDD+ NKN FSTTQLSIS+PM PS++S+RS+ SP+D Sbjct: 315 LDDEGSNKNNFSTTQLSISIPMAPSDFSSRSSCSPND 351 >ref|XP_015162064.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Solanum tuberosum] Length = 354 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPDD 444 LDD+ NKN FSTTQLSIS+PM PS++S+RS+ SP+D Sbjct: 317 LDDEGSNKNNFSTTQLSISIPMAPSDFSSRSSCSPND 353 >ref|XP_019225630.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana attenuata] ref|XP_019225631.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana attenuata] gb|OIT32536.1| growth-regulating factor 3 [Nicotiana attenuata] Length = 356 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPD 447 LDD+ NKN FSTTQLSIS+PM PS++S+RSA SP+ Sbjct: 318 LDDEESNKNNFSTTQLSISIPMAPSDFSSRSACSPN 353 >ref|XP_009605689.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016481857.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana tabacum] ref|XP_016481858.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana tabacum] Length = 356 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 554 LDDDRCNKNTFSTTQLSISVPMTPSEYSARSARSPD 447 LDD+ NKN FSTTQLSIS+PM PS++S+RSA SP+ Sbjct: 318 LDDEESNKNNFSTTQLSISIPMAPSDFSSRSACSPN 353